1UHPA

Solution structure of rsgi ruh-005, a pdz domain in human cdna, kiaa1095
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GSSGSSGKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQVLRRTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein KIAA1095
publication title Solution structure of RSGI RUH-005, a PDZ domain in human cDNA, KIAA1095
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 12
structure length 107
sequence length 107
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1uhpA00
2QBWA 4P2AB 3GGEA 1FC7A 4GVDA 4WYTA 4JORA 4Q2OA 2I1NA 4Q2NA 1QAVA 3RL7A 1WH1A 2WL7A 2I04A 2F0AA 1P1DA 4IC6A 4N6XA 4NMTA 4HOPA 5GNDA 2EDPA 3QDOA 2ZPMA 1KEFA 2JINA 5E22A 2DJTA 5H3JA 1RGRA 2K20A 5HFFA 1X5NA 5E1YA 4XHVA 2EDVA 2HE2A 2QG1A 3K50A 3SUZA 1X5QA 4MPAA 1VAEA 1QAVB 1N7TA 1WF7A 4LMMA 4R2ZA 1K32A 4YYXA 5HJ1A 2KBSA 1SOTA 2KJKA 3HVQC 1IHJA 4HOPB 4K72A 1RZXA 3DORA 2D90A 4NMRA 3TMHA 4NNLA 3EGGC 2BYGA 1OBZA 4JOPA 3ID4A 2VWRA 5E11A 5F3XA 1U37A 5HDYA 3KZEA 4Q3HA 5HF4A 1UF1A 4H11A 3R0HA 2KYLA 2V1WA 2I0IA 2QKTA 1UEPA 3DJAA 4KFWA 2KA9A 3MH6A 2YT8A 3CS0A 4JOHA 1SOZA 3NFKA 2OPGA 2DMZA 4UU6A 1ZUBA 3PV2A 1IU2A 2KOJA 2KJPA 4NXPA 1W9EA 2Z17A 3SOEA 1BE9A 2IWOA 2REYA 2EJYA 1WHAA 2EEIA 2FNEA 2DM8A 3I4WA 1Z86A 1R6JA 1N6FA 2V90A 2OQSA 4JL7A 2I0LA 1UFXA 2EDZA 2IWQA 1MFGA 3QGLA 3K82A 4Q6SA 2PKTA 1D5GA 4P0CA 1TQ3A 2FCFA 1XZ9A 5D13A 1TP3A 4G69A 2OMJA 3EGHC 2VSPA 2OZFA 1U39A 2L4SA 2KOHA 2KPKA 5HFEA 1Y7NA 1X8SA 5G1EA 2M0TA 3ID1A 4JOFA 1BFEA 3LNXA 4Z33A 2OSGA 1UEZA 5B6LA 3QIKA 1V5QA 2VSVA 2AWWA 2DKRA 3JXTA 1VCWA 5E21A 1LCYA 4K6YA 2KAWA 2LC6A 2QKVA 2PA1A 4Q2QA 3B76A 5HF1A 2JWEA 1Y8TA 2PDZA 4E35A 3L4FD 1OZIA 3CH8A 4WYUA 2HE4A 2PNTA 4JOGA 3PV4A 1OBXA 1QLCA 4GHNA 4NXRA 3NGHA 1IU0A 3DJ1A 1UM7A 1U38A 5HEYA 2YUBA 2KOMA 2ZPLA 4Q6HA 2FE5A 1Q3OA 3TSWA 2VZ5A 1X6DA 3VQFA 2K1ZA 2D8IA 5EZ0A 1VB7A 5I7ZA 3CBYA 5GLJA 1FC9A 3R68A 2OCSA 3SHUA 3ZRTA 1ZOKA 1V1TA 2Z9IA 2GZVA 5FB8C 3BPUA 3GCNA 2RRMA 2M3MA 4UU5A 2EAQA 1KWAA 2MX6A 1YBOA 1X45A 4NMOA 1WF8A 3CBZA 1RGWA 2AINA 2KG2A 2OS6A 2EGKA 2RCZA 1N6EA 1V62A 2Q3GA 2DB5A 3OTPA 3KHFA 1Z87A 3GJ9A 3QJNA 4NMQA 3TSVA 2W7RA 4NXQA 2X7ZA 1NTEA 5JXBA 2HGAA 3LNYA 2JREA 5A2PA 1TP5A 4JOJA 4EDJA 2KJDA 1L6OA 2ENOA 2M0ZA 1OBYA 2CS5A 2L97A 1GQ4A 3PV5A 2LOBA 2F5YA 4L8NA 2D92A 2EEHA 3MH4A 2KL1A 2CSJA 5HFDA 1UEWA 2CSSA 3I1EA 1RY4A 2MHOA 3PDVA 3QO6A 3GSLA 3STJA 1WHDA 2M0UA 1MC7A 2M10A 4Z8JA 2EXGA 4K76A 3SFJA 4FGMA 3SHWA 1WG6A 5F67A 4RI0A 2YTWA 5DTHA 2DLUA 1KY9A 3TSZA 1UITA 2VRFA 2UZCA 2G2LA 1G9OA 3VQGA 2KV8A 1UHPA 2JXOA 1N6DA 2IWNA 1Q3PA 4O06A 4OAJA 4YDPA 2KPLA 2R4HA 2H3MA 5HEBA 1UEQA 3DIWA 1WFVA 3O46A 3MH7A 1PDRA 3RL8A 2YT7A 2EHRA 4K75A 4K78A 4REYA 2Q9VA 1MFLA 2KRGA 2H2CA 4NMVA 1QAUA 5EYZA 1V5LA 1VJ6A 4NMPA 4PQWA 1WFGA 2EEGA 4JOEA 3AXAA 4E34A 3GDVA 4KFVA 4NMSA 3GCOA 5E6PB 1Q7XA 1WIFA 3HPMA 2EEJA 1TE0A 2P3WA 1W9QA 3PDZA 5HFBA 3FY5A 3ID3A 5HETA 2IWPA 3CBXA 1VA8A 1P1EA 3NFLA 2KQFA 1W9OA 4E3BA 3O5NA 1GM1A 3R69A 4AMHA 2E7KA 3CC0A 3QE1A 4F8KA 3OU0A 2PKUA 1UJDA 2I4SA 1M5ZA 2QKUA 1U3BA 4Q2PA 1FCFA 1T2MA 1WI4A 1I92A 2LA8A 2QT5A 1UM1A 2I6VA 2PZDA 3K1RA 1WI2A 2YUYA 5G1DA 3GDSA 2LUIA 1I16A 2EGOA 2LC7A 4OEPA 2H3LA 2G5MB 1GQ5A 2H2BA 5FHTA 2DAZA 3CYYA 1N99A 1V6BA 2JILA 5HFCA 2JIKA 2DLSA 3I18A 3RLEA 2EGNA 2DC2A 2EV8A 3DJ3A 1WJLA 2L4TA 3PS4A 3ID2A 3WKMA 5HEDA 1N7EA 4NNMA 2M0VA 2AWUA 2R3YA 1B8QA 2JOAA 3QJMA 2FN5A 3KZDA 3HPKA 2OGPA 3E17A 1NF3C 2VPHA 2W4FA 1UJUA 4JOKA 3GDUA 1FC6A 2AWXA 4OEOA 3WKLA 1UJVA 4GVCA 1N7FA 2O2TA 1X5RA
chains in the Genus database with same CATH superfamily
2QBWA 4P2AB 3GGEA 1FC7A 4GVDA 4WYTA 4JORA 4Q2OA 2I1NA 4Q2NA 1QAVA 3RL7A 1WH1A 2WL7A 2I04A 2F0AA 1P1DA 4IC6A 4N6XA 4NMTA 4HOPA 5GNDA 2EDPA 3QDOA 2ZPMA 1KEFA 2JINA 5E22A 2DJTA 5H3JA 1RGRA 2K20A 5HFFA 1X5NA 5E1YA 4XHVA 2EDVA 2HE2A 2QG1A 3K50A 3GABA 3SUZA 1X5QA 4MPAA 1VAEA 2JSNA 1QAVB 1N7TA 1WF7A 4LMMA 4R2ZA 1K32A 4YYXA 5HJ1A 2KBSA 1SOTA 2KJKA 3HVQC 1IHJA 4HOPB 4K72A 1RZXA 3DORA 2D90A 4NMRA 3TMHA 4NNLA 3EGGC 2BYGA 1OBZA 4JOPA 3ID4A 2VWRA 5E11A 5F3XA 1U37A 5HDYA 3KZEA 4Q3HA 5HF4A 1UF1A 4H11A 3R0HA 2KYLA 2V1WA 2I0IA 2QKTA 1UEPA 3DJAA 4KFWA 2KA9A 3MH6A 2YT8A 3CS0A 4JOHA 1SOZA 3NFKA 2OPGA 2DMZA 4UU6A 1ZUBA 3PV2A 1IU2A 2KOJA 2KJPA 4NXPA 1W9EA 2Z17A 3SOEA 1BE9A 2IWOA 2REYA 2EJYA 1WHAA 2EEIA 2FNEA 2DM8A 3I4WA 1Z86A 1R6JA 1N6FA 2V90A 2OQSA 4JL7A 2I0LA 1UFXA 2EDZA 2IWQA 1MFGA 3QGLA 3K82A 4Q6SA 2PKTA 1D5GA 4P0CA 1TQ3A 2FCFA 1XZ9A 5D13A 1TP3A 4G69A 2OMJA 3EGHC 2VSPA 2OZFA 1U39A 2L4SA 2KOHA 2KPKA 5HFEA 1Y7NA 1X8SA 5G1EA 2M0TA 3ID1A 4JOFA 1BFEA 3LNXA 4Z33A 2OSGA 1UEZA 5B6LA 3QIKA 1V5QA 2VSVA 2AWWA 2DKRA 3JXTA 3KDKA 1VCWA 5E21A 1LCYA 4K6YA 2KAWA 2LC6A 2QKVA 2PA1A 4Q2QA 3B76A 5HF1A 2JWEA 1Y8TA 2PDZA 4E35A 3L4FD 1OZIA 3CH8A 4WYUA 2HE4A 2PNTA 4JOGA 3PV4A 1OBXA 1QLCA 4GHNA 4NXRA 3NGHA 1IU0A 3DJ1A 1UM7A 1U38A 5HEYA 2YUBA 2KOMA 2ZPLA 4Q6HA 4FLNA 5IL9A 2FE5A 1Q3OA 3TSWA 2VZ5A 1X6DA 3VQFA 2K1ZA 2D8IA 5EZ0A 1VB7A 5I7ZA 3CBYA 5GLJA 1FC9A 3R68A 2OCSA 3SHUA 3ZRTA 1ZOKA 1V1TA 2Z9IA 2GZVA 5FB8C 3BPUA 3GCNA 2RRMA 2M3MA 4UU5A 2EAQA 1KWAA 2MX6A 1YBOA 1X45A 4NMOA 1WF8A 3CBZA 1RGWA 2AINA 2KG2A 2OS6A 2EGKA 2RCZA 1N6EA 1V62A 2Q3GA 2DB5A 3OTPA 3KHFA 1Z87A 3GJ9A 3QJNA 4NMQA 3TSVA 2W7RA 4NXQA 2X7ZA 1NTEA 5JXBA 2HGAA 3LNYA 2JREA 5A2PA 1TP5A 4JOJA 4EDJA 2KJDA 1L6OA 2ENOA 2M0ZA 1OBYA 2CS5A 2L97A 1GQ4A 3PV5A 2LOBA 2F5YA 4L8NA 2D92A 2EEHA 3MH4A 5ILBA 2KL1A 2CSJA 5HFDA 1UEWA 2CSSA 3I1EA 1RY4A 2MHOA 3PDVA 3QO6A 3GSLA 3STJA 1WHDA 2M0UA 1MC7A 2M10A 4Z8JA 2EXGA 4K76A 3SFJA 4FGMA 3SHWA 1WG6A 5F67A 4RI0A 2YTWA 5DTHA 2DLUA 1KY9A 4JJ0A 3TSZA 1UITA 2VRFA 2UZCA 2G2LA 1G9OA 3VQGA 2KV8A 1UHPA 2JXOA 1N6DA 2IWNA 1Q3PA 4O06A 4OAJA 4YDPA 2KPLA 2R4HA 2H3MA 5HEBA 1UEQA 1X9ZA 3DIWA 1WFVA 3O46A 3MH7A 1PDRA 3RL8A 2YT7A 2EHRA 4K75A 4K78A 4REYA 2Q9VA 3KDGA 1MFLA 2KRGA 2H2CA 4NMVA 4JJ3A 1QAUA 5EYZA 1V5LA 5B42A 1VJ6A 4NMPA 4PQWA 1WFGA 2EEGA 4JOEA 3AXAA 4E34A 3GDVA 4KFVA 4NMSA 3GCOA 5E6PB 1Q7XA 1WIFA 3HPMA 2EEJA 1TE0A 2GEFA 2P3WA 1W9QA 3PDZA 5HFBA 3FY5A 3ID3A 5HETA 2IWPA 3CBXA 1VA8A 1P1EA 3NFLA 2KQFA 1W9OA 4E3BA 3O5NA 1GM1A 3R69A 4AMHA 2E7KA 3CC0A 3QE1A 4F8KA 3OU0A 2PKUA 1UJDA 2I4SA 1M5ZA 2QKUA 1U3BA 4Q2PA 1FCFA 1T2MA 1WI4A 1I92A 2LA8A 2QT5A 1UM1A 2I6VA 2PZDA 3K1RA 1WI2A 2YUYA 5G1DA 3GDSA 2LUIA 1I16A 2EGOA 2LC7A 4OEPA 2H3LA 2G5MB 1GQ5A 2H2BA 5FHTA 2DAZA 3CYYA 1N99A 1V6BA 2JILA 5HFCA 2JIKA 2DLSA 3I18A 3RLEA 2EGNA 2DC2A 2EV8A 3DJ3A 1WJLA 2L4TA 3PS4A 3ID2A 3WKMA 5HEDA 1N7EA 4NNMA 2M0VA 2AWUA 2R3YA 1B8QA 2JOAA 3QJMA 2FN5A 3KZDA 3HPKA 2OGPA 3E17A 1NF3C 2VPHA 2W4FA 1UJUA 4JOKA 3GDUA 1FC6A 2AWXA 4OEOA 3WKLA 1UJVA 3NCVA 4GVCA 1N7FA 2O2TA 1X5RA
chains in the Genus database with same CATH topology
2QBWA 4P2AB 3GGEA 1FC7A 4GVDA 4WYTA 4JORA 4Q2OA 2I1NA 4Q2NA 1QAVA 3RL7A 1WH1A 2WL7A 2I04A 2F0AA 1P1DA 4IC6A 4N6XA 4NMTA 4HOPA 5GNDA 2EDPA 3QDOA 2ZPMA 1KEFA 2JINA 5E22A 2DJTA 5H3JA 1RGRA 2K20A 5HFFA 1X5NA 5E1YA 4XHVA 2EDVA 2HE2A 2QG1A 3K50A 3GABA 3SUZA 1X5QA 4MPAA 1VAEA 2JSNA 1QAVB 1N7TA 1WF7A 4LMMA 4R2ZA 1K32A 4YYXA 5HJ1A 2KBSA 1SOTA 2KJKA 3HVQC 1IHJA 4HOPB 4K72A 1RZXA 3DORA 2D90A 4NMRA 3TMHA 4NNLA 3EGGC 2BYGA 1OBZA 4JOPA 3ID4A 2VWRA 5E11A 5F3XA 1U37A 5HDYA 3KZEA 4Q3HA 5HF4A 1UF1A 4H11A 3R0HA 2KYLA 2V1WA 2I0IA 2QKTA 1UEPA 3DJAA 4KFWA 2KA9A 3MH6A 2YT8A 3CS0A 4JOHA 1SOZA 3NFKA 2OPGA 2DMZA 4UU6A 1ZUBA 3PV2A 1IU2A 2KOJA 2KJPA 4NXPA 1W9EA 2Z17A 3SOEA 1BE9A 2IWOA 2REYA 2EJYA 1WHAA 2EEIA 2FNEA 2DM8A 3I4WA 1Z86A 1R6JA 1N6FA 2V90A 2OQSA 4JL7A 2I0LA 1UFXA 2EDZA 2IWQA 1MFGA 3QGLA 3K82A 4Q6SA 2PKTA 1D5GA 4P0CA 1TQ3A 2FCFA 1XZ9A 5D13A 1TP3A 4G69A 2OMJA 3EGHC 2VSPA 2OZFA 1U39A 2L4SA 2KOHA 2KPKA 5HFEA 1Y7NA 1X8SA 5G1EA 2M0TA 3ID1A 4JOFA 1BFEA 3LNXA 4Z33A 2OSGA 1UEZA 5B6LA 3QIKA 1V5QA 2VSVA 2AWWA 2DKRA 3JXTA 3KDKA 1VCWA 5E21A 1LCYA 4K6YA 2KAWA 2LC6A 2QKVA 2PA1A 4Q2QA 3B76A 5HF1A 2JWEA 1Y8TA 2PDZA 4E35A 3L4FD 1OZIA 3CH8A 4WYUA 2HE4A 2PNTA 4JOGA 3PV4A 1OBXA 1QLCA 4GHNA 4NXRA 3NGHA 1IU0A 3DJ1A 1UM7A 1U38A 5HEYA 2YUBA 2KOMA 2ZPLA 4Q6HA 4FLNA 5IL9A 2FE5A 1Q3OA 3TSWA 2VZ5A 1X6DA 3VQFA 2K1ZA 2D8IA 5EZ0A 1VB7A 5I7ZA 3CBYA 5GLJA 1FC9A 3R68A 2OCSA 3SHUA 3ZRTA 1ZOKA 1V1TA 2Z9IA 2GZVA 5FB8C 3BPUA 3GCNA 2RRMA 2M3MA 4UU5A 2EAQA 1KWAA 2MX6A 1YBOA 1X45A 4NMOA 1WF8A 3CBZA 1RGWA 2AINA 2KG2A 2OS6A 2EGKA 2RCZA 1N6EA 1V62A 2Q3GA 2DB5A 3OTPA 3KHFA 1Z87A 3GJ9A 3QJNA 4NMQA 3TSVA 2W7RA 4NXQA 2X7ZA 1NTEA 5JXBA 2HGAA 3LNYA 2JREA 5A2PA 1TP5A 4JOJA 4EDJA 2KJDA 1L6OA 2ENOA 2M0ZA 1OBYA 2CS5A 2L97A 1GQ4A 3PV5A 2LOBA 2F5YA 4L8NA 2D92A 2EEHA 3MH4A 5ILBA 2KL1A 2CSJA 5HFDA 1UEWA 2CSSA 3I1EA 1RY4A 2MHOA 3PDVA 3QO6A 3GSLA 3STJA 1WHDA 2M0UA 1MC7A 2M10A 4Z8JA 2EXGA 4K76A 3SFJA 4FGMA 3SHWA 1WG6A 5F67A 4RI0A 2YTWA 5DTHA 2DLUA 1KY9A 4JJ0A 3TSZA 1UITA 2VRFA 2UZCA 2G2LA 1G9OA 3VQGA 2KV8A 1UHPA 2JXOA 1N6DA 2IWNA 1Q3PA 4O06A 4OAJA 4YDPA 2KPLA 2R4HA 2H3MA 5HEBA 1UEQA 1X9ZA 3DIWA 1WFVA 3O46A 3MH7A 1PDRA 3RL8A 2YT7A 2EHRA 4K75A 4K78A 4REYA 2Q9VA 3KDGA 1MFLA 2KRGA 2H2CA 4NMVA 4JJ3A 1QAUA 5EYZA 1V5LA 5B42A 1VJ6A 4NMPA 4PQWA 1WFGA 2EEGA 4JOEA 3AXAA 4E34A 3GDVA 4KFVA 4NMSA 3GCOA 5E6PB 1Q7XA 1WIFA 3HPMA 2EEJA 1TE0A 2GEFA 2P3WA 1W9QA 3PDZA 5HFBA 3FY5A 3ID3A 5HETA 2IWPA 3CBXA 1VA8A 1P1EA 3NFLA 2KQFA 1W9OA 4E3BA 3O5NA 1GM1A 3R69A 4AMHA 2E7KA 3CC0A 3QE1A 4F8KA 3OU0A 2PKUA 1UJDA 2I4SA 1M5ZA 2QKUA 1U3BA 4Q2PA 1FCFA 1T2MA 1WI4A 1I92A 2LA8A 2QT5A 1UM1A 2I6VA 2PZDA 3K1RA 1WI2A 2YUYA 5G1DA 3GDSA 2LUIA 1I16A 2EGOA 2LC7A 4OEPA 2H3LA 2G5MB 1GQ5A 2H2BA 5FHTA 2DAZA 3CYYA 1N99A 1V6BA 2JILA 5HFCA 2JIKA 2DLSA 3I18A 3RLEA 2EGNA 2DC2A 2EV8A 3DJ3A 1WJLA 2L4TA 3PS4A 3ID2A 3WKMA 5HEDA 1N7EA 4NNMA 2M0VA 2AWUA 2R3YA 1B8QA 2JOAA 3QJMA 2FN5A 3KZDA 3HPKA 2OGPA 3E17A 1NF3C 2VPHA 2W4FA 1UJUA 4JOKA 3GDUA 1FC6A 2AWXA 4OEOA 3WKLA 1UJVA 3NCVA 4GVCA 1N7FA 2O2TA 1X5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QBW A;  4P2A B;  3GGE A;  1FC7 A;  4GVD A;  4WYT A;  4JOR A;  4Q2O A;  2I1N A;  4Q2N A;  1QAV A;  3RL7 A;  1WH1 A;  2WL7 A;  2I04 A;  2F0A A;  1P1D A;  4IC6 A;  4N6X A;  4NMT A;  4HOP A;  5GND A;  2EDP A;  3QDO A;  2ZPM A;  1KEF A;  2JIN A;  5E22 A;  2DJT A;  5H3J A;  1RGR A;  2K20 A;  5HFF A;  1X5N A;  5E1Y A;  4XHV A;  2EDV A;  2HE2 A;  2QG1 A;  3K50 A;  3SUZ A;  1X5Q A;  4MPA A;  1VAE A;  1QAV B;  1N7T A;  1WF7 A;  4LMM A;  4R2Z A;  1K32 A;  4YYX A;  5HJ1 A;  2KBS A;  1SOT A;  2KJK A;  3HVQ C;  1IHJ A;  4HOP B;  4K72 A;  1RZX A;  3DOR A;  2D90 A;  4NMR A;  3TMH A;  4NNL A;  3EGG C;  2BYG A;  1OBZ A;  4JOP A;  3ID4 A;  2VWR A;  5E11 A;  5F3X A;  1U37 A;  5HDY A;  3KZE A;  4Q3H A;  5HF4 A;  1UF1 A;  4H11 A;  3R0H A;  2KYL A;  2V1W A;  2I0I A;  2QKT A;  1UEP A;  3DJA A;  4KFW A;  2KA9 A;  3MH6 A;  2YT8 A;  3CS0 A;  4JOH A;  1SOZ A;  3NFK A;  2OPG A;  2DMZ A;  4UU6 A;  1ZUB A;  3PV2 A;  1IU2 A;  2KOJ A;  2KJP A;  4NXP A;  1W9E A;  2Z17 A;  3SOE A;  1BE9 A;  2IWO A;  2REY A;  2EJY A;  1WHA A;  2EEI A;  2FNE A;  2DM8 A;  3I4W A;  1Z86 A;  1R6J A;  1N6F A;  2V90 A;  2OQS A;  4JL7 A;  2I0L A;  1UFX A;  2EDZ A;  2IWQ A;  1MFG A;  3QGL A;  3K82 A;  4Q6S A;  2PKT A;  1D5G A;  4P0C A;  1TQ3 A;  2FCF A;  1XZ9 A;  5D13 A;  1TP3 A;  4G69 A;  2OMJ A;  3EGH C;  2VSP A;  2OZF A;  1U39 A;  2L4S A;  2KOH A;  2KPK A;  5HFE A;  1Y7N A;  1X8S A;  5G1E A;  2M0T A;  3ID1 A;  4JOF A;  1BFE A;  3LNX A;  4Z33 A;  2OSG A;  1UEZ A;  5B6L A;  3QIK A;  1V5Q A;  2VSV A;  2AWW A;  2DKR A;  3JXT A;  1VCW A;  5E21 A;  1LCY A;  4K6Y A;  2KAW A;  2LC6 A;  2QKV A;  2PA1 A;  4Q2Q A;  3B76 A;  5HF1 A;  2JWE A;  1Y8T A;  2PDZ A;  4E35 A;  3L4F D;  1OZI A;  3CH8 A;  4WYU A;  2HE4 A;  2PNT A;  4JOG A;  3PV4 A;  1OBX A;  1QLC A;  4GHN A;  4NXR A;  3NGH A;  1IU0 A;  3DJ1 A;  1UM7 A;  1U38 A;  5HEY A;  2YUB A;  2KOM A;  2ZPL A;  4Q6H A;  2FE5 A;  1Q3O A;  3TSW A;  2VZ5 A;  1X6D A;  3VQF A;  2K1Z A;  2D8I A;  5EZ0 A;  1VB7 A;  5I7Z A;  3CBY A;  5GLJ A;  1FC9 A;  3R68 A;  2OCS A;  3SHU A;  3ZRT A;  1ZOK A;  1V1T A;  2Z9I A;  2GZV A;  5FB8 C;  3BPU A;  3GCN A;  2RRM A;  2M3M A;  4UU5 A;  2EAQ A;  1KWA A;  2MX6 A;  1YBO A;  1X45 A;  4NMO A;  1WF8 A;  3CBZ A;  1RGW A;  2AIN A;  2KG2 A;  2OS6 A;  2EGK A;  2RCZ A;  1N6E A;  1V62 A;  2Q3G A;  2DB5 A;  3OTP A;  3KHF A;  1Z87 A;  3GJ9 A;  3QJN A;  4NMQ A;  3TSV A;  2W7R A;  4NXQ A;  2X7Z A;  1NTE A;  5JXB A;  2HGA A;  3LNY A;  2JRE A;  5A2P A;  1TP5 A;  4JOJ A;  4EDJ A;  2KJD A;  1L6O A;  2ENO A;  2M0Z A;  1OBY A;  2CS5 A;  2L97 A;  1GQ4 A;  3PV5 A;  2LOB A;  2F5Y A;  4L8N A;  2D92 A;  2EEH A;  3MH4 A;  2KL1 A;  2CSJ A;  5HFD A;  1UEW A;  2CSS A;  3I1E A;  1RY4 A;  2MHO A;  3PDV A;  3QO6 A;  3GSL A;  3STJ A;  1WHD A;  2M0U A;  1MC7 A;  2M10 A;  4Z8J A;  2EXG A;  4K76 A;  3SFJ A;  4FGM A;  3SHW A;  1WG6 A;  5F67 A;  4RI0 A;  2YTW A;  5DTH A;  2DLU A;  1KY9 A;  3TSZ A;  1UIT A;  2VRF A;  2UZC A;  2G2L A;  1G9O A;  3VQG A;  2KV8 A;  1UHP A;  2JXO A;  1N6D A;  2IWN A;  1Q3P A;  4O06 A;  4OAJ A;  4YDP A;  2KPL A;  2R4H A;  2H3M A;  5HEB A;  1UEQ A;  3DIW A;  1WFV A;  3O46 A;  3MH7 A;  1PDR A;  3RL8 A;  2YT7 A;  2EHR A;  4K75 A;  4K78 A;  4REY A;  2Q9V A;  1MFL A;  2KRG A;  2H2C A;  4NMV A;  1QAU A;  5EYZ A;  1V5L A;  1VJ6 A;  4NMP A;  4PQW A;  1WFG A;  2EEG A;  4JOE A;  3AXA A;  4E34 A;  3GDV A;  4KFV A;  4NMS A;  3GCO A;  5E6P B;  1Q7X A;  1WIF A;  3HPM A;  2EEJ A;  1TE0 A;  2P3W A;  1W9Q A;  3PDZ A;  5HFB A;  3FY5 A;  3ID3 A;  5HET A;  2IWP A;  3CBX A;  1VA8 A;  1P1E A;  3NFL A;  2KQF A;  1W9O A;  4E3B A;  3O5N A;  1GM1 A;  3R69 A;  4AMH A;  2E7K A;  3CC0 A;  3QE1 A;  4F8K A;  3OU0 A;  2PKU A;  1UJD A;  2I4S A;  1M5Z A;  2QKU A;  1U3B A;  4Q2P A;  1FCF A;  1T2M A;  1WI4 A;  1I92 A;  2LA8 A;  2QT5 A;  1UM1 A;  2I6V A;  2PZD A;  3K1R A;  1WI2 A;  2YUY A;  5G1D A;  3GDS A;  2LUI A;  1I16 A;  2EGO A;  2LC7 A;  4OEP A;  2H3L A;  2G5M B;  1GQ5 A;  2H2B A;  5FHT A;  2DAZ A;  3CYY A;  1N99 A;  1V6B A;  2JIL A;  5HFC A;  2JIK A;  2DLS A;  3I18 A;  3RLE A;  2EGN A;  2DC2 A;  2EV8 A;  3DJ3 A;  1WJL A;  2L4T A;  3PS4 A;  3ID2 A;  3WKM A;  5HED A;  1N7E A;  4NNM A;  2M0V A;  2AWU A;  2R3Y A;  1B8Q A;  2JOA A;  3QJM A;  2FN5 A;  3KZD A;  3HPK A;  2OGP A;  3E17 A;  1NF3 C;  2VPH A;  2W4F A;  1UJU A;  4JOK A;  3GDU A;  1FC6 A;  2AWX A;  4OEO A;  3WKL A;  1UJV A;  4GVC A;  1N7F A;  2O2T A;  1X5R A; 
#chains in the Genus database with same CATH topology
 2QBW A;  4P2A B;  3GGE A;  1FC7 A;  4GVD A;  4WYT A;  4JOR A;  4Q2O A;  2I1N A;  4Q2N A;  1QAV A;  3RL7 A;  1WH1 A;  2WL7 A;  2I04 A;  2F0A A;  1P1D A;  4IC6 A;  4N6X A;  4NMT A;  4HOP A;  5GND A;  2EDP A;  3QDO A;  2ZPM A;  1KEF A;  2JIN A;  5E22 A;  2DJT A;  5H3J A;  1RGR A;  2K20 A;  5HFF A;  1X5N A;  5E1Y A;  4XHV A;  2EDV A;  2HE2 A;  2QG1 A;  3K50 A;  3GAB A;  3SUZ A;  1X5Q A;  4MPA A;  1VAE A;  2JSN A;  1QAV B;  1N7T A;  1WF7 A;  4LMM A;  4R2Z A;  1K32 A;  4YYX A;  5HJ1 A;  2KBS A;  1SOT A;  2KJK A;  3HVQ C;  1IHJ A;  4HOP B;  4K72 A;  1RZX A;  3DOR A;  2D90 A;  4NMR A;  3TMH A;  4NNL A;  3EGG C;  2BYG A;  1OBZ A;  4JOP A;  3ID4 A;  2VWR A;  5E11 A;  5F3X A;  1U37 A;  5HDY A;  3KZE A;  4Q3H A;  5HF4 A;  1UF1 A;  4H11 A;  3R0H A;  2KYL A;  2V1W A;  2I0I A;  2QKT A;  1UEP A;  3DJA A;  4KFW A;  2KA9 A;  3MH6 A;  2YT8 A;  3CS0 A;  4JOH A;  1SOZ A;  3NFK A;  2OPG A;  2DMZ A;  4UU6 A;  1ZUB A;  3PV2 A;  1IU2 A;  2KOJ A;  2KJP A;  4NXP A;  1W9E A;  2Z17 A;  3SOE A;  1BE9 A;  2IWO A;  2REY A;  2EJY A;  1WHA A;  2EEI A;  2FNE A;  2DM8 A;  3I4W A;  1Z86 A;  1R6J A;  1N6F A;  2V90 A;  2OQS A;  4JL7 A;  2I0L A;  1UFX A;  2EDZ A;  2IWQ A;  1MFG A;  3QGL A;  3K82 A;  4Q6S A;  2PKT A;  1D5G A;  4P0C A;  1TQ3 A;  2FCF A;  1XZ9 A;  5D13 A;  1TP3 A;  4G69 A;  2OMJ A;  3EGH C;  2VSP A;  2OZF A;  1U39 A;  2L4S A;  2KOH A;  2KPK A;  5HFE A;  1Y7N A;  1X8S A;  5G1E A;  2M0T A;  3ID1 A;  4JOF A;  1BFE A;  3LNX A;  4Z33 A;  2OSG A;  1UEZ A;  5B6L A;  3QIK A;  1V5Q A;  2VSV A;  2AWW A;  2DKR A;  3JXT A;  3KDK A;  1VCW A;  5E21 A;  1LCY A;  4K6Y A;  2KAW A;  2LC6 A;  2QKV A;  2PA1 A;  4Q2Q A;  3B76 A;  5HF1 A;  2JWE A;  1Y8T A;  2PDZ A;  4E35 A;  3L4F D;  1OZI A;  3CH8 A;  4WYU A;  2HE4 A;  2PNT A;  4JOG A;  3PV4 A;  1OBX A;  1QLC A;  4GHN A;  4NXR A;  3NGH A;  1IU0 A;  3DJ1 A;  1UM7 A;  1U38 A;  5HEY A;  2YUB A;  2KOM A;  2ZPL A;  4Q6H A;  4FLN A;  5IL9 A;  2FE5 A;  1Q3O A;  3TSW A;  2VZ5 A;  1X6D A;  3VQF A;  2K1Z A;  2D8I A;  5EZ0 A;  1VB7 A;  5I7Z A;  3CBY A;  5GLJ A;  1FC9 A;  3R68 A;  2OCS A;  3SHU A;  3ZRT A;  1ZOK A;  1V1T A;  2Z9I A;  2GZV A;  5FB8 C;  3BPU A;  3GCN A;  2RRM A;  2M3M A;  4UU5 A;  2EAQ A;  1KWA A;  2MX6 A;  1YBO A;  1X45 A;  4NMO A;  1WF8 A;  3CBZ A;  1RGW A;  2AIN A;  2KG2 A;  2OS6 A;  2EGK A;  2RCZ A;  1N6E A;  1V62 A;  2Q3G A;  2DB5 A;  3OTP A;  3KHF A;  1Z87 A;  3GJ9 A;  3QJN A;  4NMQ A;  3TSV A;  2W7R A;  4NXQ A;  2X7Z A;  1NTE A;  5JXB A;  2HGA A;  3LNY A;  2JRE A;  5A2P A;  1TP5 A;  4JOJ A;  4EDJ A;  2KJD A;  1L6O A;  2ENO A;  2M0Z A;  1OBY A;  2CS5 A;  2L97 A;  1GQ4 A;  3PV5 A;  2LOB A;  2F5Y A;  4L8N A;  2D92 A;  2EEH A;  3MH4 A;  5ILB A;  2KL1 A;  2CSJ A;  5HFD A;  1UEW A;  2CSS A;  3I1E A;  1RY4 A;  2MHO A;  3PDV A;  3QO6 A;  3GSL A;  3STJ A;  1WHD A;  2M0U A;  1MC7 A;  2M10 A;  4Z8J A;  2EXG A;  4K76 A;  3SFJ A;  4FGM A;  3SHW A;  1WG6 A;  5F67 A;  4RI0 A;  2YTW A;  5DTH A;  2DLU A;  1KY9 A;  4JJ0 A;  3TSZ A;  1UIT A;  2VRF A;  2UZC A;  2G2L A;  1G9O A;  3VQG A;  2KV8 A;  1UHP A;  2JXO A;  1N6D A;  2IWN A;  1Q3P A;  4O06 A;  4OAJ A;  4YDP A;  2KPL A;  2R4H A;  2H3M A;  5HEB A;  1UEQ A;  1X9Z A;  3DIW A;  1WFV A;  3O46 A;  3MH7 A;  1PDR A;  3RL8 A;  2YT7 A;  2EHR A;  4K75 A;  4K78 A;  4REY A;  2Q9V A;  3KDG A;  1MFL A;  2KRG A;  2H2C A;  4NMV A;  4JJ3 A;  1QAU A;  5EYZ A;  1V5L A;  5B42 A;  1VJ6 A;  4NMP A;  4PQW A;  1WFG A;  2EEG A;  4JOE A;  3AXA A;  4E34 A;  3GDV A;  4KFV A;  4NMS A;  3GCO A;  5E6P B;  1Q7X A;  1WIF A;  3HPM A;  2EEJ A;  1TE0 A;  2GEF A;  2P3W A;  1W9Q A;  3PDZ A;  5HFB A;  3FY5 A;  3ID3 A;  5HET A;  2IWP A;  3CBX A;  1VA8 A;  1P1E A;  3NFL A;  2KQF A;  1W9O A;  4E3B A;  3O5N A;  1GM1 A;  3R69 A;  4AMH A;  2E7K A;  3CC0 A;  3QE1 A;  4F8K A;  3OU0 A;  2PKU A;  1UJD A;  2I4S A;  1M5Z A;  2QKU A;  1U3B A;  4Q2P A;  1FCF A;  1T2M A;  1WI4 A;  1I92 A;  2LA8 A;  2QT5 A;  1UM1 A;  2I6V A;  2PZD A;  3K1R A;  1WI2 A;  2YUY A;  5G1D A;  3GDS A;  2LUI A;  1I16 A;  2EGO A;  2LC7 A;  4OEP A;  2H3L A;  2G5M B;  1GQ5 A;  2H2B A;  5FHT A;  2DAZ A;  3CYY A;  1N99 A;  1V6B A;  2JIL A;  5HFC A;  2JIK A;  2DLS A;  3I18 A;  3RLE A;  2EGN A;  2DC2 A;  2EV8 A;  3DJ3 A;  1WJL A;  2L4T A;  3PS4 A;  3ID2 A;  3WKM A;  5HED A;  1N7E A;  4NNM A;  2M0V A;  2AWU A;  2R3Y A;  1B8Q A;  2JOA A;  3QJM A;  2FN5 A;  3KZD A;  3HPK A;  2OGP A;  3E17 A;  1NF3 C;  2VPH A;  2W4F A;  1UJU A;  4JOK A;  3GDU A;  1FC6 A;  2AWX A;  4OEO A;  3WKL A;  1UJV A;  3NCV A;  4GVC A;  1N7F A;  2O2T A;  1X5R A; 
#chains in the Genus database with same CATH homology
 2QBW A;  4P2A B;  3GGE A;  1FC7 A;  4GVD A;  4WYT A;  4JOR A;  4Q2O A;  2I1N A;  4Q2N A;  1QAV A;  3RL7 A;  1WH1 A;  2WL7 A;  2I04 A;  2F0A A;  1P1D A;  4IC6 A;  4N6X A;  4NMT A;  4HOP A;  5GND A;  2EDP A;  3QDO A;  2ZPM A;  1KEF A;  2JIN A;  5E22 A;  2DJT A;  5H3J A;  1RGR A;  2K20 A;  5HFF A;  1X5N A;  5E1Y A;  4XHV A;  2EDV A;  2HE2 A;  2QG1 A;  3K50 A;  3GAB A;  3SUZ A;  1X5Q A;  4MPA A;  1VAE A;  2JSN A;  1QAV B;  1N7T A;  1WF7 A;  4LMM A;  4R2Z A;  1K32 A;  4YYX A;  5HJ1 A;  2KBS A;  1SOT A;  2KJK A;  3HVQ C;  1IHJ A;  4HOP B;  4K72 A;  1RZX A;  3DOR A;  2D90 A;  4NMR A;  3TMH A;  4NNL A;  3EGG C;  2BYG A;  1OBZ A;  4JOP A;  3ID4 A;  2VWR A;  5E11 A;  5F3X A;  1U37 A;  5HDY A;  3KZE A;  4Q3H A;  5HF4 A;  1UF1 A;  4H11 A;  3R0H A;  2KYL A;  2V1W A;  2I0I A;  2QKT A;  1UEP A;  3DJA A;  4KFW A;  2KA9 A;  3MH6 A;  2YT8 A;  3CS0 A;  4JOH A;  1SOZ A;  3NFK A;  2OPG A;  2DMZ A;  4UU6 A;  1ZUB A;  3PV2 A;  1IU2 A;  2KOJ A;  2KJP A;  4NXP A;  1W9E A;  2Z17 A;  3SOE A;  1BE9 A;  2IWO A;  2REY A;  2EJY A;  1WHA A;  2EEI A;  2FNE A;  2DM8 A;  3I4W A;  1Z86 A;  1R6J A;  1N6F A;  2V90 A;  2OQS A;  4JL7 A;  2I0L A;  1UFX A;  2EDZ A;  2IWQ A;  1MFG A;  3QGL A;  3K82 A;  4Q6S A;  2PKT A;  1D5G A;  4P0C A;  1TQ3 A;  2FCF A;  1XZ9 A;  5D13 A;  1TP3 A;  4G69 A;  2OMJ A;  3EGH C;  2VSP A;  2OZF A;  1U39 A;  2L4S A;  2KOH A;  2KPK A;  5HFE A;  1Y7N A;  1X8S A;  5G1E A;  2M0T A;  3ID1 A;  4JOF A;  1BFE A;  3LNX A;  4Z33 A;  2OSG A;  1UEZ A;  5B6L A;  3QIK A;  1V5Q A;  2VSV A;  2AWW A;  2DKR A;  3JXT A;  3KDK A;  1VCW A;  5E21 A;  1LCY A;  4K6Y A;  2KAW A;  2LC6 A;  2QKV A;  2PA1 A;  4Q2Q A;  3B76 A;  5HF1 A;  2JWE A;  1Y8T A;  2PDZ A;  4E35 A;  3L4F D;  1OZI A;  3CH8 A;  4WYU A;  2HE4 A;  2PNT A;  4JOG A;  3PV4 A;  1OBX A;  1QLC A;  4GHN A;  4NXR A;  3NGH A;  1IU0 A;  3DJ1 A;  1UM7 A;  1U38 A;  5HEY A;  2YUB A;  2KOM A;  2ZPL A;  4Q6H A;  4FLN A;  5IL9 A;  2FE5 A;  1Q3O A;  3TSW A;  2VZ5 A;  1X6D A;  3VQF A;  2K1Z A;  2D8I A;  5EZ0 A;  1VB7 A;  5I7Z A;  3CBY A;  5GLJ A;  1FC9 A;  3R68 A;  2OCS A;  3SHU A;  3ZRT A;  1ZOK A;  1V1T A;  2Z9I A;  2GZV A;  5FB8 C;  3BPU A;  3GCN A;  2RRM A;  2M3M A;  4UU5 A;  2EAQ A;  1KWA A;  2MX6 A;  1YBO A;  1X45 A;  4NMO A;  1WF8 A;  3CBZ A;  1RGW A;  2AIN A;  2KG2 A;  2OS6 A;  2EGK A;  2RCZ A;  1N6E A;  1V62 A;  2Q3G A;  2DB5 A;  3OTP A;  3KHF A;  1Z87 A;  3GJ9 A;  3QJN A;  4NMQ A;  3TSV A;  2W7R A;  4NXQ A;  2X7Z A;  1NTE A;  5JXB A;  2HGA A;  3LNY A;  2JRE A;  5A2P A;  1TP5 A;  4JOJ A;  4EDJ A;  2KJD A;  1L6O A;  2ENO A;  2M0Z A;  1OBY A;  2CS5 A;  2L97 A;  1GQ4 A;  3PV5 A;  2LOB A;  2F5Y A;  4L8N A;  2D92 A;  2EEH A;  3MH4 A;  5ILB A;  2KL1 A;  2CSJ A;  5HFD A;  1UEW A;  2CSS A;  3I1E A;  1RY4 A;  2MHO A;  3PDV A;  3QO6 A;  3GSL A;  3STJ A;  1WHD A;  2M0U A;  1MC7 A;  2M10 A;  4Z8J A;  2EXG A;  4K76 A;  3SFJ A;  4FGM A;  3SHW A;  1WG6 A;  5F67 A;  4RI0 A;  2YTW A;  5DTH A;  2DLU A;  1KY9 A;  4JJ0 A;  3TSZ A;  1UIT A;  2VRF A;  2UZC A;  2G2L A;  1G9O A;  3VQG A;  2KV8 A;  1UHP A;  2JXO A;  1N6D A;  2IWN A;  1Q3P A;  4O06 A;  4OAJ A;  4YDP A;  2KPL A;  2R4H A;  2H3M A;  5HEB A;  1UEQ A;  1X9Z A;  3DIW A;  1WFV A;  3O46 A;  3MH7 A;  1PDR A;  3RL8 A;  2YT7 A;  2EHR A;  4K75 A;  4K78 A;  4REY A;  2Q9V A;  3KDG A;  1MFL A;  2KRG A;  2H2C A;  4NMV A;  4JJ3 A;  1QAU A;  5EYZ A;  1V5L A;  5B42 A;  1VJ6 A;  4NMP A;  4PQW A;  1WFG A;  2EEG A;  4JOE A;  3AXA A;  4E34 A;  3GDV A;  4KFV A;  4NMS A;  3GCO A;  5E6P B;  1Q7X A;  1WIF A;  3HPM A;  2EEJ A;  1TE0 A;  2GEF A;  2P3W A;  1W9Q A;  3PDZ A;  5HFB A;  3FY5 A;  3ID3 A;  5HET A;  2IWP A;  3CBX A;  1VA8 A;  1P1E A;  3NFL A;  2KQF A;  1W9O A;  4E3B A;  3O5N A;  1GM1 A;  3R69 A;  4AMH A;  2E7K A;  3CC0 A;  3QE1 A;  4F8K A;  3OU0 A;  2PKU A;  1UJD A;  2I4S A;  1M5Z A;  2QKU A;  1U3B A;  4Q2P A;  1FCF A;  1T2M A;  1WI4 A;  1I92 A;  2LA8 A;  2QT5 A;  1UM1 A;  2I6V A;  2PZD A;  3K1R A;  1WI2 A;  2YUY A;  5G1D A;  3GDS A;  2LUI A;  1I16 A;  2EGO A;  2LC7 A;  4OEP A;  2H3L A;  2G5M B;  1GQ5 A;  2H2B A;  5FHT A;  2DAZ A;  3CYY A;  1N99 A;  1V6B A;  2JIL A;  5HFC A;  2JIK A;  2DLS A;  3I18 A;  3RLE A;  2EGN A;  2DC2 A;  2EV8 A;  3DJ3 A;  1WJL A;  2L4T A;  3PS4 A;  3ID2 A;  3WKM A;  5HED A;  1N7E A;  4NNM A;  2M0V A;  2AWU A;  2R3Y A;  1B8Q A;  2JOA A;  3QJM A;  2FN5 A;  3KZD A;  3HPK A;  2OGP A;  3E17 A;  1NF3 C;  2VPH A;  2W4F A;  1UJU A;  4JOK A;  3GDU A;  1FC6 A;  2AWX A;  4OEO A;  3WKL A;  1UJV A;  3NCV A;  4GVC A;  1N7F A;  2O2T A;  1X5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...