2KV8A

Solution structure ofrgs12 pdz domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
83
structure length
83
Chain Sequence
b'PRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of G-protein signaling 12
publication title Determining the Molecular Basis for the pH-dependent Interaction between the PDZ of Human RGS12 and MEK2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2kv8A00
3KZEA 4PQWA 2CS5A 3PV2A 3OU0A 4NNLA 5EYZA 1W9QA 2EEGA 2DKRA 4H11A 1W9EA 3O46A 1TP5A 1WJLA 4GVDA 1U38A 2EEIA 4K78A 2Q3GA 2YTWA 5HFDA 3WKMA 2G2LA 2LUIA 3LNXA 3I1EA 3R69A 4REYA 1I92A 3CBZA 2CSJA 2KL1A 2REYA 1KWAA 5JXBA 1FCFA 5E11A 2KPLA 3SHUA 2QKVA 2UZCA 2AWWA 2DB5A 1QAUA 2F0AA 1VA8A 2W7RA 2EXGA 5GNDA 3FY5A 1R6JA 5G1EA 1XZ9A 2EEJA 5DTHA 2FCFA 4NMRA 3TSZA 5HFCA 2MHOA 1OBXA 1WI4A 1K32A 1G9OA 3QE1A 1WH1A 2OQSA 2KV8A 3PS4A 4JOEA 1GM1A 3STJA 4NMOA 3CH8A 1X6DA 2FN5A 1P1EA 1Q3OA 2I4SA 4JOJA 5HETA 2I6VA 3HPKA 4L8NA 2W4FA 4P2AB 4Q6HA 4Z33A 4GHNA 1T2MA 1N6EA 4GVCA 2H3LA 2KOHA 2KG2A 4JOGA 1X5QA 5HDYA 1KY9A 3KZDA 1KEFA 4HOPA 3SHWA 2G5MB 1QAVA 2YUYA 2L4SA 2Z17A 3QO6A 3RLEA 2GZVA 1X8SA 1RZXA 1OBYA 4Q6SA 1D5GA 2KPKA 2EEHA 1L6OA 4OAJA 1GQ4A 4Q2NA 2I04A 1SOTA 4KFVA 2O2TA 3WKLA 1M5ZA 1PDRA 3DJ3A 5F67A 2AWXA 1WIFA 1OZIA 3O5NA 1RGRA 2FE5A 4Q3HA 3SFJA 4Q2PA 2LC7A 1UM7A 1NTEA 2BYGA 3PV4A 5HFBA 2PA1A 4E35A 1IU2A 3RL8A 2QBWA 3AXAA 3SUZA 5D13A 1WI2A 2WL7A 2YUBA 5F3XA 4NMPA 4E34A 2Q9VA 4JOKA 5EZ0A 4N6XA 2IWNA 2PNTA 1WFVA 4OEPA 1RGWA 1WG6A 1YBOA 3EGHC 4JORA 1UF1A 2EDZA 2D90A 2E7KA 2M0VA 2VRFA 2KOMA 3K1RA 1UFXA 3ID4A 1Q7XA 2PKTA 3GDSA 3ID3A 4KFWA 1Y8TA 4P0CA 4FGMA 2IWOA 5HF1A 2ENOA 3QJMA 2P3WA 2CSSA 4NNMA 2QG1A 2QT5A 3GDVA 4AMHA 4JOHA 3CBYA 3E17A 4YDPA 1N6FA 2RRMA 2D92A 2KJDA 1N7FA 3PV5A 1UEPA 2JOAA 2K1ZA 1X5RA 3DORA 5HEDA 5E1YA 1TE0A 2RCZA 5GLJA 1U37A 4K76A 2KA9A 3GCOA 2EJYA 2KQFA 4EDJA 4Q2OA 2DAZA 2I0LA 1WF8A 1GQ5A 4K72A 1FC6A 2LOBA 1Z86A 1V5QA 3DJAA 3SOEA 4NXQA 2EGNA 3MH4A 3VQFA 3VQGA 2EDVA 5HEBA 2D8IA 1VJ6A 2DLSA 3ID1A 2JWEA 4OEOA 3I18A 5HFFA 3EGGC 3GCNA 4HOPB 2JREA 5HFEA 1QAVB 2VZ5A 1V6BA 1Q3PA 1U3BA 3NFLA 1N99A 2OZFA 5A2PA 3HPMA 4NMTA 2EDPA 3QGLA 4LMMA 4NXPA 3OTPA 4NXRA 4RI0A 5E6PB 1QLCA 1MC7A 1X45A 3QDOA 1WHAA 1MFGA 5HEYA 1NF3C 1BE9A 2OS6A 2ZPMA 2DC2A 2PZDA 2FNEA 2QKUA 5FB8C 2M0UA 5FHTA 1UJUA 2KRGA 2LC6A 3JXTA 1WHDA 2KJPA 1U39A 2EAQA 4K75A 2X7ZA 3GDUA 3GJ9A 4XHVA 3TSVA 3NGHA 2OPGA 4E3BA 1UJDA 1V5LA 2M3MA 3B76A 1LCYA 5HJ1A 3K82A 2L4TA 2DM8A 3CS0A 4JL7A 4IC6A 4UU6A 2V1WA 1UJVA 4O06A 2HGAA 2KJKA 5I7ZA 3R0HA 2H3MA 5E22A 3ZRTA 3ID2A 1N7TA 2MX6A 5G1DA 2DLUA 5H3JA 1P1DA 2EHRA 1VCWA 1UEQA 4K6YA 3NFKA 4JOPA 2HE2A 3CBXA 1ZUBA 2PKUA 4G69A 2AINA 4NMVA 2IWQA 2IWPA 2M0TA 2F5YA 2KBSA 2YT8A 4R2ZA 3GSLA 3KHFA 1Y7NA 2H2CA 2YT7A 1X5NA 2OGPA 2EV8A 2DMZA 3QIKA 1IU0A 3QJNA 5B6LA 3MH7A 1N7EA 3MH6A 2JINA 1Z87A 3PDZA 3LNYA 4YYXA 2KOJA 3BPUA 1IHJA 3RL7A 2KAWA 1RY4A 2LA8A 1FC9A 1VB7A 2L97A 2OMJA 2Z9IA 4WYTA 1UM1A 2QKTA 3L4FD 2M0ZA 1SOZA 1UITA 1OBZA 3CC0A 1UHPA 2JXOA 4Z8JA 1V1TA 1FC7A 3DJ1A 4NMQA 4MPAA 2EGKA 2OCSA 1I16A 4JOFA 2PDZA 1TQ3A 2M10A 1W9OA 2I0IA 4WYUA 3TSWA 2VPHA 2AWUA 1V62A 1B8QA 3DIWA 5E21A 1N6DA 2JIKA 2HE4A 1WFGA 4F8KA 2I1NA 1ZOKA 3R68A 3K50A 3PDVA 2VWRA 2VSPA 2R3YA 5HF4A 1WF7A 1UEZA 2V90A 1MFLA 2JILA 2H2BA 2R4HA 3I4WA 3TMHA 4UU5A 2VSVA 1UEWA 2K20A 2OSGA 4NMSA 1BFEA 3GGEA 1TP3A 2ZPLA 4Q2QA 3CYYA 2KYLA 2EGOA 2DJTA 3HVQC 1VAEA
chains in the Genus database with same CATH superfamily
3KZEA 4FLNA 4PQWA 2CS5A 3PV2A 3OU0A 4NNLA 5EYZA 1W9QA 2EEGA 2DKRA 4H11A 1W9EA 3O46A 1TP5A 1WJLA 4GVDA 1U38A 2EEIA 4K78A 2Q3GA 2YTWA 5HFDA 3WKMA 2G2LA 2LUIA 3LNXA 3I1EA 3R69A 4REYA 1I92A 3CBZA 2CSJA 2KL1A 2REYA 1KWAA 5JXBA 1FCFA 5E11A 2KPLA 4JJ3A 3SHUA 2QKVA 2UZCA 2AWWA 2DB5A 1QAUA 2F0AA 1VA8A 2W7RA 2EXGA 5GNDA 3FY5A 1R6JA 5G1EA 1XZ9A 2EEJA 5DTHA 2FCFA 4NMRA 3TSZA 5HFCA 2MHOA 1OBXA 1WI4A 1K32A 1G9OA 3QE1A 1WH1A 2OQSA 2KV8A 3PS4A 3GABA 4JOEA 1GM1A 3STJA 4NMOA 3CH8A 1X6DA 2FN5A 1P1EA 1Q3OA 2I4SA 4JOJA 2GEFA 5HETA 2I6VA 3HPKA 4L8NA 2W4FA 4P2AB 3NCVA 4Q6HA 4Z33A 4GHNA 1T2MA 1N6EA 4GVCA 2H3LA 2KOHA 2KG2A 4JOGA 1X5QA 5HDYA 2JSNA 1KY9A 3KZDA 1KEFA 4HOPA 3SHWA 2G5MB 1QAVA 2YUYA 2L4SA 2Z17A 3QO6A 3RLEA 2GZVA 1X8SA 1RZXA 1OBYA 4Q6SA 1D5GA 2KPKA 2EEHA 1L6OA 4OAJA 1GQ4A 4Q2NA 2I04A 1SOTA 4KFVA 2O2TA 3WKLA 1M5ZA 1PDRA 3DJ3A 5F67A 2AWXA 1WIFA 1OZIA 3O5NA 1RGRA 2FE5A 4Q3HA 3SFJA 4Q2PA 2LC7A 1UM7A 1NTEA 2BYGA 3PV4A 5HFBA 2PA1A 4E35A 1IU2A 3RL8A 2QBWA 3AXAA 3SUZA 5D13A 1WI2A 2WL7A 2YUBA 5F3XA 4NMPA 4E34A 2Q9VA 4JOKA 5EZ0A 4N6XA 5B42A 2IWNA 2PNTA 1WFVA 4OEPA 1RGWA 1WG6A 1YBOA 3EGHC 4JORA 1UF1A 2EDZA 2D90A 2E7KA 2M0VA 2VRFA 2KOMA 3K1RA 1UFXA 3ID4A 1Q7XA 2PKTA 3GDSA 3ID3A 4KFWA 1Y8TA 4P0CA 4FGMA 2IWOA 5HF1A 2ENOA 3QJMA 2P3WA 2CSSA 4NNMA 2QG1A 2QT5A 3GDVA 4AMHA 4JOHA 3CBYA 3E17A 4YDPA 1N6FA 2RRMA 2D92A 2KJDA 1N7FA 3PV5A 1UEPA 2JOAA 2K1ZA 1X5RA 3DORA 5HEDA 5E1YA 1TE0A 2RCZA 5GLJA 1U37A 4K76A 2KA9A 3GCOA 2EJYA 2KQFA 4EDJA 4Q2OA 2DAZA 2I0LA 1WF8A 1GQ5A 4K72A 1FC6A 2LOBA 1Z86A 1V5QA 3DJAA 3SOEA 4NXQA 2EGNA 3MH4A 3VQFA 3VQGA 2EDVA 5HEBA 2D8IA 1VJ6A 2DLSA 3ID1A 2JWEA 4OEOA 3I18A 5HFFA 3EGGC 3GCNA 4HOPB 2JREA 5HFEA 1QAVB 2VZ5A 1V6BA 1Q3PA 1U3BA 3NFLA 1N99A 2OZFA 5A2PA 3HPMA 4NMTA 2EDPA 3QGLA 4LMMA 4NXPA 3OTPA 4NXRA 4RI0A 5E6PB 1QLCA 1MC7A 1X45A 3QDOA 1WHAA 5IL9A 1MFGA 5HEYA 1NF3C 1BE9A 2OS6A 2ZPMA 2DC2A 2PZDA 2FNEA 2QKUA 5FB8C 3KDKA 2M0UA 5FHTA 1UJUA 2KRGA 2LC6A 4JJ0A 3JXTA 1WHDA 2KJPA 1U39A 2EAQA 4K75A 2X7ZA 3GDUA 3GJ9A 4XHVA 3TSVA 3NGHA 2OPGA 4E3BA 1UJDA 1V5LA 2M3MA 3B76A 1LCYA 5HJ1A 3K82A 2L4TA 2DM8A 3CS0A 4JL7A 5ILBA 4IC6A 4UU6A 2V1WA 1UJVA 4O06A 2HGAA 2KJKA 5I7ZA 3R0HA 2H3MA 5E22A 3ZRTA 3ID2A 1N7TA 2MX6A 5G1DA 2DLUA 5H3JA 1P1DA 2EHRA 1VCWA 1UEQA 4K6YA 3NFKA 4JOPA 2HE2A 3CBXA 1ZUBA 2PKUA 4G69A 2AINA 4NMVA 2IWQA 2IWPA 2M0TA 2F5YA 2KBSA 2YT8A 4R2ZA 3GSLA 3KHFA 1Y7NA 2H2CA 2YT7A 1X5NA 2OGPA 2EV8A 2DMZA 3QIKA 1IU0A 3QJNA 5B6LA 3MH7A 1N7EA 3MH6A 2JINA 1Z87A 3PDZA 3LNYA 4YYXA 2KOJA 3BPUA 1IHJA 3RL7A 2KAWA 1RY4A 2LA8A 1FC9A 1VB7A 2L97A 2OMJA 2Z9IA 4WYTA 1UM1A 2QKTA 3L4FD 2M0ZA 1SOZA 1UITA 1OBZA 1X9ZA 3CC0A 1UHPA 2JXOA 4Z8JA 1V1TA 1FC7A 3DJ1A 4NMQA 4MPAA 2EGKA 2OCSA 1I16A 4JOFA 2PDZA 1TQ3A 2M10A 1W9OA 2I0IA 4WYUA 3TSWA 2VPHA 2AWUA 1V62A 1B8QA 3DIWA 5E21A 1N6DA 2JIKA 2HE4A 1WFGA 4F8KA 2I1NA 1ZOKA 3R68A 3K50A 3PDVA 2VWRA 2VSPA 2R3YA 5HF4A 3KDGA 1WF7A 1UEZA 2V90A 1MFLA 2JILA 2H2BA 2R4HA 3I4WA 3TMHA 4UU5A 2VSVA 1UEWA 2K20A 2OSGA 4NMSA 1BFEA 3GGEA 1TP3A 2ZPLA 4Q2QA 3CYYA 2KYLA 2EGOA 2DJTA 3HVQC 1VAEA
chains in the Genus database with same CATH topology
3KZEA 4FLNA 4PQWA 2CS5A 3PV2A 3OU0A 4NNLA 5EYZA 1W9QA 2EEGA 2DKRA 4H11A 1W9EA 3O46A 1TP5A 1WJLA 4GVDA 1U38A 2EEIA 4K78A 2Q3GA 2YTWA 5HFDA 3WKMA 2G2LA 2LUIA 3LNXA 3I1EA 3R69A 4REYA 1I92A 3CBZA 2CSJA 2KL1A 2REYA 1KWAA 5JXBA 1FCFA 5E11A 2KPLA 4JJ3A 3SHUA 2QKVA 2UZCA 2AWWA 2DB5A 1QAUA 2F0AA 1VA8A 2W7RA 2EXGA 5GNDA 3FY5A 1R6JA 5G1EA 1XZ9A 2EEJA 5DTHA 2FCFA 4NMRA 3TSZA 5HFCA 2MHOA 1OBXA 1WI4A 1K32A 1G9OA 3QE1A 1WH1A 2OQSA 2KV8A 3PS4A 3GABA 4JOEA 1GM1A 3STJA 4NMOA 3CH8A 1X6DA 2FN5A 1P1EA 1Q3OA 2I4SA 4JOJA 2GEFA 5HETA 2I6VA 3HPKA 4L8NA 2W4FA 4P2AB 3NCVA 4Q6HA 4Z33A 4GHNA 1T2MA 1N6EA 4GVCA 2H3LA 2KOHA 2KG2A 4JOGA 1X5QA 5HDYA 2JSNA 1KY9A 3KZDA 1KEFA 4HOPA 3SHWA 2G5MB 1QAVA 2YUYA 2L4SA 2Z17A 3QO6A 3RLEA 2GZVA 1X8SA 1RZXA 1OBYA 4Q6SA 1D5GA 2KPKA 2EEHA 1L6OA 4OAJA 1GQ4A 4Q2NA 2I04A 1SOTA 4KFVA 2O2TA 3WKLA 1M5ZA 1PDRA 3DJ3A 5F67A 2AWXA 1WIFA 1OZIA 3O5NA 1RGRA 2FE5A 4Q3HA 3SFJA 4Q2PA 2LC7A 1UM7A 1NTEA 2BYGA 3PV4A 5HFBA 2PA1A 4E35A 1IU2A 3RL8A 2QBWA 3AXAA 3SUZA 5D13A 1WI2A 2WL7A 2YUBA 5F3XA 4NMPA 4E34A 2Q9VA 4JOKA 5EZ0A 4N6XA 5B42A 2IWNA 2PNTA 1WFVA 4OEPA 1RGWA 1WG6A 1YBOA 3EGHC 4JORA 1UF1A 2EDZA 2D90A 2E7KA 2M0VA 2VRFA 2KOMA 3K1RA 1UFXA 3ID4A 1Q7XA 2PKTA 3GDSA 3ID3A 4KFWA 1Y8TA 4P0CA 4FGMA 2IWOA 5HF1A 2ENOA 3QJMA 2P3WA 2CSSA 4NNMA 2QG1A 2QT5A 3GDVA 4AMHA 4JOHA 3CBYA 3E17A 4YDPA 1N6FA 2RRMA 2D92A 2KJDA 1N7FA 3PV5A 1UEPA 2JOAA 2K1ZA 1X5RA 3DORA 5HEDA 5E1YA 1TE0A 2RCZA 5GLJA 1U37A 4K76A 2KA9A 3GCOA 2EJYA 2KQFA 4EDJA 4Q2OA 2DAZA 2I0LA 1WF8A 1GQ5A 4K72A 1FC6A 2LOBA 1Z86A 1V5QA 3DJAA 3SOEA 4NXQA 2EGNA 3MH4A 3VQFA 3VQGA 2EDVA 5HEBA 2D8IA 1VJ6A 2DLSA 3ID1A 2JWEA 4OEOA 3I18A 5HFFA 3EGGC 3GCNA 4HOPB 2JREA 5HFEA 1QAVB 2VZ5A 1V6BA 1Q3PA 1U3BA 3NFLA 1N99A 2OZFA 5A2PA 3HPMA 4NMTA 2EDPA 3QGLA 4LMMA 4NXPA 3OTPA 4NXRA 4RI0A 5E6PB 1QLCA 1MC7A 1X45A 3QDOA 1WHAA 5IL9A 1MFGA 5HEYA 1NF3C 1BE9A 2OS6A 2ZPMA 2DC2A 2PZDA 2FNEA 2QKUA 5FB8C 3KDKA 2M0UA 5FHTA 1UJUA 2KRGA 2LC6A 4JJ0A 3JXTA 1WHDA 2KJPA 1U39A 2EAQA 4K75A 2X7ZA 3GDUA 3GJ9A 4XHVA 3TSVA 3NGHA 2OPGA 4E3BA 1UJDA 1V5LA 2M3MA 3B76A 1LCYA 5HJ1A 3K82A 2L4TA 2DM8A 3CS0A 4JL7A 5ILBA 4IC6A 4UU6A 2V1WA 1UJVA 4O06A 2HGAA 2KJKA 5I7ZA 3R0HA 2H3MA 5E22A 3ZRTA 3ID2A 1N7TA 2MX6A 5G1DA 2DLUA 5H3JA 1P1DA 2EHRA 1VCWA 1UEQA 4K6YA 3NFKA 4JOPA 2HE2A 3CBXA 1ZUBA 2PKUA 4G69A 2AINA 4NMVA 2IWQA 2IWPA 2M0TA 2F5YA 2KBSA 2YT8A 4R2ZA 3GSLA 3KHFA 1Y7NA 2H2CA 2YT7A 1X5NA 2OGPA 2EV8A 2DMZA 3QIKA 1IU0A 3QJNA 5B6LA 3MH7A 1N7EA 3MH6A 2JINA 1Z87A 3PDZA 3LNYA 4YYXA 2KOJA 3BPUA 1IHJA 3RL7A 2KAWA 1RY4A 2LA8A 1FC9A 1VB7A 2L97A 2OMJA 2Z9IA 4WYTA 1UM1A 2QKTA 3L4FD 2M0ZA 1SOZA 1UITA 1OBZA 1X9ZA 3CC0A 1UHPA 2JXOA 4Z8JA 1V1TA 1FC7A 3DJ1A 4NMQA 4MPAA 2EGKA 2OCSA 1I16A 4JOFA 2PDZA 1TQ3A 2M10A 1W9OA 2I0IA 4WYUA 3TSWA 2VPHA 2AWUA 1V62A 1B8QA 3DIWA 5E21A 1N6DA 2JIKA 2HE4A 1WFGA 4F8KA 2I1NA 1ZOKA 3R68A 3K50A 3PDVA 2VWRA 2VSPA 2R3YA 5HF4A 3KDGA 1WF7A 1UEZA 2V90A 1MFLA 2JILA 2H2BA 2R4HA 3I4WA 3TMHA 4UU5A 2VSVA 1UEWA 2K20A 2OSGA 4NMSA 1BFEA 3GGEA 1TP3A 2ZPLA 4Q2QA 3CYYA 2KYLA 2EGOA 2DJTA 3HVQC 1VAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZE A;  4PQW A;  2CS5 A;  3PV2 A;  3OU0 A;  4NNL A;  5EYZ A;  1W9Q A;  2EEG A;  2DKR A;  4H11 A;  1W9E A;  3O46 A;  1TP5 A;  1WJL A;  4GVD A;  1U38 A;  2EEI A;  4K78 A;  2Q3G A;  2YTW A;  5HFD A;  3WKM A;  2G2L A;  2LUI A;  3LNX A;  3I1E A;  3R69 A;  4REY A;  1I92 A;  3CBZ A;  2CSJ A;  2KL1 A;  2REY A;  1KWA A;  5JXB A;  1FCF A;  5E11 A;  2KPL A;  3SHU A;  2QKV A;  2UZC A;  2AWW A;  2DB5 A;  1QAU A;  2F0A A;  1VA8 A;  2W7R A;  2EXG A;  5GND A;  3FY5 A;  1R6J A;  5G1E A;  1XZ9 A;  2EEJ A;  5DTH A;  2FCF A;  4NMR A;  3TSZ A;  5HFC A;  2MHO A;  1OBX A;  1WI4 A;  1K32 A;  1G9O A;  3QE1 A;  1WH1 A;  2OQS A;  2KV8 A;  3PS4 A;  4JOE A;  1GM1 A;  3STJ A;  4NMO A;  3CH8 A;  1X6D A;  2FN5 A;  1P1E A;  1Q3O A;  2I4S A;  4JOJ A;  5HET A;  2I6V A;  3HPK A;  4L8N A;  2W4F A;  4P2A B;  4Q6H A;  4Z33 A;  4GHN A;  1T2M A;  1N6E A;  4GVC A;  2H3L A;  2KOH A;  2KG2 A;  4JOG A;  1X5Q A;  5HDY A;  1KY9 A;  3KZD A;  1KEF A;  4HOP A;  3SHW A;  2G5M B;  1QAV A;  2YUY A;  2L4S A;  2Z17 A;  3QO6 A;  3RLE A;  2GZV A;  1X8S A;  1RZX A;  1OBY A;  4Q6S A;  1D5G A;  2KPK A;  2EEH A;  1L6O A;  4OAJ A;  1GQ4 A;  4Q2N A;  2I04 A;  1SOT A;  4KFV A;  2O2T A;  3WKL A;  1M5Z A;  1PDR A;  3DJ3 A;  5F67 A;  2AWX A;  1WIF A;  1OZI A;  3O5N A;  1RGR A;  2FE5 A;  4Q3H A;  3SFJ A;  4Q2P A;  2LC7 A;  1UM7 A;  1NTE A;  2BYG A;  3PV4 A;  5HFB A;  2PA1 A;  4E35 A;  1IU2 A;  3RL8 A;  2QBW A;  3AXA A;  3SUZ A;  5D13 A;  1WI2 A;  2WL7 A;  2YUB A;  5F3X A;  4NMP A;  4E34 A;  2Q9V A;  4JOK A;  5EZ0 A;  4N6X A;  2IWN A;  2PNT A;  1WFV A;  4OEP A;  1RGW A;  1WG6 A;  1YBO A;  3EGH C;  4JOR A;  1UF1 A;  2EDZ A;  2D90 A;  2E7K A;  2M0V A;  2VRF A;  2KOM A;  3K1R A;  1UFX A;  3ID4 A;  1Q7X A;  2PKT A;  3GDS A;  3ID3 A;  4KFW A;  1Y8T A;  4P0C A;  4FGM A;  2IWO A;  5HF1 A;  2ENO A;  3QJM A;  2P3W A;  2CSS A;  4NNM A;  2QG1 A;  2QT5 A;  3GDV A;  4AMH A;  4JOH A;  3CBY A;  3E17 A;  4YDP A;  1N6F A;  2RRM A;  2D92 A;  2KJD A;  1N7F A;  3PV5 A;  1UEP A;  2JOA A;  2K1Z A;  1X5R A;  3DOR A;  5HED A;  5E1Y A;  1TE0 A;  2RCZ A;  5GLJ A;  1U37 A;  4K76 A;  2KA9 A;  3GCO A;  2EJY A;  2KQF A;  4EDJ A;  4Q2O A;  2DAZ A;  2I0L A;  1WF8 A;  1GQ5 A;  4K72 A;  1FC6 A;  2LOB A;  1Z86 A;  1V5Q A;  3DJA A;  3SOE A;  4NXQ A;  2EGN A;  3MH4 A;  3VQF A;  3VQG A;  2EDV A;  5HEB A;  2D8I A;  1VJ6 A;  2DLS A;  3ID1 A;  2JWE A;  4OEO A;  3I18 A;  5HFF A;  3EGG C;  3GCN A;  4HOP B;  2JRE A;  5HFE A;  1QAV B;  2VZ5 A;  1V6B A;  1Q3P A;  1U3B A;  3NFL A;  1N99 A;  2OZF A;  5A2P A;  3HPM A;  4NMT A;  2EDP A;  3QGL A;  4LMM A;  4NXP A;  3OTP A;  4NXR A;  4RI0 A;  5E6P B;  1QLC A;  1MC7 A;  1X45 A;  3QDO A;  1WHA A;  1MFG A;  5HEY A;  1NF3 C;  1BE9 A;  2OS6 A;  2ZPM A;  2DC2 A;  2PZD A;  2FNE A;  2QKU A;  5FB8 C;  2M0U A;  5FHT A;  1UJU A;  2KRG A;  2LC6 A;  3JXT A;  1WHD A;  2KJP A;  1U39 A;  2EAQ A;  4K75 A;  2X7Z A;  3GDU A;  3GJ9 A;  4XHV A;  3TSV A;  3NGH A;  2OPG A;  4E3B A;  1UJD A;  1V5L A;  2M3M A;  3B76 A;  1LCY A;  5HJ1 A;  3K82 A;  2L4T A;  2DM8 A;  3CS0 A;  4JL7 A;  4IC6 A;  4UU6 A;  2V1W A;  1UJV A;  4O06 A;  2HGA A;  2KJK A;  5I7Z A;  3R0H A;  2H3M A;  5E22 A;  3ZRT A;  3ID2 A;  1N7T A;  2MX6 A;  5G1D A;  2DLU A;  5H3J A;  1P1D A;  2EHR A;  1VCW A;  1UEQ A;  4K6Y A;  3NFK A;  4JOP A;  2HE2 A;  3CBX A;  1ZUB A;  2PKU A;  4G69 A;  2AIN A;  4NMV A;  2IWQ A;  2IWP A;  2M0T A;  2F5Y A;  2KBS A;  2YT8 A;  4R2Z A;  3GSL A;  3KHF A;  1Y7N A;  2H2C A;  2YT7 A;  1X5N A;  2OGP A;  2EV8 A;  2DMZ A;  3QIK A;  1IU0 A;  3QJN A;  5B6L A;  3MH7 A;  1N7E A;  3MH6 A;  2JIN A;  1Z87 A;  3PDZ A;  3LNY A;  4YYX A;  2KOJ A;  3BPU A;  1IHJ A;  3RL7 A;  2KAW A;  1RY4 A;  2LA8 A;  1FC9 A;  1VB7 A;  2L97 A;  2OMJ A;  2Z9I A;  4WYT A;  1UM1 A;  2QKT A;  3L4F D;  2M0Z A;  1SOZ A;  1UIT A;  1OBZ A;  3CC0 A;  1UHP A;  2JXO A;  4Z8J A;  1V1T A;  1FC7 A;  3DJ1 A;  4NMQ A;  4MPA A;  2EGK A;  2OCS A;  1I16 A;  4JOF A;  2PDZ A;  1TQ3 A;  2M10 A;  1W9O A;  2I0I A;  4WYU A;  3TSW A;  2VPH A;  2AWU A;  1V62 A;  1B8Q A;  3DIW A;  5E21 A;  1N6D A;  2JIK A;  2HE4 A;  1WFG A;  4F8K A;  2I1N A;  1ZOK A;  3R68 A;  3K50 A;  3PDV A;  2VWR A;  2VSP A;  2R3Y A;  5HF4 A;  1WF7 A;  1UEZ A;  2V90 A;  1MFL A;  2JIL A;  2H2B A;  2R4H A;  3I4W A;  3TMH A;  4UU5 A;  2VSV A;  1UEW A;  2K20 A;  2OSG A;  4NMS A;  1BFE A;  3GGE A;  1TP3 A;  2ZPL A;  4Q2Q A;  3CYY A;  2KYL A;  2EGO A;  2DJT A;  3HVQ C;  1VAE A; 
#chains in the Genus database with same CATH topology
 3KZE A;  4FLN A;  4PQW A;  2CS5 A;  3PV2 A;  3OU0 A;  4NNL A;  5EYZ A;  1W9Q A;  2EEG A;  2DKR A;  4H11 A;  1W9E A;  3O46 A;  1TP5 A;  1WJL A;  4GVD A;  1U38 A;  2EEI A;  4K78 A;  2Q3G A;  2YTW A;  5HFD A;  3WKM A;  2G2L A;  2LUI A;  3LNX A;  3I1E A;  3R69 A;  4REY A;  1I92 A;  3CBZ A;  2CSJ A;  2KL1 A;  2REY A;  1KWA A;  5JXB A;  1FCF A;  5E11 A;  2KPL A;  4JJ3 A;  3SHU A;  2QKV A;  2UZC A;  2AWW A;  2DB5 A;  1QAU A;  2F0A A;  1VA8 A;  2W7R A;  2EXG A;  5GND A;  3FY5 A;  1R6J A;  5G1E A;  1XZ9 A;  2EEJ A;  5DTH A;  2FCF A;  4NMR A;  3TSZ A;  5HFC A;  2MHO A;  1OBX A;  1WI4 A;  1K32 A;  1G9O A;  3QE1 A;  1WH1 A;  2OQS A;  2KV8 A;  3PS4 A;  3GAB A;  4JOE A;  1GM1 A;  3STJ A;  4NMO A;  3CH8 A;  1X6D A;  2FN5 A;  1P1E A;  1Q3O A;  2I4S A;  4JOJ A;  2GEF A;  5HET A;  2I6V A;  3HPK A;  4L8N A;  2W4F A;  4P2A B;  3NCV A;  4Q6H A;  4Z33 A;  4GHN A;  1T2M A;  1N6E A;  4GVC A;  2H3L A;  2KOH A;  2KG2 A;  4JOG A;  1X5Q A;  5HDY A;  2JSN A;  1KY9 A;  3KZD A;  1KEF A;  4HOP A;  3SHW A;  2G5M B;  1QAV A;  2YUY A;  2L4S A;  2Z17 A;  3QO6 A;  3RLE A;  2GZV A;  1X8S A;  1RZX A;  1OBY A;  4Q6S A;  1D5G A;  2KPK A;  2EEH A;  1L6O A;  4OAJ A;  1GQ4 A;  4Q2N A;  2I04 A;  1SOT A;  4KFV A;  2O2T A;  3WKL A;  1M5Z A;  1PDR A;  3DJ3 A;  5F67 A;  2AWX A;  1WIF A;  1OZI A;  3O5N A;  1RGR A;  2FE5 A;  4Q3H A;  3SFJ A;  4Q2P A;  2LC7 A;  1UM7 A;  1NTE A;  2BYG A;  3PV4 A;  5HFB A;  2PA1 A;  4E35 A;  1IU2 A;  3RL8 A;  2QBW A;  3AXA A;  3SUZ A;  5D13 A;  1WI2 A;  2WL7 A;  2YUB A;  5F3X A;  4NMP A;  4E34 A;  2Q9V A;  4JOK A;  5EZ0 A;  4N6X A;  5B42 A;  2IWN A;  2PNT A;  1WFV A;  4OEP A;  1RGW A;  1WG6 A;  1YBO A;  3EGH C;  4JOR A;  1UF1 A;  2EDZ A;  2D90 A;  2E7K A;  2M0V A;  2VRF A;  2KOM A;  3K1R A;  1UFX A;  3ID4 A;  1Q7X A;  2PKT A;  3GDS A;  3ID3 A;  4KFW A;  1Y8T A;  4P0C A;  4FGM A;  2IWO A;  5HF1 A;  2ENO A;  3QJM A;  2P3W A;  2CSS A;  4NNM A;  2QG1 A;  2QT5 A;  3GDV A;  4AMH A;  4JOH A;  3CBY A;  3E17 A;  4YDP A;  1N6F A;  2RRM A;  2D92 A;  2KJD A;  1N7F A;  3PV5 A;  1UEP A;  2JOA A;  2K1Z A;  1X5R A;  3DOR A;  5HED A;  5E1Y A;  1TE0 A;  2RCZ A;  5GLJ A;  1U37 A;  4K76 A;  2KA9 A;  3GCO A;  2EJY A;  2KQF A;  4EDJ A;  4Q2O A;  2DAZ A;  2I0L A;  1WF8 A;  1GQ5 A;  4K72 A;  1FC6 A;  2LOB A;  1Z86 A;  1V5Q A;  3DJA A;  3SOE A;  4NXQ A;  2EGN A;  3MH4 A;  3VQF A;  3VQG A;  2EDV A;  5HEB A;  2D8I A;  1VJ6 A;  2DLS A;  3ID1 A;  2JWE A;  4OEO A;  3I18 A;  5HFF A;  3EGG C;  3GCN A;  4HOP B;  2JRE A;  5HFE A;  1QAV B;  2VZ5 A;  1V6B A;  1Q3P A;  1U3B A;  3NFL A;  1N99 A;  2OZF A;  5A2P A;  3HPM A;  4NMT A;  2EDP A;  3QGL A;  4LMM A;  4NXP A;  3OTP A;  4NXR A;  4RI0 A;  5E6P B;  1QLC A;  1MC7 A;  1X45 A;  3QDO A;  1WHA A;  5IL9 A;  1MFG A;  5HEY A;  1NF3 C;  1BE9 A;  2OS6 A;  2ZPM A;  2DC2 A;  2PZD A;  2FNE A;  2QKU A;  5FB8 C;  3KDK A;  2M0U A;  5FHT A;  1UJU A;  2KRG A;  2LC6 A;  4JJ0 A;  3JXT A;  1WHD A;  2KJP A;  1U39 A;  2EAQ A;  4K75 A;  2X7Z A;  3GDU A;  3GJ9 A;  4XHV A;  3TSV A;  3NGH A;  2OPG A;  4E3B A;  1UJD A;  1V5L A;  2M3M A;  3B76 A;  1LCY A;  5HJ1 A;  3K82 A;  2L4T A;  2DM8 A;  3CS0 A;  4JL7 A;  5ILB A;  4IC6 A;  4UU6 A;  2V1W A;  1UJV A;  4O06 A;  2HGA A;  2KJK A;  5I7Z A;  3R0H A;  2H3M A;  5E22 A;  3ZRT A;  3ID2 A;  1N7T A;  2MX6 A;  5G1D A;  2DLU A;  5H3J A;  1P1D A;  2EHR A;  1VCW A;  1UEQ A;  4K6Y A;  3NFK A;  4JOP A;  2HE2 A;  3CBX A;  1ZUB A;  2PKU A;  4G69 A;  2AIN A;  4NMV A;  2IWQ A;  2IWP A;  2M0T A;  2F5Y A;  2KBS A;  2YT8 A;  4R2Z A;  3GSL A;  3KHF A;  1Y7N A;  2H2C A;  2YT7 A;  1X5N A;  2OGP A;  2EV8 A;  2DMZ A;  3QIK A;  1IU0 A;  3QJN A;  5B6L A;  3MH7 A;  1N7E A;  3MH6 A;  2JIN A;  1Z87 A;  3PDZ A;  3LNY A;  4YYX A;  2KOJ A;  3BPU A;  1IHJ A;  3RL7 A;  2KAW A;  1RY4 A;  2LA8 A;  1FC9 A;  1VB7 A;  2L97 A;  2OMJ A;  2Z9I A;  4WYT A;  1UM1 A;  2QKT A;  3L4F D;  2M0Z A;  1SOZ A;  1UIT A;  1OBZ A;  1X9Z A;  3CC0 A;  1UHP A;  2JXO A;  4Z8J A;  1V1T A;  1FC7 A;  3DJ1 A;  4NMQ A;  4MPA A;  2EGK A;  2OCS A;  1I16 A;  4JOF A;  2PDZ A;  1TQ3 A;  2M10 A;  1W9O A;  2I0I A;  4WYU A;  3TSW A;  2VPH A;  2AWU A;  1V62 A;  1B8Q A;  3DIW A;  5E21 A;  1N6D A;  2JIK A;  2HE4 A;  1WFG A;  4F8K A;  2I1N A;  1ZOK A;  3R68 A;  3K50 A;  3PDV A;  2VWR A;  2VSP A;  2R3Y A;  5HF4 A;  3KDG A;  1WF7 A;  1UEZ A;  2V90 A;  1MFL A;  2JIL A;  2H2B A;  2R4H A;  3I4W A;  3TMH A;  4UU5 A;  2VSV A;  1UEW A;  2K20 A;  2OSG A;  4NMS A;  1BFE A;  3GGE A;  1TP3 A;  2ZPL A;  4Q2Q A;  3CYY A;  2KYL A;  2EGO A;  2DJT A;  3HVQ C;  1VAE A; 
#chains in the Genus database with same CATH homology
 3KZE A;  4FLN A;  4PQW A;  2CS5 A;  3PV2 A;  3OU0 A;  4NNL A;  5EYZ A;  1W9Q A;  2EEG A;  2DKR A;  4H11 A;  1W9E A;  3O46 A;  1TP5 A;  1WJL A;  4GVD A;  1U38 A;  2EEI A;  4K78 A;  2Q3G A;  2YTW A;  5HFD A;  3WKM A;  2G2L A;  2LUI A;  3LNX A;  3I1E A;  3R69 A;  4REY A;  1I92 A;  3CBZ A;  2CSJ A;  2KL1 A;  2REY A;  1KWA A;  5JXB A;  1FCF A;  5E11 A;  2KPL A;  4JJ3 A;  3SHU A;  2QKV A;  2UZC A;  2AWW A;  2DB5 A;  1QAU A;  2F0A A;  1VA8 A;  2W7R A;  2EXG A;  5GND A;  3FY5 A;  1R6J A;  5G1E A;  1XZ9 A;  2EEJ A;  5DTH A;  2FCF A;  4NMR A;  3TSZ A;  5HFC A;  2MHO A;  1OBX A;  1WI4 A;  1K32 A;  1G9O A;  3QE1 A;  1WH1 A;  2OQS A;  2KV8 A;  3PS4 A;  3GAB A;  4JOE A;  1GM1 A;  3STJ A;  4NMO A;  3CH8 A;  1X6D A;  2FN5 A;  1P1E A;  1Q3O A;  2I4S A;  4JOJ A;  2GEF A;  5HET A;  2I6V A;  3HPK A;  4L8N A;  2W4F A;  4P2A B;  3NCV A;  4Q6H A;  4Z33 A;  4GHN A;  1T2M A;  1N6E A;  4GVC A;  2H3L A;  2KOH A;  2KG2 A;  4JOG A;  1X5Q A;  5HDY A;  2JSN A;  1KY9 A;  3KZD A;  1KEF A;  4HOP A;  3SHW A;  2G5M B;  1QAV A;  2YUY A;  2L4S A;  2Z17 A;  3QO6 A;  3RLE A;  2GZV A;  1X8S A;  1RZX A;  1OBY A;  4Q6S A;  1D5G A;  2KPK A;  2EEH A;  1L6O A;  4OAJ A;  1GQ4 A;  4Q2N A;  2I04 A;  1SOT A;  4KFV A;  2O2T A;  3WKL A;  1M5Z A;  1PDR A;  3DJ3 A;  5F67 A;  2AWX A;  1WIF A;  1OZI A;  3O5N A;  1RGR A;  2FE5 A;  4Q3H A;  3SFJ A;  4Q2P A;  2LC7 A;  1UM7 A;  1NTE A;  2BYG A;  3PV4 A;  5HFB A;  2PA1 A;  4E35 A;  1IU2 A;  3RL8 A;  2QBW A;  3AXA A;  3SUZ A;  5D13 A;  1WI2 A;  2WL7 A;  2YUB A;  5F3X A;  4NMP A;  4E34 A;  2Q9V A;  4JOK A;  5EZ0 A;  4N6X A;  5B42 A;  2IWN A;  2PNT A;  1WFV A;  4OEP A;  1RGW A;  1WG6 A;  1YBO A;  3EGH C;  4JOR A;  1UF1 A;  2EDZ A;  2D90 A;  2E7K A;  2M0V A;  2VRF A;  2KOM A;  3K1R A;  1UFX A;  3ID4 A;  1Q7X A;  2PKT A;  3GDS A;  3ID3 A;  4KFW A;  1Y8T A;  4P0C A;  4FGM A;  2IWO A;  5HF1 A;  2ENO A;  3QJM A;  2P3W A;  2CSS A;  4NNM A;  2QG1 A;  2QT5 A;  3GDV A;  4AMH A;  4JOH A;  3CBY A;  3E17 A;  4YDP A;  1N6F A;  2RRM A;  2D92 A;  2KJD A;  1N7F A;  3PV5 A;  1UEP A;  2JOA A;  2K1Z A;  1X5R A;  3DOR A;  5HED A;  5E1Y A;  1TE0 A;  2RCZ A;  5GLJ A;  1U37 A;  4K76 A;  2KA9 A;  3GCO A;  2EJY A;  2KQF A;  4EDJ A;  4Q2O A;  2DAZ A;  2I0L A;  1WF8 A;  1GQ5 A;  4K72 A;  1FC6 A;  2LOB A;  1Z86 A;  1V5Q A;  3DJA A;  3SOE A;  4NXQ A;  2EGN A;  3MH4 A;  3VQF A;  3VQG A;  2EDV A;  5HEB A;  2D8I A;  1VJ6 A;  2DLS A;  3ID1 A;  2JWE A;  4OEO A;  3I18 A;  5HFF A;  3EGG C;  3GCN A;  4HOP B;  2JRE A;  5HFE A;  1QAV B;  2VZ5 A;  1V6B A;  1Q3P A;  1U3B A;  3NFL A;  1N99 A;  2OZF A;  5A2P A;  3HPM A;  4NMT A;  2EDP A;  3QGL A;  4LMM A;  4NXP A;  3OTP A;  4NXR A;  4RI0 A;  5E6P B;  1QLC A;  1MC7 A;  1X45 A;  3QDO A;  1WHA A;  5IL9 A;  1MFG A;  5HEY A;  1NF3 C;  1BE9 A;  2OS6 A;  2ZPM A;  2DC2 A;  2PZD A;  2FNE A;  2QKU A;  5FB8 C;  3KDK A;  2M0U A;  5FHT A;  1UJU A;  2KRG A;  2LC6 A;  4JJ0 A;  3JXT A;  1WHD A;  2KJP A;  1U39 A;  2EAQ A;  4K75 A;  2X7Z A;  3GDU A;  3GJ9 A;  4XHV A;  3TSV A;  3NGH A;  2OPG A;  4E3B A;  1UJD A;  1V5L A;  2M3M A;  3B76 A;  1LCY A;  5HJ1 A;  3K82 A;  2L4T A;  2DM8 A;  3CS0 A;  4JL7 A;  5ILB A;  4IC6 A;  4UU6 A;  2V1W A;  1UJV A;  4O06 A;  2HGA A;  2KJK A;  5I7Z A;  3R0H A;  2H3M A;  5E22 A;  3ZRT A;  3ID2 A;  1N7T A;  2MX6 A;  5G1D A;  2DLU A;  5H3J A;  1P1D A;  2EHR A;  1VCW A;  1UEQ A;  4K6Y A;  3NFK A;  4JOP A;  2HE2 A;  3CBX A;  1ZUB A;  2PKU A;  4G69 A;  2AIN A;  4NMV A;  2IWQ A;  2IWP A;  2M0T A;  2F5Y A;  2KBS A;  2YT8 A;  4R2Z A;  3GSL A;  3KHF A;  1Y7N A;  2H2C A;  2YT7 A;  1X5N A;  2OGP A;  2EV8 A;  2DMZ A;  3QIK A;  1IU0 A;  3QJN A;  5B6L A;  3MH7 A;  1N7E A;  3MH6 A;  2JIN A;  1Z87 A;  3PDZ A;  3LNY A;  4YYX A;  2KOJ A;  3BPU A;  1IHJ A;  3RL7 A;  2KAW A;  1RY4 A;  2LA8 A;  1FC9 A;  1VB7 A;  2L97 A;  2OMJ A;  2Z9I A;  4WYT A;  1UM1 A;  2QKT A;  3L4F D;  2M0Z A;  1SOZ A;  1UIT A;  1OBZ A;  1X9Z A;  3CC0 A;  1UHP A;  2JXO A;  4Z8J A;  1V1T A;  1FC7 A;  3DJ1 A;  4NMQ A;  4MPA A;  2EGK A;  2OCS A;  1I16 A;  4JOF A;  2PDZ A;  1TQ3 A;  2M10 A;  1W9O A;  2I0I A;  4WYU A;  3TSW A;  2VPH A;  2AWU A;  1V62 A;  1B8Q A;  3DIW A;  5E21 A;  1N6D A;  2JIK A;  2HE4 A;  1WFG A;  4F8K A;  2I1N A;  1ZOK A;  3R68 A;  3K50 A;  3PDV A;  2VWR A;  2VSP A;  2R3Y A;  5HF4 A;  3KDG A;  1WF7 A;  1UEZ A;  2V90 A;  1MFL A;  2JIL A;  2H2B A;  2R4H A;  3I4W A;  3TMH A;  4UU5 A;  2VSV A;  1UEW A;  2K20 A;  2OSG A;  4NMS A;  1BFE A;  3GGE A;  1TP3 A;  2ZPL A;  4Q2Q A;  3CYY A;  2KYL A;  2EGO A;  2DJT A;  3HVQ C;  1VAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...