1UHPA

Solution structure of rsgi ruh-005, a pdz domain in human cdna, kiaa1095
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
107
structure length
107
Chain Sequence
GSSGSSGKSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQVLRRTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein KIAA1095
publication title Solution structure of RSGI RUH-005, a PDZ domain in human cDNA, KIAA1095
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 12
structure length 107
sequence length 107
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1uhpA00
1VAEA 1VA8A 1UITA 3O46A 2M0VA 1WG6A 4FGMA 5HFBA 3ID1A 3QO6A 1FC6A 2AWUA 2Z9IA 5GNDA 2KJKA 4YYXA 2L4TA 2QKTA 1N6FA 2K20A 4GVCA 2VZ5A 3CBXA 3QJNA 3RL7A 2M0ZA 1LCYA 2DLUA 1WJLA 2KBSA 2JIKA 1WF8A 2H2CA 2VWRA 4Q6SA 3R68A 4NXRA 3CH8A 3E17A 4E34A 3GDUA 3OTPA 1N7TA 2EEGA 3RLEA 1UEQA 3QGLA 2EGOA 2FN5A 5HFFA 2KAWA 3QDOA 2KYLA 2KL1A 1WH1A 3FY5A 3B76A 5HEDA 1OBXA 4JOEA 5A2PA 2L97A 5HFCA 2PKTA 3NFLA 2K1ZA 4Q2NA 4NMOA 3LNYA 1UJVA 3PV4A 3VQGA 4UU6A 1U39A 4XHVA 5HF1A 1WHDA 1WIFA 2CS5A 1QLCA 3DJ1A 1VCWA 1TQ3A 1X45A 2DC2A 4LMMA 1N6DA 3PDZA 5F67A 1BFEA 4NNLA 2P3WA 3PV2A 2ENOA 3DJAA 2LA8A 4Q2OA 1N7FA 1TP3A 4K78A 1UJDA 3K50A 2D92A 1X6DA 2FNEA 2V90A 5E6PB 4E35A 2IWQA 3DIWA 1SOTA 1GQ4A 1UM7A 1V5QA 1X5NA 4GHNA 4N6XA 4L8NA 1QAVB 3CBYA 2M0TA 5GLJA 3NGHA 3I1EA 2LOBA 2IWPA 2ZPLA 5HJ1A 4OEOA 3HPKA 4JOHA 4Q2QA 2CSJA 2JOAA 3ID3A 1VB7A 2EDPA 4YDPA 1OBYA 2HE4A 2EEJA 3STJA 2H3MA 1U3BA 2KQFA 2M3MA 1Y8TA 4E3BA 5B6LA 2KRGA 4JOPA 3DJ3A 2OSGA 2F0AA 1WHAA 5E11A 1KEFA 1V5LA 4HOPB 1VJ6A 3SFJA 1MFGA 2F5YA 1IU2A 4REYA 3EGGC 2EV8A 1W9OA 2O2TA 2GZVA 2WL7A 3MH7A 4NMPA 2KV8A 5D13A 4O06A 4Z8JA 2DMZA 2PKUA 2JILA 2HE2A 2PDZA 2HGAA 4Q3HA 1Q3OA 1YBOA 4OAJA 1ZOKA 2MX6A 2BYGA 2PZDA 1XZ9A 2R4HA 4JL7A 2VSVA 3BPUA 1RZXA 1U37A 3JXTA 4F8KA 3ID2A 5G1EA 4OEPA 2KJDA 1R6JA 4NNMA 4K75A 1TE0A 4Q6HA 3GJ9A 4WYTA 2M10A 1IHJA 1V1TA 1D5GA 3EGHC 2EHRA 3TSWA 2AINA 1N7EA 2OS6A 2I4SA 3R0HA 5H3JA 5HDYA 4NMRA 2H3LA 1G9OA 4G69A 3MH4A 4EDJA 4JOGA 2Q3GA 1WI2A 1MC7A 3PS4A 1NTEA 2OCSA 1U38A 1QAVA 2MHOA 3I18A 4K76A 3KHFA 2AWWA 4NMTA 2YT8A 4MPAA 1X5QA 2DJTA 1X8SA 2KOHA 3TMHA 5FHTA 3GCOA 1OZIA 1V6BA 2EEHA 3OU0A 2DM8A 2LC7A 2UZCA 4IC6A 2QKVA 5HF4A 2OGPA 4JOFA 2IWNA 1V62A 2YUBA 1T2MA 5HEBA 1IU0A 2L4SA 1FCFA 1TP5A 4JOJA 2DB5A 2OPGA 2EJYA 2W4FA 4HOPA 3KZDA 1QAUA 1M5ZA 3GSLA 2VSPA 1FC9A 1BE9A 3ID4A 3L4FD 2CSSA 1I16A 2ZPMA 3TSVA 2OZFA 2I1NA 3QJMA 1UHPA 5JXBA 2PA1A 3TSZA 2QG1A 2QT5A 1N99A 3K82A 1Q3PA 4GVDA 2KJPA 1OBZA 2KPLA 2EDVA 3MH6A 3QIKA 4H11A 1SOZA 2DKRA 4KFWA 4NMQA 5DTHA 2KG2A 2KA9A 1UEZA 3SHWA 1FC7A 3GGEA 1RGRA 1I92A 1Q7XA 4P2AB 1ZUBA 3QE1A 4NXPA 3DORA 1UF1A 1GQ5A 2JXOA 1P1EA 4KFVA 5E1YA 1RGWA 5HFDA 3VQFA 3WKMA 1K32A 1KWAA 2X7ZA 2AWXA 1UFXA 2I6VA 2RCZA 2LC6A 1WFVA 5E21A 3LNXA 2EGKA 2RRMA 1PDRA 5F3XA 3CS0A 4Q2PA 1KY9A 1UM1A 1Y7NA 3HVQC 1N6EA 5E22A 2DLSA 1GM1A 2JWEA 4RI0A 3SHUA 4Z33A 3SOEA 2M0UA 5EYZA 2FCFA 1W9EA 3GDSA 2I04A 4UU5A 2V1WA 2KOMA 4NMVA 2KPKA 4K6YA 2Z17A 3CBZA 3CC0A 2EAQA 1UEPA 1W9QA 3PDVA 2LUIA 2JREA 1Z86A 4K72A 5G1DA 1Z87A 4NMSA 2OMJA 2D90A 3RL8A 4PQWA 1WF7A 2YT7A 3GDVA 3ZRTA 5HFEA 2PNTA 2KOJA 1UEWA 1P1DA 2YUYA 3KZEA 2W7RA 1X5RA 1L6OA 3O5NA 5EZ0A 1NF3C 2JINA 2FE5A 3GCNA 1MFLA 2G2LA 2G5MB 2IWOA 4JOKA 5I7ZA 5HEYA 2Q9VA 3PV5A 3AXAA 4P0CA 3K1RA 2REYA 2YTWA 1UJUA 2EGNA 3I4WA 1B8QA 4NXQA 2R3YA 2QKUA 2I0IA 3R69A 2VRFA 4R2ZA 2EXGA 2EDZA 4AMHA 4WYUA 2QBWA 3CYYA 5FB8C 4JORA 5HETA 2E7KA 3SUZA 2D8IA 3NFKA 2VPHA 2H2BA 2OQSA 3HPMA 3WKLA 2DAZA 1WFGA 2EEIA 2I0LA 1WI4A 1RY4A
chains in the Genus database with same CATH superfamily
1VAEA 1VA8A 1UITA 3O46A 2M0VA 1WG6A 4FGMA 5HFBA 3ID1A 3QO6A 1FC6A 2AWUA 2Z9IA 5GNDA 2KJKA 4YYXA 2L4TA 2QKTA 1N6FA 2K20A 4GVCA 2VZ5A 3CBXA 3QJNA 3RL7A 2M0ZA 1LCYA 2DLUA 1WJLA 2KBSA 2JIKA 1WF8A 2H2CA 2VWRA 4Q6SA 3R68A 4NXRA 3CH8A 3E17A 4E34A 3GDUA 3OTPA 1N7TA 2EEGA 3RLEA 1UEQA 3QGLA 2EGOA 2FN5A 5HFFA 2KAWA 3QDOA 2KYLA 2KL1A 1WH1A 3FY5A 3B76A 5HEDA 1OBXA 4JOEA 4JJ0A 5A2PA 2L97A 5HFCA 2PKTA 3NFLA 2K1ZA 4Q2NA 4NMOA 3LNYA 1UJVA 3PV4A 3VQGA 4UU6A 1U39A 4XHVA 5HF1A 1WHDA 1WIFA 2CS5A 1QLCA 3DJ1A 1VCWA 1TQ3A 1X45A 2DC2A 4LMMA 1X9ZA 1N6DA 4FLNA 3PDZA 5F67A 2GEFA 1BFEA 4NNLA 2P3WA 3PV2A 2ENOA 3DJAA 2LA8A 4Q2OA 1N7FA 1TP3A 4K78A 1UJDA 3K50A 2D92A 1X6DA 2FNEA 2V90A 5E6PB 4E35A 2IWQA 3DIWA 1SOTA 1GQ4A 1UM7A 1V5QA 1X5NA 4GHNA 4N6XA 4L8NA 1QAVB 3CBYA 2M0TA 5GLJA 3NGHA 3I1EA 2LOBA 2IWPA 2ZPLA 5HJ1A 4OEOA 3HPKA 4JOHA 4Q2QA 2CSJA 2JOAA 3ID3A 1VB7A 2EDPA 4YDPA 1OBYA 2HE4A 2EEJA 3STJA 2H3MA 1U3BA 2KQFA 2M3MA 1Y8TA 4E3BA 5B6LA 2KRGA 4JOPA 3DJ3A 3NCVA 2OSGA 2F0AA 1WHAA 5E11A 1KEFA 1V5LA 4HOPB 1VJ6A 3SFJA 1MFGA 2F5YA 1IU2A 4REYA 3EGGC 2EV8A 1W9OA 2O2TA 2GZVA 2WL7A 3MH7A 4NMPA 2KV8A 5D13A 4O06A 4Z8JA 2DMZA 2PKUA 2JILA 2HE2A 2PDZA 2HGAA 4Q3HA 1Q3OA 1YBOA 4OAJA 1ZOKA 2MX6A 2BYGA 2PZDA 1XZ9A 2R4HA 4JL7A 2VSVA 3BPUA 1RZXA 1U37A 3JXTA 4F8KA 3ID2A 5G1EA 4OEPA 2KJDA 1R6JA 4NNMA 4K75A 1TE0A 4Q6HA 3GJ9A 4WYTA 2M10A 1IHJA 1V1TA 1D5GA 3EGHC 2EHRA 3TSWA 2AINA 1N7EA 2OS6A 2I4SA 3KDGA 3R0HA 5H3JA 5HDYA 4NMRA 2H3LA 1G9OA 4G69A 3MH4A 4EDJA 4JOGA 2Q3GA 1WI2A 1MC7A 3PS4A 1NTEA 2OCSA 1U38A 1QAVA 2MHOA 3I18A 4K76A 3KHFA 2AWWA 4NMTA 2YT8A 4MPAA 1X5QA 2DJTA 1X8SA 2KOHA 3TMHA 5FHTA 3GCOA 5IL9A 1OZIA 1V6BA 2EEHA 3OU0A 2DM8A 2LC7A 2UZCA 4IC6A 2QKVA 5HF4A 2OGPA 4JOFA 2IWNA 1V62A 2YUBA 1T2MA 5HEBA 1IU0A 2L4SA 1FCFA 1TP5A 4JOJA 2DB5A 2OPGA 2EJYA 2W4FA 4HOPA 3KZDA 1QAUA 1M5ZA 3GSLA 2VSPA 1FC9A 1BE9A 3ID4A 3L4FD 2JSNA 2CSSA 1I16A 2ZPMA 3TSVA 2OZFA 2I1NA 3QJMA 1UHPA 5JXBA 2PA1A 3TSZA 2QG1A 2QT5A 1N99A 3K82A 1Q3PA 4GVDA 3GABA 2KJPA 1OBZA 2KPLA 2EDVA 3MH6A 3QIKA 4H11A 1SOZA 2DKRA 4KFWA 4NMQA 5DTHA 2KG2A 2KA9A 1UEZA 3SHWA 1FC7A 3GGEA 1RGRA 1I92A 1Q7XA 4P2AB 1ZUBA 3QE1A 4NXPA 3DORA 1UF1A 1GQ5A 2JXOA 1P1EA 4KFVA 5E1YA 1RGWA 5HFDA 3VQFA 3WKMA 1K32A 1KWAA 2X7ZA 2AWXA 4JJ3A 1UFXA 2I6VA 2RCZA 2LC6A 1WFVA 5E21A 3LNXA 2EGKA 2RRMA 1PDRA 5F3XA 3CS0A 4Q2PA 1KY9A 1UM1A 1Y7NA 3HVQC 1N6EA 5E22A 2DLSA 1GM1A 2JWEA 4RI0A 3SHUA 4Z33A 3SOEA 2M0UA 5EYZA 2FCFA 1W9EA 3GDSA 5B42A 2I04A 4UU5A 2V1WA 2KOMA 4NMVA 2KPKA 4K6YA 2Z17A 3CBZA 3CC0A 2EAQA 1UEPA 1W9QA 3PDVA 2LUIA 2JREA 1Z86A 4K72A 5G1DA 1Z87A 4NMSA 2OMJA 2D90A 3KDKA 3RL8A 4PQWA 1WF7A 2YT7A 3GDVA 3ZRTA 5HFEA 2PNTA 2KOJA 1UEWA 1P1DA 5ILBA 2YUYA 3KZEA 2W7RA 1X5RA 1L6OA 3O5NA 5EZ0A 1NF3C 2JINA 2FE5A 3GCNA 1MFLA 2G2LA 2G5MB 2IWOA 4JOKA 5I7ZA 5HEYA 2Q9VA 3PV5A 3AXAA 4P0CA 3K1RA 2REYA 2YTWA 1UJUA 2EGNA 3I4WA 1B8QA 4NXQA 2R3YA 2QKUA 2I0IA 3R69A 2VRFA 4R2ZA 2EXGA 2EDZA 4AMHA 4WYUA 2QBWA 3CYYA 5FB8C 4JORA 5HETA 2E7KA 3SUZA 2D8IA 3NFKA 2VPHA 2H2BA 2OQSA 3HPMA 3WKLA 2DAZA 1WFGA 2EEIA 2I0LA 1WI4A 1RY4A
chains in the Genus database with same CATH topology
1VAEA 1VA8A 1UITA 3O46A 2M0VA 1WG6A 4FGMA 5HFBA 3ID1A 3QO6A 1FC6A 2AWUA 2Z9IA 5GNDA 2KJKA 4YYXA 2L4TA 2QKTA 1N6FA 2K20A 4GVCA 2VZ5A 3CBXA 3QJNA 3RL7A 2M0ZA 1LCYA 2DLUA 1WJLA 2KBSA 2JIKA 1WF8A 2H2CA 2VWRA 4Q6SA 3R68A 4NXRA 3CH8A 3E17A 4E34A 3GDUA 3OTPA 1N7TA 2EEGA 3RLEA 1UEQA 3QGLA 2EGOA 2FN5A 5HFFA 2KAWA 3QDOA 2KYLA 2KL1A 1WH1A 3FY5A 3B76A 5HEDA 1OBXA 4JOEA 4JJ0A 5A2PA 2L97A 5HFCA 2PKTA 3NFLA 2K1ZA 4Q2NA 4NMOA 3LNYA 1UJVA 3PV4A 3VQGA 4UU6A 1U39A 4XHVA 5HF1A 1WHDA 1WIFA 2CS5A 1QLCA 3DJ1A 1VCWA 1TQ3A 1X45A 2DC2A 4LMMA 1X9ZA 1N6DA 4FLNA 3PDZA 5F67A 2GEFA 1BFEA 4NNLA 2P3WA 3PV2A 2ENOA 3DJAA 2LA8A 4Q2OA 1N7FA 1TP3A 4K78A 1UJDA 3K50A 2D92A 1X6DA 2FNEA 2V90A 5E6PB 4E35A 2IWQA 3DIWA 1SOTA 1GQ4A 1UM7A 1V5QA 1X5NA 4GHNA 4N6XA 4L8NA 1QAVB 3CBYA 2M0TA 5GLJA 3NGHA 3I1EA 2LOBA 2IWPA 2ZPLA 5HJ1A 4OEOA 3HPKA 4JOHA 4Q2QA 2CSJA 2JOAA 3ID3A 1VB7A 2EDPA 4YDPA 1OBYA 2HE4A 2EEJA 3STJA 2H3MA 1U3BA 2KQFA 2M3MA 1Y8TA 4E3BA 5B6LA 2KRGA 4JOPA 3DJ3A 3NCVA 2OSGA 2F0AA 1WHAA 5E11A 1KEFA 1V5LA 4HOPB 1VJ6A 3SFJA 1MFGA 2F5YA 1IU2A 4REYA 3EGGC 2EV8A 1W9OA 2O2TA 2GZVA 2WL7A 3MH7A 4NMPA 2KV8A 5D13A 4O06A 4Z8JA 2DMZA 2PKUA 2JILA 2HE2A 2PDZA 2HGAA 4Q3HA 1Q3OA 1YBOA 4OAJA 1ZOKA 2MX6A 2BYGA 2PZDA 1XZ9A 2R4HA 4JL7A 2VSVA 3BPUA 1RZXA 1U37A 3JXTA 4F8KA 3ID2A 5G1EA 4OEPA 2KJDA 1R6JA 4NNMA 4K75A 1TE0A 4Q6HA 3GJ9A 4WYTA 2M10A 1IHJA 1V1TA 1D5GA 3EGHC 2EHRA 3TSWA 2AINA 1N7EA 2OS6A 2I4SA 3KDGA 3R0HA 5H3JA 5HDYA 4NMRA 2H3LA 1G9OA 4G69A 3MH4A 4EDJA 4JOGA 2Q3GA 1WI2A 1MC7A 3PS4A 1NTEA 2OCSA 1U38A 1QAVA 2MHOA 3I18A 4K76A 3KHFA 2AWWA 4NMTA 2YT8A 4MPAA 1X5QA 2DJTA 1X8SA 2KOHA 3TMHA 5FHTA 3GCOA 5IL9A 1OZIA 1V6BA 2EEHA 3OU0A 2DM8A 2LC7A 2UZCA 4IC6A 2QKVA 5HF4A 2OGPA 4JOFA 2IWNA 1V62A 2YUBA 1T2MA 5HEBA 1IU0A 2L4SA 1FCFA 1TP5A 4JOJA 2DB5A 2OPGA 2EJYA 2W4FA 4HOPA 3KZDA 1QAUA 1M5ZA 3GSLA 2VSPA 1FC9A 1BE9A 3ID4A 3L4FD 2JSNA 2CSSA 1I16A 2ZPMA 3TSVA 2OZFA 2I1NA 3QJMA 1UHPA 5JXBA 2PA1A 3TSZA 2QG1A 2QT5A 1N99A 3K82A 1Q3PA 4GVDA 3GABA 2KJPA 1OBZA 2KPLA 2EDVA 3MH6A 3QIKA 4H11A 1SOZA 2DKRA 4KFWA 4NMQA 5DTHA 2KG2A 2KA9A 1UEZA 3SHWA 1FC7A 3GGEA 1RGRA 1I92A 1Q7XA 4P2AB 1ZUBA 3QE1A 4NXPA 3DORA 1UF1A 1GQ5A 2JXOA 1P1EA 4KFVA 5E1YA 1RGWA 5HFDA 3VQFA 3WKMA 1K32A 1KWAA 2X7ZA 2AWXA 4JJ3A 1UFXA 2I6VA 2RCZA 2LC6A 1WFVA 5E21A 3LNXA 2EGKA 2RRMA 1PDRA 5F3XA 3CS0A 4Q2PA 1KY9A 1UM1A 1Y7NA 3HVQC 1N6EA 5E22A 2DLSA 1GM1A 2JWEA 4RI0A 3SHUA 4Z33A 3SOEA 2M0UA 5EYZA 2FCFA 1W9EA 3GDSA 5B42A 2I04A 4UU5A 2V1WA 2KOMA 4NMVA 2KPKA 4K6YA 2Z17A 3CBZA 3CC0A 2EAQA 1UEPA 1W9QA 3PDVA 2LUIA 2JREA 1Z86A 4K72A 5G1DA 1Z87A 4NMSA 2OMJA 2D90A 3KDKA 3RL8A 4PQWA 1WF7A 2YT7A 3GDVA 3ZRTA 5HFEA 2PNTA 2KOJA 1UEWA 1P1DA 5ILBA 2YUYA 3KZEA 2W7RA 1X5RA 1L6OA 3O5NA 5EZ0A 1NF3C 2JINA 2FE5A 3GCNA 1MFLA 2G2LA 2G5MB 2IWOA 4JOKA 5I7ZA 5HEYA 2Q9VA 3PV5A 3AXAA 4P0CA 3K1RA 2REYA 2YTWA 1UJUA 2EGNA 3I4WA 1B8QA 4NXQA 2R3YA 2QKUA 2I0IA 3R69A 2VRFA 4R2ZA 2EXGA 2EDZA 4AMHA 4WYUA 2QBWA 3CYYA 5FB8C 4JORA 5HETA 2E7KA 3SUZA 2D8IA 3NFKA 2VPHA 2H2BA 2OQSA 3HPMA 3WKLA 2DAZA 1WFGA 2EEIA 2I0LA 1WI4A 1RY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAE A;  1VA8 A;  1UIT A;  3O46 A;  2M0V A;  1WG6 A;  4FGM A;  5HFB A;  3ID1 A;  3QO6 A;  1FC6 A;  2AWU A;  2Z9I A;  5GND A;  2KJK A;  4YYX A;  2L4T A;  2QKT A;  1N6F A;  2K20 A;  4GVC A;  2VZ5 A;  3CBX A;  3QJN A;  3RL7 A;  2M0Z A;  1LCY A;  2DLU A;  1WJL A;  2KBS A;  2JIK A;  1WF8 A;  2H2C A;  2VWR A;  4Q6S A;  3R68 A;  4NXR A;  3CH8 A;  3E17 A;  4E34 A;  3GDU A;  3OTP A;  1N7T A;  2EEG A;  3RLE A;  1UEQ A;  3QGL A;  2EGO A;  2FN5 A;  5HFF A;  2KAW A;  3QDO A;  2KYL A;  2KL1 A;  1WH1 A;  3FY5 A;  3B76 A;  5HED A;  1OBX A;  4JOE A;  5A2P A;  2L97 A;  5HFC A;  2PKT A;  3NFL A;  2K1Z A;  4Q2N A;  4NMO A;  3LNY A;  1UJV A;  3PV4 A;  3VQG A;  4UU6 A;  1U39 A;  4XHV A;  5HF1 A;  1WHD A;  1WIF A;  2CS5 A;  1QLC A;  3DJ1 A;  1VCW A;  1TQ3 A;  1X45 A;  2DC2 A;  4LMM A;  1N6D A;  3PDZ A;  5F67 A;  1BFE A;  4NNL A;  2P3W A;  3PV2 A;  2ENO A;  3DJA A;  2LA8 A;  4Q2O A;  1N7F A;  1TP3 A;  4K78 A;  1UJD A;  3K50 A;  2D92 A;  1X6D A;  2FNE A;  2V90 A;  5E6P B;  4E35 A;  2IWQ A;  3DIW A;  1SOT A;  1GQ4 A;  1UM7 A;  1V5Q A;  1X5N A;  4GHN A;  4N6X A;  4L8N A;  1QAV B;  3CBY A;  2M0T A;  5GLJ A;  3NGH A;  3I1E A;  2LOB A;  2IWP A;  2ZPL A;  5HJ1 A;  4OEO A;  3HPK A;  4JOH A;  4Q2Q A;  2CSJ A;  2JOA A;  3ID3 A;  1VB7 A;  2EDP A;  4YDP A;  1OBY A;  2HE4 A;  2EEJ A;  3STJ A;  2H3M A;  1U3B A;  2KQF A;  2M3M A;  1Y8T A;  4E3B A;  5B6L A;  2KRG A;  4JOP A;  3DJ3 A;  2OSG A;  2F0A A;  1WHA A;  5E11 A;  1KEF A;  1V5L A;  4HOP B;  1VJ6 A;  3SFJ A;  1MFG A;  2F5Y A;  1IU2 A;  4REY A;  3EGG C;  2EV8 A;  1W9O A;  2O2T A;  2GZV A;  2WL7 A;  3MH7 A;  4NMP A;  2KV8 A;  5D13 A;  4O06 A;  4Z8J A;  2DMZ A;  2PKU A;  2JIL A;  2HE2 A;  2PDZ A;  2HGA A;  4Q3H A;  1Q3O A;  1YBO A;  4OAJ A;  1ZOK A;  2MX6 A;  2BYG A;  2PZD A;  1XZ9 A;  2R4H A;  4JL7 A;  2VSV A;  3BPU A;  1RZX A;  1U37 A;  3JXT A;  4F8K A;  3ID2 A;  5G1E A;  4OEP A;  2KJD A;  1R6J A;  4NNM A;  4K75 A;  1TE0 A;  4Q6H A;  3GJ9 A;  4WYT A;  2M10 A;  1IHJ A;  1V1T A;  1D5G A;  3EGH C;  2EHR A;  3TSW A;  2AIN A;  1N7E A;  2OS6 A;  2I4S A;  3R0H A;  5H3J A;  5HDY A;  4NMR A;  2H3L A;  1G9O A;  4G69 A;  3MH4 A;  4EDJ A;  4JOG A;  2Q3G A;  1WI2 A;  1MC7 A;  3PS4 A;  1NTE A;  2OCS A;  1U38 A;  1QAV A;  2MHO A;  3I18 A;  4K76 A;  3KHF A;  2AWW A;  4NMT A;  2YT8 A;  4MPA A;  1X5Q A;  2DJT A;  1X8S A;  2KOH A;  3TMH A;  5FHT A;  3GCO A;  1OZI A;  1V6B A;  2EEH A;  3OU0 A;  2DM8 A;  2LC7 A;  2UZC A;  4IC6 A;  2QKV A;  5HF4 A;  2OGP A;  4JOF A;  2IWN A;  1V62 A;  2YUB A;  1T2M A;  5HEB A;  1IU0 A;  2L4S A;  1FCF A;  1TP5 A;  4JOJ A;  2DB5 A;  2OPG A;  2EJY A;  2W4F A;  4HOP A;  3KZD A;  1QAU A;  1M5Z A;  3GSL A;  2VSP A;  1FC9 A;  1BE9 A;  3ID4 A;  3L4F D;  2CSS A;  1I16 A;  2ZPM A;  3TSV A;  2OZF A;  2I1N A;  3QJM A;  1UHP A;  5JXB A;  2PA1 A;  3TSZ A;  2QG1 A;  2QT5 A;  1N99 A;  3K82 A;  1Q3P A;  4GVD A;  2KJP A;  1OBZ A;  2KPL A;  2EDV A;  3MH6 A;  3QIK A;  4H11 A;  1SOZ A;  2DKR A;  4KFW A;  4NMQ A;  5DTH A;  2KG2 A;  2KA9 A;  1UEZ A;  3SHW A;  1FC7 A;  3GGE A;  1RGR A;  1I92 A;  1Q7X A;  4P2A B;  1ZUB A;  3QE1 A;  4NXP A;  3DOR A;  1UF1 A;  1GQ5 A;  2JXO A;  1P1E A;  4KFV A;  5E1Y A;  1RGW A;  5HFD A;  3VQF A;  3WKM A;  1K32 A;  1KWA A;  2X7Z A;  2AWX A;  1UFX A;  2I6V A;  2RCZ A;  2LC6 A;  1WFV A;  5E21 A;  3LNX A;  2EGK A;  2RRM A;  1PDR A;  5F3X A;  3CS0 A;  4Q2P A;  1KY9 A;  1UM1 A;  1Y7N A;  3HVQ C;  1N6E A;  5E22 A;  2DLS A;  1GM1 A;  2JWE A;  4RI0 A;  3SHU A;  4Z33 A;  3SOE A;  2M0U A;  5EYZ A;  2FCF A;  1W9E A;  3GDS A;  2I04 A;  4UU5 A;  2V1W A;  2KOM A;  4NMV A;  2KPK A;  4K6Y A;  2Z17 A;  3CBZ A;  3CC0 A;  2EAQ A;  1UEP A;  1W9Q A;  3PDV A;  2LUI A;  2JRE A;  1Z86 A;  4K72 A;  5G1D A;  1Z87 A;  4NMS A;  2OMJ A;  2D90 A;  3RL8 A;  4PQW A;  1WF7 A;  2YT7 A;  3GDV A;  3ZRT A;  5HFE A;  2PNT A;  2KOJ A;  1UEW A;  1P1D A;  2YUY A;  3KZE A;  2W7R A;  1X5R A;  1L6O A;  3O5N A;  5EZ0 A;  1NF3 C;  2JIN A;  2FE5 A;  3GCN A;  1MFL A;  2G2L A;  2G5M B;  2IWO A;  4JOK A;  5I7Z A;  5HEY A;  2Q9V A;  3PV5 A;  3AXA A;  4P0C A;  3K1R A;  2REY A;  2YTW A;  1UJU A;  2EGN A;  3I4W A;  1B8Q A;  4NXQ A;  2R3Y A;  2QKU A;  2I0I A;  3R69 A;  2VRF A;  4R2Z A;  2EXG A;  2EDZ A;  4AMH A;  4WYU A;  2QBW A;  3CYY A;  5FB8 C;  4JOR A;  5HET A;  2E7K A;  3SUZ A;  2D8I A;  3NFK A;  2VPH A;  2H2B A;  2OQS A;  3HPM A;  3WKL A;  2DAZ A;  1WFG A;  2EEI A;  2I0L A;  1WI4 A;  1RY4 A; 
#chains in the Genus database with same CATH topology
 1VAE A;  1VA8 A;  1UIT A;  3O46 A;  2M0V A;  1WG6 A;  4FGM A;  5HFB A;  3ID1 A;  3QO6 A;  1FC6 A;  2AWU A;  2Z9I A;  5GND A;  2KJK A;  4YYX A;  2L4T A;  2QKT A;  1N6F A;  2K20 A;  4GVC A;  2VZ5 A;  3CBX A;  3QJN A;  3RL7 A;  2M0Z A;  1LCY A;  2DLU A;  1WJL A;  2KBS A;  2JIK A;  1WF8 A;  2H2C A;  2VWR A;  4Q6S A;  3R68 A;  4NXR A;  3CH8 A;  3E17 A;  4E34 A;  3GDU A;  3OTP A;  1N7T A;  2EEG A;  3RLE A;  1UEQ A;  3QGL A;  2EGO A;  2FN5 A;  5HFF A;  2KAW A;  3QDO A;  2KYL A;  2KL1 A;  1WH1 A;  3FY5 A;  3B76 A;  5HED A;  1OBX A;  4JOE A;  4JJ0 A;  5A2P A;  2L97 A;  5HFC A;  2PKT A;  3NFL A;  2K1Z A;  4Q2N A;  4NMO A;  3LNY A;  1UJV A;  3PV4 A;  3VQG A;  4UU6 A;  1U39 A;  4XHV A;  5HF1 A;  1WHD A;  1WIF A;  2CS5 A;  1QLC A;  3DJ1 A;  1VCW A;  1TQ3 A;  1X45 A;  2DC2 A;  4LMM A;  1X9Z A;  1N6D A;  4FLN A;  3PDZ A;  5F67 A;  2GEF A;  1BFE A;  4NNL A;  2P3W A;  3PV2 A;  2ENO A;  3DJA A;  2LA8 A;  4Q2O A;  1N7F A;  1TP3 A;  4K78 A;  1UJD A;  3K50 A;  2D92 A;  1X6D A;  2FNE A;  2V90 A;  5E6P B;  4E35 A;  2IWQ A;  3DIW A;  1SOT A;  1GQ4 A;  1UM7 A;  1V5Q A;  1X5N A;  4GHN A;  4N6X A;  4L8N A;  1QAV B;  3CBY A;  2M0T A;  5GLJ A;  3NGH A;  3I1E A;  2LOB A;  2IWP A;  2ZPL A;  5HJ1 A;  4OEO A;  3HPK A;  4JOH A;  4Q2Q A;  2CSJ A;  2JOA A;  3ID3 A;  1VB7 A;  2EDP A;  4YDP A;  1OBY A;  2HE4 A;  2EEJ A;  3STJ A;  2H3M A;  1U3B A;  2KQF A;  2M3M A;  1Y8T A;  4E3B A;  5B6L A;  2KRG A;  4JOP A;  3DJ3 A;  3NCV A;  2OSG A;  2F0A A;  1WHA A;  5E11 A;  1KEF A;  1V5L A;  4HOP B;  1VJ6 A;  3SFJ A;  1MFG A;  2F5Y A;  1IU2 A;  4REY A;  3EGG C;  2EV8 A;  1W9O A;  2O2T A;  2GZV A;  2WL7 A;  3MH7 A;  4NMP A;  2KV8 A;  5D13 A;  4O06 A;  4Z8J A;  2DMZ A;  2PKU A;  2JIL A;  2HE2 A;  2PDZ A;  2HGA A;  4Q3H A;  1Q3O A;  1YBO A;  4OAJ A;  1ZOK A;  2MX6 A;  2BYG A;  2PZD A;  1XZ9 A;  2R4H A;  4JL7 A;  2VSV A;  3BPU A;  1RZX A;  1U37 A;  3JXT A;  4F8K A;  3ID2 A;  5G1E A;  4OEP A;  2KJD A;  1R6J A;  4NNM A;  4K75 A;  1TE0 A;  4Q6H A;  3GJ9 A;  4WYT A;  2M10 A;  1IHJ A;  1V1T A;  1D5G A;  3EGH C;  2EHR A;  3TSW A;  2AIN A;  1N7E A;  2OS6 A;  2I4S A;  3KDG A;  3R0H A;  5H3J A;  5HDY A;  4NMR A;  2H3L A;  1G9O A;  4G69 A;  3MH4 A;  4EDJ A;  4JOG A;  2Q3G A;  1WI2 A;  1MC7 A;  3PS4 A;  1NTE A;  2OCS A;  1U38 A;  1QAV A;  2MHO A;  3I18 A;  4K76 A;  3KHF A;  2AWW A;  4NMT A;  2YT8 A;  4MPA A;  1X5Q A;  2DJT A;  1X8S A;  2KOH A;  3TMH A;  5FHT A;  3GCO A;  5IL9 A;  1OZI A;  1V6B A;  2EEH A;  3OU0 A;  2DM8 A;  2LC7 A;  2UZC A;  4IC6 A;  2QKV A;  5HF4 A;  2OGP A;  4JOF A;  2IWN A;  1V62 A;  2YUB A;  1T2M A;  5HEB A;  1IU0 A;  2L4S A;  1FCF A;  1TP5 A;  4JOJ A;  2DB5 A;  2OPG A;  2EJY A;  2W4F A;  4HOP A;  3KZD A;  1QAU A;  1M5Z A;  3GSL A;  2VSP A;  1FC9 A;  1BE9 A;  3ID4 A;  3L4F D;  2JSN A;  2CSS A;  1I16 A;  2ZPM A;  3TSV A;  2OZF A;  2I1N A;  3QJM A;  1UHP A;  5JXB A;  2PA1 A;  3TSZ A;  2QG1 A;  2QT5 A;  1N99 A;  3K82 A;  1Q3P A;  4GVD A;  3GAB A;  2KJP A;  1OBZ A;  2KPL A;  2EDV A;  3MH6 A;  3QIK A;  4H11 A;  1SOZ A;  2DKR A;  4KFW A;  4NMQ A;  5DTH A;  2KG2 A;  2KA9 A;  1UEZ A;  3SHW A;  1FC7 A;  3GGE A;  1RGR A;  1I92 A;  1Q7X A;  4P2A B;  1ZUB A;  3QE1 A;  4NXP A;  3DOR A;  1UF1 A;  1GQ5 A;  2JXO A;  1P1E A;  4KFV A;  5E1Y A;  1RGW A;  5HFD A;  3VQF A;  3WKM A;  1K32 A;  1KWA A;  2X7Z A;  2AWX A;  4JJ3 A;  1UFX A;  2I6V A;  2RCZ A;  2LC6 A;  1WFV A;  5E21 A;  3LNX A;  2EGK A;  2RRM A;  1PDR A;  5F3X A;  3CS0 A;  4Q2P A;  1KY9 A;  1UM1 A;  1Y7N A;  3HVQ C;  1N6E A;  5E22 A;  2DLS A;  1GM1 A;  2JWE A;  4RI0 A;  3SHU A;  4Z33 A;  3SOE A;  2M0U A;  5EYZ A;  2FCF A;  1W9E A;  3GDS A;  5B42 A;  2I04 A;  4UU5 A;  2V1W A;  2KOM A;  4NMV A;  2KPK A;  4K6Y A;  2Z17 A;  3CBZ A;  3CC0 A;  2EAQ A;  1UEP A;  1W9Q A;  3PDV A;  2LUI A;  2JRE A;  1Z86 A;  4K72 A;  5G1D A;  1Z87 A;  4NMS A;  2OMJ A;  2D90 A;  3KDK A;  3RL8 A;  4PQW A;  1WF7 A;  2YT7 A;  3GDV A;  3ZRT A;  5HFE A;  2PNT A;  2KOJ A;  1UEW A;  1P1D A;  5ILB A;  2YUY A;  3KZE A;  2W7R A;  1X5R A;  1L6O A;  3O5N A;  5EZ0 A;  1NF3 C;  2JIN A;  2FE5 A;  3GCN A;  1MFL A;  2G2L A;  2G5M B;  2IWO A;  4JOK A;  5I7Z A;  5HEY A;  2Q9V A;  3PV5 A;  3AXA A;  4P0C A;  3K1R A;  2REY A;  2YTW A;  1UJU A;  2EGN A;  3I4W A;  1B8Q A;  4NXQ A;  2R3Y A;  2QKU A;  2I0I A;  3R69 A;  2VRF A;  4R2Z A;  2EXG A;  2EDZ A;  4AMH A;  4WYU A;  2QBW A;  3CYY A;  5FB8 C;  4JOR A;  5HET A;  2E7K A;  3SUZ A;  2D8I A;  3NFK A;  2VPH A;  2H2B A;  2OQS A;  3HPM A;  3WKL A;  2DAZ A;  1WFG A;  2EEI A;  2I0L A;  1WI4 A;  1RY4 A; 
#chains in the Genus database with same CATH homology
 1VAE A;  1VA8 A;  1UIT A;  3O46 A;  2M0V A;  1WG6 A;  4FGM A;  5HFB A;  3ID1 A;  3QO6 A;  1FC6 A;  2AWU A;  2Z9I A;  5GND A;  2KJK A;  4YYX A;  2L4T A;  2QKT A;  1N6F A;  2K20 A;  4GVC A;  2VZ5 A;  3CBX A;  3QJN A;  3RL7 A;  2M0Z A;  1LCY A;  2DLU A;  1WJL A;  2KBS A;  2JIK A;  1WF8 A;  2H2C A;  2VWR A;  4Q6S A;  3R68 A;  4NXR A;  3CH8 A;  3E17 A;  4E34 A;  3GDU A;  3OTP A;  1N7T A;  2EEG A;  3RLE A;  1UEQ A;  3QGL A;  2EGO A;  2FN5 A;  5HFF A;  2KAW A;  3QDO A;  2KYL A;  2KL1 A;  1WH1 A;  3FY5 A;  3B76 A;  5HED A;  1OBX A;  4JOE A;  4JJ0 A;  5A2P A;  2L97 A;  5HFC A;  2PKT A;  3NFL A;  2K1Z A;  4Q2N A;  4NMO A;  3LNY A;  1UJV A;  3PV4 A;  3VQG A;  4UU6 A;  1U39 A;  4XHV A;  5HF1 A;  1WHD A;  1WIF A;  2CS5 A;  1QLC A;  3DJ1 A;  1VCW A;  1TQ3 A;  1X45 A;  2DC2 A;  4LMM A;  1X9Z A;  1N6D A;  4FLN A;  3PDZ A;  5F67 A;  2GEF A;  1BFE A;  4NNL A;  2P3W A;  3PV2 A;  2ENO A;  3DJA A;  2LA8 A;  4Q2O A;  1N7F A;  1TP3 A;  4K78 A;  1UJD A;  3K50 A;  2D92 A;  1X6D A;  2FNE A;  2V90 A;  5E6P B;  4E35 A;  2IWQ A;  3DIW A;  1SOT A;  1GQ4 A;  1UM7 A;  1V5Q A;  1X5N A;  4GHN A;  4N6X A;  4L8N A;  1QAV B;  3CBY A;  2M0T A;  5GLJ A;  3NGH A;  3I1E A;  2LOB A;  2IWP A;  2ZPL A;  5HJ1 A;  4OEO A;  3HPK A;  4JOH A;  4Q2Q A;  2CSJ A;  2JOA A;  3ID3 A;  1VB7 A;  2EDP A;  4YDP A;  1OBY A;  2HE4 A;  2EEJ A;  3STJ A;  2H3M A;  1U3B A;  2KQF A;  2M3M A;  1Y8T A;  4E3B A;  5B6L A;  2KRG A;  4JOP A;  3DJ3 A;  3NCV A;  2OSG A;  2F0A A;  1WHA A;  5E11 A;  1KEF A;  1V5L A;  4HOP B;  1VJ6 A;  3SFJ A;  1MFG A;  2F5Y A;  1IU2 A;  4REY A;  3EGG C;  2EV8 A;  1W9O A;  2O2T A;  2GZV A;  2WL7 A;  3MH7 A;  4NMP A;  2KV8 A;  5D13 A;  4O06 A;  4Z8J A;  2DMZ A;  2PKU A;  2JIL A;  2HE2 A;  2PDZ A;  2HGA A;  4Q3H A;  1Q3O A;  1YBO A;  4OAJ A;  1ZOK A;  2MX6 A;  2BYG A;  2PZD A;  1XZ9 A;  2R4H A;  4JL7 A;  2VSV A;  3BPU A;  1RZX A;  1U37 A;  3JXT A;  4F8K A;  3ID2 A;  5G1E A;  4OEP A;  2KJD A;  1R6J A;  4NNM A;  4K75 A;  1TE0 A;  4Q6H A;  3GJ9 A;  4WYT A;  2M10 A;  1IHJ A;  1V1T A;  1D5G A;  3EGH C;  2EHR A;  3TSW A;  2AIN A;  1N7E A;  2OS6 A;  2I4S A;  3KDG A;  3R0H A;  5H3J A;  5HDY A;  4NMR A;  2H3L A;  1G9O A;  4G69 A;  3MH4 A;  4EDJ A;  4JOG A;  2Q3G A;  1WI2 A;  1MC7 A;  3PS4 A;  1NTE A;  2OCS A;  1U38 A;  1QAV A;  2MHO A;  3I18 A;  4K76 A;  3KHF A;  2AWW A;  4NMT A;  2YT8 A;  4MPA A;  1X5Q A;  2DJT A;  1X8S A;  2KOH A;  3TMH A;  5FHT A;  3GCO A;  5IL9 A;  1OZI A;  1V6B A;  2EEH A;  3OU0 A;  2DM8 A;  2LC7 A;  2UZC A;  4IC6 A;  2QKV A;  5HF4 A;  2OGP A;  4JOF A;  2IWN A;  1V62 A;  2YUB A;  1T2M A;  5HEB A;  1IU0 A;  2L4S A;  1FCF A;  1TP5 A;  4JOJ A;  2DB5 A;  2OPG A;  2EJY A;  2W4F A;  4HOP A;  3KZD A;  1QAU A;  1M5Z A;  3GSL A;  2VSP A;  1FC9 A;  1BE9 A;  3ID4 A;  3L4F D;  2JSN A;  2CSS A;  1I16 A;  2ZPM A;  3TSV A;  2OZF A;  2I1N A;  3QJM A;  1UHP A;  5JXB A;  2PA1 A;  3TSZ A;  2QG1 A;  2QT5 A;  1N99 A;  3K82 A;  1Q3P A;  4GVD A;  3GAB A;  2KJP A;  1OBZ A;  2KPL A;  2EDV A;  3MH6 A;  3QIK A;  4H11 A;  1SOZ A;  2DKR A;  4KFW A;  4NMQ A;  5DTH A;  2KG2 A;  2KA9 A;  1UEZ A;  3SHW A;  1FC7 A;  3GGE A;  1RGR A;  1I92 A;  1Q7X A;  4P2A B;  1ZUB A;  3QE1 A;  4NXP A;  3DOR A;  1UF1 A;  1GQ5 A;  2JXO A;  1P1E A;  4KFV A;  5E1Y A;  1RGW A;  5HFD A;  3VQF A;  3WKM A;  1K32 A;  1KWA A;  2X7Z A;  2AWX A;  4JJ3 A;  1UFX A;  2I6V A;  2RCZ A;  2LC6 A;  1WFV A;  5E21 A;  3LNX A;  2EGK A;  2RRM A;  1PDR A;  5F3X A;  3CS0 A;  4Q2P A;  1KY9 A;  1UM1 A;  1Y7N A;  3HVQ C;  1N6E A;  5E22 A;  2DLS A;  1GM1 A;  2JWE A;  4RI0 A;  3SHU A;  4Z33 A;  3SOE A;  2M0U A;  5EYZ A;  2FCF A;  1W9E A;  3GDS A;  5B42 A;  2I04 A;  4UU5 A;  2V1W A;  2KOM A;  4NMV A;  2KPK A;  4K6Y A;  2Z17 A;  3CBZ A;  3CC0 A;  2EAQ A;  1UEP A;  1W9Q A;  3PDV A;  2LUI A;  2JRE A;  1Z86 A;  4K72 A;  5G1D A;  1Z87 A;  4NMS A;  2OMJ A;  2D90 A;  3KDK A;  3RL8 A;  4PQW A;  1WF7 A;  2YT7 A;  3GDV A;  3ZRT A;  5HFE A;  2PNT A;  2KOJ A;  1UEW A;  1P1D A;  5ILB A;  2YUY A;  3KZE A;  2W7R A;  1X5R A;  1L6O A;  3O5N A;  5EZ0 A;  1NF3 C;  2JIN A;  2FE5 A;  3GCN A;  1MFL A;  2G2L A;  2G5M B;  2IWO A;  4JOK A;  5I7Z A;  5HEY A;  2Q9V A;  3PV5 A;  3AXA A;  4P0C A;  3K1R A;  2REY A;  2YTW A;  1UJU A;  2EGN A;  3I4W A;  1B8Q A;  4NXQ A;  2R3Y A;  2QKU A;  2I0I A;  3R69 A;  2VRF A;  4R2Z A;  2EXG A;  2EDZ A;  4AMH A;  4WYU A;  2QBW A;  3CYY A;  5FB8 C;  4JOR A;  5HET A;  2E7K A;  3SUZ A;  2D8I A;  3NFK A;  2VPH A;  2H2B A;  2OQS A;  3HPM A;  3WKL A;  2DAZ A;  1WFG A;  2EEI A;  2I0L A;  1WI4 A;  1RY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...