2I0LA

X-ray crystal structure of sap97 pdz2 bound to the c-terminal peptide of hpv18 e6.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
b'EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Structures of a Human Papillomavirus (HPV) E6 Polypeptide Bound to MAGUK Proteins: Mechanisms of Targeting Tumor Suppressors by a High-Risk HPV Oncoprotein.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 16
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2i0lA00
5HJ1A 3TSVA 3NFKA 2EDVA 1B8QA 4N6XA 1FC6A 2W7RA 1VB7A 5E6PB 2OS6A 1Y8TA 1NTEA 3GSLA 2JILA 2KJKA 1WFGA 4FGMA 2DMZA 1WIFA 2JINA 4JOGA 2MHOA 4JOHA 4P0CA 1BFEA 2F0AA 2HGAA 2KPLA 2KJDA 4NXRA 4JORA 5G1DA 1IU2A 1GQ4A 2I0LA 5E1YA 1FC7A 1QAVA 4MPAA 1UF1A 2OZFA 1Y7NA 5E21A 1QAUA 2WL7A 2QKVA 2D92A 1XZ9A 1RGWA 2BYGA 2PNTA 5A2PA 3QE1A 2DC2A 2OCSA 5I7ZA 2RRMA 5HETA 2DM8A 4JOPA 1V1TA 4Q6SA 1RGRA 3NGHA 2EJYA 3GCNA 4NNLA 4UU5A 1LCYA 3PV4A 2EDZA 3RL7A 5HFFA 2IWOA 2M0ZA 1N6FA 3GDSA 2I0IA 2AWXA 1UHPA 3RL8A 2KJPA 5FHTA 4G69A 4L8NA 4E3BA 3CBXA 2H3LA 1U38A 4H11A 5HDYA 1X5QA 2R4HA 1D5GA 3SHWA 2PKUA 3R0HA 2I6VA 1WI4A 2YT7A 4YDPA 2E7KA 1OBZA 1OBYA 1WH1A 4HOPB 4OEOA 2F5YA 1V6BA 2EEGA 1ZOKA 2H2BA 1UM7A 4JL7A 3GJ9A 3WKLA 2L4SA 4HOPA 4NMTA 5HEYA 2Z17A 2VSPA 2ZPMA 2IWQA 3JXTA 4REYA 4IC6A 1N7FA 2KRGA 3CH8A 4OAJA 3QJMA 2PZDA 4NMRA 1Q3PA 2CSSA 2KYLA 3QGLA 1X45A 3AXAA 1VCWA 1G9OA 2HE2A 2AWUA 5HF1A 1Z86A 3I1EA 4K76A 1W9OA 2KPKA 3MH6A 2OGPA 1V5LA 4WYTA 4RI0A 2LA8A 4E34A 2KAWA 2I04A 1R6JA 1UEWA 5G1EA 2EHRA 1ZUBA 4NNMA 3GCOA 1IU0A 3GDVA 2DAZA 2UZCA 1SOTA 4LMMA 1UEZA 2HE4A 2Z9IA 1VJ6A 2KV8A 2DKRA 3DORA 2REYA 1WJLA 2OQSA 3KZDA 3CS0A 1W9EA 3TMHA 2JIKA 5B6LA 3PDZA 2P3WA 2G2LA 4Z8JA 1X5RA 5HFEA 4NXPA 3HVQC 3SFJA 3BPUA 3OTPA 2D8IA 5HFCA 2KOJA 1U39A 2RCZA 1MFGA 4O06A 1T2MA 2M10A 2PA1A 1P1DA 3ID3A 1I16A 2Q9VA 3SHUA 4E35A 1N7EA 1OBXA 5HFDA 3R69A 2JOAA 4EDJA 2W4FA 2X7ZA 1X8SA 1K32A 3O5NA 2VZ5A 5F3XA 4GHNA 1SOZA 5HEBA 1KEFA 3NFLA 3EGGC 2VPHA 2M3MA 1FC9A 5D13A 3PV5A 4NXQA 2DB5A 1OZIA 3QIKA 1Q3OA 2OSGA 2AWWA 2JREA 2V1WA 2VSVA 4Q2OA 4JOKA 4WYUA 2EGKA 3I4WA 4YYXA 1UJUA 2EXGA 1X5NA 1WF8A 1UEPA 1QLCA 1Z87A 2EEHA 2EV8A 3KZEA 3SOEA 3WKMA 2Q3GA 2JWEA 1UM1A 2QKUA 4OEPA 4GVDA 4Q6HA 2ZPLA 3FY5A 1M5ZA 2EEJA 3LNXA 1Q7XA 2D90A 5EYZA 3R68A 3PDVA 4JOEA 1RY4A 2R3YA 3GGEA 1N6DA 3TSZA 2KL1A 2VRFA 2M0UA 4KFVA 5DTHA 2I1NA 2KA9A 1VAEA 1V5QA 2M0TA 2H2CA 1RZXA 1GM1A 2PKTA 3PS4A 4Z33A 1IHJA 2M0VA 5GLJA 1UFXA 2QT5A 4K72A 3ID2A 2YUBA 2IWNA 1N6EA 5HFBA 2KBSA 1MFLA 3CBYA 2LOBA 5EZ0A 1N99A 1I92A 4JOFA 5H3JA 2KOMA 2YT8A 3DJAA 2YTWA 2PDZA 3ID4A 3VQFA 2K1ZA 2KQFA 2OMJA 2QBWA 3K82A 2FNEA 3RLEA 2H3MA 1P1EA 1TP5A 2G5MB 2FN5A 5FB8C 1TE0A 3B76A 1QAVB 2LC6A 2VWRA 3ZRTA 3I18A 5JXBA 4F8KA 2LUIA 3HPMA 4NMOA 4KFWA 2QKTA 5F67A 4K75A 2OPGA 3TSWA 2I4SA 3O46A 1V62A 1VA8A 1YBOA 1WG6A 2JXOA 3ID1A 1WF7A 3CYYA 4K78A 5HF4A 2EDPA 3SUZA 2AINA 1TQ3A 4Q2NA 1UJDA 5HEDA 1N7TA 3DJ3A 2GZVA 3HPKA 4JOJA 4Q3HA 2QG1A 2EAQA 2DLSA 2L97A 3QJNA 3OU0A 3E17A 4PQWA 3CC0A 2KG2A 1BE9A 1UJVA 5GNDA 3PV2A 3GDUA 3VQGA 4XHVA 1FCFA 1KY9A 2DLUA 4K6YA 1WHDA 1U3BA 1U37A 3DIWA 1UEQA 2FE5A 4NMPA 4NMSA 4UU6A 4R2ZA 3QO6A 2CS5A 1WFVA 4AMHA 3LNYA 2EGNA 2L4TA 1WI2A 3EGHC 3K1RA 5E11A 2K20A 1UITA 4Q2QA 2ENOA 3MH7A 1KWAA 4NMVA 3MH4A 1W9QA 3L4FD 3KHFA 2DJTA 1MC7A 1GQ5A 1PDRA 2FCFA 2YUYA 2KOHA 5E22A 1WHAA 2MX6A 2O2TA 1X6DA 2EEIA 2IWPA 3DJ1A 3QDOA 2V90A 3K50A 2LC7A 3CBZA 4NMQA 2EGOA 1NF3C 4Q2PA 1L6OA 3STJA 4GVCA 1TP3A 4P2AB 2CSJA
chains in the Genus database with same CATH superfamily
5HJ1A 3TSVA 3NFKA 2EDVA 1B8QA 4N6XA 1FC6A 2W7RA 5IL9A 1VB7A 5E6PB 2OS6A 1Y8TA 1NTEA 3GSLA 2JILA 2KJKA 1WFGA 4FGMA 4JJ3A 2DMZA 1WIFA 2JINA 4JOGA 2MHOA 4JOHA 4P0CA 1BFEA 2F0AA 2HGAA 2KPLA 2KJDA 4NXRA 4JORA 5G1DA 1IU2A 1GQ4A 2I0LA 5E1YA 1FC7A 1QAVA 4MPAA 1UF1A 2OZFA 1Y7NA 5E21A 1QAUA 2WL7A 2QKVA 2D92A 1XZ9A 1RGWA 2BYGA 2PNTA 5A2PA 3QE1A 2DC2A 2OCSA 5I7ZA 2RRMA 5HETA 2DM8A 4JOPA 1V1TA 4Q6SA 1RGRA 3NGHA 2EJYA 3GCNA 4NNLA 4UU5A 1LCYA 3PV4A 2EDZA 3RL7A 5HFFA 2IWOA 2M0ZA 1N6FA 3GDSA 2I0IA 2AWXA 1UHPA 3RL8A 2KJPA 5FHTA 4G69A 4L8NA 4E3BA 3CBXA 2H3LA 1U38A 4H11A 5HDYA 1X5QA 2R4HA 1D5GA 3SHWA 2PKUA 3R0HA 2I6VA 1WI4A 2YT7A 5ILBA 4YDPA 2E7KA 1OBZA 1OBYA 1WH1A 4HOPB 4OEOA 2F5YA 1V6BA 2EEGA 1ZOKA 2H2BA 1UM7A 4JL7A 3GJ9A 3WKLA 2L4SA 4HOPA 4NMTA 5HEYA 2Z17A 2VSPA 2ZPMA 2IWQA 3JXTA 4REYA 4IC6A 1N7FA 2KRGA 1X9ZA 3CH8A 4OAJA 3QJMA 2PZDA 4NMRA 1Q3PA 2CSSA 2KYLA 3QGLA 1X45A 3AXAA 1VCWA 3NCVA 1G9OA 2HE2A 2AWUA 5HF1A 1Z86A 3I1EA 4K76A 1W9OA 2KPKA 3MH6A 2OGPA 1V5LA 4WYTA 4RI0A 2LA8A 4E34A 2KAWA 2I04A 1R6JA 1UEWA 5G1EA 2EHRA 1ZUBA 4NNMA 3GCOA 1IU0A 3GDVA 2DAZA 2UZCA 1SOTA 4LMMA 1UEZA 2HE4A 2Z9IA 1VJ6A 2KV8A 2DKRA 3DORA 2REYA 1WJLA 2OQSA 3KZDA 3CS0A 1W9EA 3TMHA 2JIKA 5B6LA 3PDZA 2P3WA 2G2LA 4Z8JA 1X5RA 5HFEA 4NXPA 3HVQC 3SFJA 3BPUA 3OTPA 2D8IA 5HFCA 2KOJA 1U39A 2RCZA 1MFGA 4O06A 1T2MA 2M10A 2PA1A 1P1DA 3ID3A 1I16A 2Q9VA 3SHUA 4E35A 1N7EA 1OBXA 5HFDA 3R69A 2JOAA 4EDJA 2W4FA 2X7ZA 1X8SA 1K32A 3O5NA 2VZ5A 5F3XA 4GHNA 1SOZA 5HEBA 1KEFA 3NFLA 3EGGC 2VPHA 2M3MA 1FC9A 5D13A 3PV5A 4NXQA 2DB5A 1OZIA 3QIKA 1Q3OA 2OSGA 2AWWA 2JREA 4JJ0A 2V1WA 2VSVA 4Q2OA 4JOKA 4WYUA 2EGKA 3I4WA 4YYXA 1UJUA 2EXGA 1X5NA 1WF8A 1UEPA 1QLCA 1Z87A 2EEHA 2EV8A 3KZEA 3SOEA 3WKMA 2Q3GA 2JWEA 1UM1A 2QKUA 4OEPA 4GVDA 4Q6HA 2ZPLA 3FY5A 1M5ZA 2EEJA 3LNXA 1Q7XA 2D90A 5EYZA 3R68A 3PDVA 4JOEA 1RY4A 2R3YA 3GGEA 1N6DA 3TSZA 2KL1A 2VRFA 2M0UA 4KFVA 5DTHA 2I1NA 2KA9A 1VAEA 1V5QA 2M0TA 2H2CA 2JSNA 1RZXA 1GM1A 2PKTA 3PS4A 4Z33A 1IHJA 2M0VA 5GLJA 1UFXA 2QT5A 4K72A 3ID2A 2YUBA 2IWNA 1N6EA 5HFBA 2KBSA 1MFLA 3CBYA 2LOBA 5EZ0A 1N99A 1I92A 4JOFA 3KDGA 5H3JA 2KOMA 2YT8A 3DJAA 2YTWA 2PDZA 3ID4A 3VQFA 2K1ZA 2KQFA 2OMJA 2QBWA 3K82A 2FNEA 3RLEA 2H3MA 1P1EA 1TP5A 2G5MB 2FN5A 5FB8C 1TE0A 3B76A 1QAVB 2LC6A 2VWRA 3ZRTA 3I18A 5JXBA 4F8KA 2LUIA 3HPMA 4NMOA 4KFWA 2QKTA 5F67A 4K75A 2OPGA 3TSWA 2I4SA 3O46A 1V62A 1VA8A 1YBOA 1WG6A 2JXOA 3ID1A 1WF7A 3CYYA 4K78A 5HF4A 2EDPA 2GEFA 3SUZA 2AINA 1TQ3A 4Q2NA 1UJDA 5HEDA 1N7TA 3DJ3A 2GZVA 3HPKA 4JOJA 4Q3HA 2QG1A 2EAQA 2DLSA 2L97A 3QJNA 3OU0A 3E17A 4PQWA 3CC0A 2KG2A 1BE9A 1UJVA 5GNDA 3PV2A 3GDUA 3VQGA 4XHVA 1FCFA 1KY9A 2DLUA 4K6YA 1WHDA 1U3BA 1U37A 3DIWA 1UEQA 2FE5A 5B42A 4NMPA 4NMSA 4UU6A 4R2ZA 3QO6A 2CS5A 1WFVA 4AMHA 3LNYA 2EGNA 4FLNA 2L4TA 1WI2A 3EGHC 3K1RA 5E11A 2K20A 1UITA 3GABA 4Q2QA 2ENOA 3MH7A 1KWAA 4NMVA 3KDKA 3MH4A 1W9QA 3L4FD 3KHFA 2DJTA 1MC7A 1GQ5A 1PDRA 2FCFA 2YUYA 2KOHA 5E22A 1WHAA 2MX6A 2O2TA 1X6DA 2EEIA 2IWPA 3DJ1A 3QDOA 2V90A 3K50A 2LC7A 3CBZA 4NMQA 2EGOA 1NF3C 4Q2PA 1L6OA 3STJA 4GVCA 1TP3A 4P2AB 2CSJA
chains in the Genus database with same CATH topology
5HJ1A 3TSVA 3NFKA 2EDVA 1B8QA 4N6XA 1FC6A 2W7RA 5IL9A 1VB7A 5E6PB 2OS6A 1Y8TA 1NTEA 3GSLA 2JILA 2KJKA 1WFGA 4FGMA 4JJ3A 2DMZA 1WIFA 2JINA 4JOGA 2MHOA 4JOHA 4P0CA 1BFEA 2F0AA 2HGAA 2KPLA 2KJDA 4NXRA 4JORA 5G1DA 1IU2A 1GQ4A 2I0LA 5E1YA 1FC7A 1QAVA 4MPAA 1UF1A 2OZFA 1Y7NA 5E21A 1QAUA 2WL7A 2QKVA 2D92A 1XZ9A 1RGWA 2BYGA 2PNTA 5A2PA 3QE1A 2DC2A 2OCSA 5I7ZA 2RRMA 5HETA 2DM8A 4JOPA 1V1TA 4Q6SA 1RGRA 3NGHA 2EJYA 3GCNA 4NNLA 4UU5A 1LCYA 3PV4A 2EDZA 3RL7A 5HFFA 2IWOA 2M0ZA 1N6FA 3GDSA 2I0IA 2AWXA 1UHPA 3RL8A 2KJPA 5FHTA 4G69A 4L8NA 4E3BA 3CBXA 2H3LA 1U38A 4H11A 5HDYA 1X5QA 2R4HA 1D5GA 3SHWA 2PKUA 3R0HA 2I6VA 1WI4A 2YT7A 5ILBA 4YDPA 2E7KA 1OBZA 1OBYA 1WH1A 4HOPB 4OEOA 2F5YA 1V6BA 2EEGA 1ZOKA 2H2BA 1UM7A 4JL7A 3GJ9A 3WKLA 2L4SA 4HOPA 4NMTA 5HEYA 2Z17A 2VSPA 2ZPMA 2IWQA 3JXTA 4REYA 4IC6A 1N7FA 2KRGA 1X9ZA 3CH8A 4OAJA 3QJMA 2PZDA 4NMRA 1Q3PA 2CSSA 2KYLA 3QGLA 1X45A 3AXAA 1VCWA 3NCVA 1G9OA 2HE2A 2AWUA 5HF1A 1Z86A 3I1EA 4K76A 1W9OA 2KPKA 3MH6A 2OGPA 1V5LA 4WYTA 4RI0A 2LA8A 4E34A 2KAWA 2I04A 1R6JA 1UEWA 5G1EA 2EHRA 1ZUBA 4NNMA 3GCOA 1IU0A 3GDVA 2DAZA 2UZCA 1SOTA 4LMMA 1UEZA 2HE4A 2Z9IA 1VJ6A 2KV8A 2DKRA 3DORA 2REYA 1WJLA 2OQSA 3KZDA 3CS0A 1W9EA 3TMHA 2JIKA 5B6LA 3PDZA 2P3WA 2G2LA 4Z8JA 1X5RA 5HFEA 4NXPA 3HVQC 3SFJA 3BPUA 3OTPA 2D8IA 5HFCA 2KOJA 1U39A 2RCZA 1MFGA 4O06A 1T2MA 2M10A 2PA1A 1P1DA 3ID3A 1I16A 2Q9VA 3SHUA 4E35A 1N7EA 1OBXA 5HFDA 3R69A 2JOAA 4EDJA 2W4FA 2X7ZA 1X8SA 1K32A 3O5NA 2VZ5A 5F3XA 4GHNA 1SOZA 5HEBA 1KEFA 3NFLA 3EGGC 2VPHA 2M3MA 1FC9A 5D13A 3PV5A 4NXQA 2DB5A 1OZIA 3QIKA 1Q3OA 2OSGA 2AWWA 2JREA 4JJ0A 2V1WA 2VSVA 4Q2OA 4JOKA 4WYUA 2EGKA 3I4WA 4YYXA 1UJUA 2EXGA 1X5NA 1WF8A 1UEPA 1QLCA 1Z87A 2EEHA 2EV8A 3KZEA 3SOEA 3WKMA 2Q3GA 2JWEA 1UM1A 2QKUA 4OEPA 4GVDA 4Q6HA 2ZPLA 3FY5A 1M5ZA 2EEJA 3LNXA 1Q7XA 2D90A 5EYZA 3R68A 3PDVA 4JOEA 1RY4A 2R3YA 3GGEA 1N6DA 3TSZA 2KL1A 2VRFA 2M0UA 4KFVA 5DTHA 2I1NA 2KA9A 1VAEA 1V5QA 2M0TA 2H2CA 2JSNA 1RZXA 1GM1A 2PKTA 3PS4A 4Z33A 1IHJA 2M0VA 5GLJA 1UFXA 2QT5A 4K72A 3ID2A 2YUBA 2IWNA 1N6EA 5HFBA 2KBSA 1MFLA 3CBYA 2LOBA 5EZ0A 1N99A 1I92A 4JOFA 3KDGA 5H3JA 2KOMA 2YT8A 3DJAA 2YTWA 2PDZA 3ID4A 3VQFA 2K1ZA 2KQFA 2OMJA 2QBWA 3K82A 2FNEA 3RLEA 2H3MA 1P1EA 1TP5A 2G5MB 2FN5A 5FB8C 1TE0A 3B76A 1QAVB 2LC6A 2VWRA 3ZRTA 3I18A 5JXBA 4F8KA 2LUIA 3HPMA 4NMOA 4KFWA 2QKTA 5F67A 4K75A 2OPGA 3TSWA 2I4SA 3O46A 1V62A 1VA8A 1YBOA 1WG6A 2JXOA 3ID1A 1WF7A 3CYYA 4K78A 5HF4A 2EDPA 2GEFA 3SUZA 2AINA 1TQ3A 4Q2NA 1UJDA 5HEDA 1N7TA 3DJ3A 2GZVA 3HPKA 4JOJA 4Q3HA 2QG1A 2EAQA 2DLSA 2L97A 3QJNA 3OU0A 3E17A 4PQWA 3CC0A 2KG2A 1BE9A 1UJVA 5GNDA 3PV2A 3GDUA 3VQGA 4XHVA 1FCFA 1KY9A 2DLUA 4K6YA 1WHDA 1U3BA 1U37A 3DIWA 1UEQA 2FE5A 5B42A 4NMPA 4NMSA 4UU6A 4R2ZA 3QO6A 2CS5A 1WFVA 4AMHA 3LNYA 2EGNA 4FLNA 2L4TA 1WI2A 3EGHC 3K1RA 5E11A 2K20A 1UITA 3GABA 4Q2QA 2ENOA 3MH7A 1KWAA 4NMVA 3KDKA 3MH4A 1W9QA 3L4FD 3KHFA 2DJTA 1MC7A 1GQ5A 1PDRA 2FCFA 2YUYA 2KOHA 5E22A 1WHAA 2MX6A 2O2TA 1X6DA 2EEIA 2IWPA 3DJ1A 3QDOA 2V90A 3K50A 2LC7A 3CBZA 4NMQA 2EGOA 1NF3C 4Q2PA 1L6OA 3STJA 4GVCA 1TP3A 4P2AB 2CSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HJ1 A;  3TSV A;  3NFK A;  2EDV A;  1B8Q A;  4N6X A;  1FC6 A;  2W7R A;  1VB7 A;  5E6P B;  2OS6 A;  1Y8T A;  1NTE A;  3GSL A;  2JIL A;  2KJK A;  1WFG A;  4FGM A;  2DMZ A;  1WIF A;  2JIN A;  4JOG A;  2MHO A;  4JOH A;  4P0C A;  1BFE A;  2F0A A;  2HGA A;  2KPL A;  2KJD A;  4NXR A;  4JOR A;  5G1D A;  1IU2 A;  1GQ4 A;  2I0L A;  5E1Y A;  1FC7 A;  1QAV A;  4MPA A;  1UF1 A;  2OZF A;  1Y7N A;  5E21 A;  1QAU A;  2WL7 A;  2QKV A;  2D92 A;  1XZ9 A;  1RGW A;  2BYG A;  2PNT A;  5A2P A;  3QE1 A;  2DC2 A;  2OCS A;  5I7Z A;  2RRM A;  5HET A;  2DM8 A;  4JOP A;  1V1T A;  4Q6S A;  1RGR A;  3NGH A;  2EJY A;  3GCN A;  4NNL A;  4UU5 A;  1LCY A;  3PV4 A;  2EDZ A;  3RL7 A;  5HFF A;  2IWO A;  2M0Z A;  1N6F A;  3GDS A;  2I0I A;  2AWX A;  1UHP A;  3RL8 A;  2KJP A;  5FHT A;  4G69 A;  4L8N A;  4E3B A;  3CBX A;  2H3L A;  1U38 A;  4H11 A;  5HDY A;  1X5Q A;  2R4H A;  1D5G A;  3SHW A;  2PKU A;  3R0H A;  2I6V A;  1WI4 A;  2YT7 A;  4YDP A;  2E7K A;  1OBZ A;  1OBY A;  1WH1 A;  4HOP B;  4OEO A;  2F5Y A;  1V6B A;  2EEG A;  1ZOK A;  2H2B A;  1UM7 A;  4JL7 A;  3GJ9 A;  3WKL A;  2L4S A;  4HOP A;  4NMT A;  5HEY A;  2Z17 A;  2VSP A;  2ZPM A;  2IWQ A;  3JXT A;  4REY A;  4IC6 A;  1N7F A;  2KRG A;  3CH8 A;  4OAJ A;  3QJM A;  2PZD A;  4NMR A;  1Q3P A;  2CSS A;  2KYL A;  3QGL A;  1X45 A;  3AXA A;  1VCW A;  1G9O A;  2HE2 A;  2AWU A;  5HF1 A;  1Z86 A;  3I1E A;  4K76 A;  1W9O A;  2KPK A;  3MH6 A;  2OGP A;  1V5L A;  4WYT A;  4RI0 A;  2LA8 A;  4E34 A;  2KAW A;  2I04 A;  1R6J A;  1UEW A;  5G1E A;  2EHR A;  1ZUB A;  4NNM A;  3GCO A;  1IU0 A;  3GDV A;  2DAZ A;  2UZC A;  1SOT A;  4LMM A;  1UEZ A;  2HE4 A;  2Z9I A;  1VJ6 A;  2KV8 A;  2DKR A;  3DOR A;  2REY A;  1WJL A;  2OQS A;  3KZD A;  3CS0 A;  1W9E A;  3TMH A;  2JIK A;  5B6L A;  3PDZ A;  2P3W A;  2G2L A;  4Z8J A;  1X5R A;  5HFE A;  4NXP A;  3HVQ C;  3SFJ A;  3BPU A;  3OTP A;  2D8I A;  5HFC A;  2KOJ A;  1U39 A;  2RCZ A;  1MFG A;  4O06 A;  1T2M A;  2M10 A;  2PA1 A;  1P1D A;  3ID3 A;  1I16 A;  2Q9V A;  3SHU A;  4E35 A;  1N7E A;  1OBX A;  5HFD A;  3R69 A;  2JOA A;  4EDJ A;  2W4F A;  2X7Z A;  1X8S A;  1K32 A;  3O5N A;  2VZ5 A;  5F3X A;  4GHN A;  1SOZ A;  5HEB A;  1KEF A;  3NFL A;  3EGG C;  2VPH A;  2M3M A;  1FC9 A;  5D13 A;  3PV5 A;  4NXQ A;  2DB5 A;  1OZI A;  3QIK A;  1Q3O A;  2OSG A;  2AWW A;  2JRE A;  2V1W A;  2VSV A;  4Q2O A;  4JOK A;  4WYU A;  2EGK A;  3I4W A;  4YYX A;  1UJU A;  2EXG A;  1X5N A;  1WF8 A;  1UEP A;  1QLC A;  1Z87 A;  2EEH A;  2EV8 A;  3KZE A;  3SOE A;  3WKM A;  2Q3G A;  2JWE A;  1UM1 A;  2QKU A;  4OEP A;  4GVD A;  4Q6H A;  2ZPL A;  3FY5 A;  1M5Z A;  2EEJ A;  3LNX A;  1Q7X A;  2D90 A;  5EYZ A;  3R68 A;  3PDV A;  4JOE A;  1RY4 A;  2R3Y A;  3GGE A;  1N6D A;  3TSZ A;  2KL1 A;  2VRF A;  2M0U A;  4KFV A;  5DTH A;  2I1N A;  2KA9 A;  1VAE A;  1V5Q A;  2M0T A;  2H2C A;  1RZX A;  1GM1 A;  2PKT A;  3PS4 A;  4Z33 A;  1IHJ A;  2M0V A;  5GLJ A;  1UFX A;  2QT5 A;  4K72 A;  3ID2 A;  2YUB A;  2IWN A;  1N6E A;  5HFB A;  2KBS A;  1MFL A;  3CBY A;  2LOB A;  5EZ0 A;  1N99 A;  1I92 A;  4JOF A;  5H3J A;  2KOM A;  2YT8 A;  3DJA A;  2YTW A;  2PDZ A;  3ID4 A;  3VQF A;  2K1Z A;  2KQF A;  2OMJ A;  2QBW A;  3K82 A;  2FNE A;  3RLE A;  2H3M A;  1P1E A;  1TP5 A;  2G5M B;  2FN5 A;  5FB8 C;  1TE0 A;  3B76 A;  1QAV B;  2LC6 A;  2VWR A;  3ZRT A;  3I18 A;  5JXB A;  4F8K A;  2LUI A;  3HPM A;  4NMO A;  4KFW A;  2QKT A;  5F67 A;  4K75 A;  2OPG A;  3TSW A;  2I4S A;  3O46 A;  1V62 A;  1VA8 A;  1YBO A;  1WG6 A;  2JXO A;  3ID1 A;  1WF7 A;  3CYY A;  4K78 A;  5HF4 A;  2EDP A;  3SUZ A;  2AIN A;  1TQ3 A;  4Q2N A;  1UJD A;  5HED A;  1N7T A;  3DJ3 A;  2GZV A;  3HPK A;  4JOJ A;  4Q3H A;  2QG1 A;  2EAQ A;  2DLS A;  2L97 A;  3QJN A;  3OU0 A;  3E17 A;  4PQW A;  3CC0 A;  2KG2 A;  1BE9 A;  1UJV A;  5GND A;  3PV2 A;  3GDU A;  3VQG A;  4XHV A;  1FCF A;  1KY9 A;  2DLU A;  4K6Y A;  1WHD A;  1U3B A;  1U37 A;  3DIW A;  1UEQ A;  2FE5 A;  4NMP A;  4NMS A;  4UU6 A;  4R2Z A;  3QO6 A;  2CS5 A;  1WFV A;  4AMH A;  3LNY A;  2EGN A;  2L4T A;  1WI2 A;  3EGH C;  3K1R A;  5E11 A;  2K20 A;  1UIT A;  4Q2Q A;  2ENO A;  3MH7 A;  1KWA A;  4NMV A;  3MH4 A;  1W9Q A;  3L4F D;  3KHF A;  2DJT A;  1MC7 A;  1GQ5 A;  1PDR A;  2FCF A;  2YUY A;  2KOH A;  5E22 A;  1WHA A;  2MX6 A;  2O2T A;  1X6D A;  2EEI A;  2IWP A;  3DJ1 A;  3QDO A;  2V90 A;  3K50 A;  2LC7 A;  3CBZ A;  4NMQ A;  2EGO A;  1NF3 C;  4Q2P A;  1L6O A;  3STJ A;  4GVC A;  1TP3 A;  4P2A B;  2CSJ A; 
#chains in the Genus database with same CATH topology
 5HJ1 A;  3TSV A;  3NFK A;  2EDV A;  1B8Q A;  4N6X A;  1FC6 A;  2W7R A;  5IL9 A;  1VB7 A;  5E6P B;  2OS6 A;  1Y8T A;  1NTE A;  3GSL A;  2JIL A;  2KJK A;  1WFG A;  4FGM A;  4JJ3 A;  2DMZ A;  1WIF A;  2JIN A;  4JOG A;  2MHO A;  4JOH A;  4P0C A;  1BFE A;  2F0A A;  2HGA A;  2KPL A;  2KJD A;  4NXR A;  4JOR A;  5G1D A;  1IU2 A;  1GQ4 A;  2I0L A;  5E1Y A;  1FC7 A;  1QAV A;  4MPA A;  1UF1 A;  2OZF A;  1Y7N A;  5E21 A;  1QAU A;  2WL7 A;  2QKV A;  2D92 A;  1XZ9 A;  1RGW A;  2BYG A;  2PNT A;  5A2P A;  3QE1 A;  2DC2 A;  2OCS A;  5I7Z A;  2RRM A;  5HET A;  2DM8 A;  4JOP A;  1V1T A;  4Q6S A;  1RGR A;  3NGH A;  2EJY A;  3GCN A;  4NNL A;  4UU5 A;  1LCY A;  3PV4 A;  2EDZ A;  3RL7 A;  5HFF A;  2IWO A;  2M0Z A;  1N6F A;  3GDS A;  2I0I A;  2AWX A;  1UHP A;  3RL8 A;  2KJP A;  5FHT A;  4G69 A;  4L8N A;  4E3B A;  3CBX A;  2H3L A;  1U38 A;  4H11 A;  5HDY A;  1X5Q A;  2R4H A;  1D5G A;  3SHW A;  2PKU A;  3R0H A;  2I6V A;  1WI4 A;  2YT7 A;  5ILB A;  4YDP A;  2E7K A;  1OBZ A;  1OBY A;  1WH1 A;  4HOP B;  4OEO A;  2F5Y A;  1V6B A;  2EEG A;  1ZOK A;  2H2B A;  1UM7 A;  4JL7 A;  3GJ9 A;  3WKL A;  2L4S A;  4HOP A;  4NMT A;  5HEY A;  2Z17 A;  2VSP A;  2ZPM A;  2IWQ A;  3JXT A;  4REY A;  4IC6 A;  1N7F A;  2KRG A;  1X9Z A;  3CH8 A;  4OAJ A;  3QJM A;  2PZD A;  4NMR A;  1Q3P A;  2CSS A;  2KYL A;  3QGL A;  1X45 A;  3AXA A;  1VCW A;  3NCV A;  1G9O A;  2HE2 A;  2AWU A;  5HF1 A;  1Z86 A;  3I1E A;  4K76 A;  1W9O A;  2KPK A;  3MH6 A;  2OGP A;  1V5L A;  4WYT A;  4RI0 A;  2LA8 A;  4E34 A;  2KAW A;  2I04 A;  1R6J A;  1UEW A;  5G1E A;  2EHR A;  1ZUB A;  4NNM A;  3GCO A;  1IU0 A;  3GDV A;  2DAZ A;  2UZC A;  1SOT A;  4LMM A;  1UEZ A;  2HE4 A;  2Z9I A;  1VJ6 A;  2KV8 A;  2DKR A;  3DOR A;  2REY A;  1WJL A;  2OQS A;  3KZD A;  3CS0 A;  1W9E A;  3TMH A;  2JIK A;  5B6L A;  3PDZ A;  2P3W A;  2G2L A;  4Z8J A;  1X5R A;  5HFE A;  4NXP A;  3HVQ C;  3SFJ A;  3BPU A;  3OTP A;  2D8I A;  5HFC A;  2KOJ A;  1U39 A;  2RCZ A;  1MFG A;  4O06 A;  1T2M A;  2M10 A;  2PA1 A;  1P1D A;  3ID3 A;  1I16 A;  2Q9V A;  3SHU A;  4E35 A;  1N7E A;  1OBX A;  5HFD A;  3R69 A;  2JOA A;  4EDJ A;  2W4F A;  2X7Z A;  1X8S A;  1K32 A;  3O5N A;  2VZ5 A;  5F3X A;  4GHN A;  1SOZ A;  5HEB A;  1KEF A;  3NFL A;  3EGG C;  2VPH A;  2M3M A;  1FC9 A;  5D13 A;  3PV5 A;  4NXQ A;  2DB5 A;  1OZI A;  3QIK A;  1Q3O A;  2OSG A;  2AWW A;  2JRE A;  4JJ0 A;  2V1W A;  2VSV A;  4Q2O A;  4JOK A;  4WYU A;  2EGK A;  3I4W A;  4YYX A;  1UJU A;  2EXG A;  1X5N A;  1WF8 A;  1UEP A;  1QLC A;  1Z87 A;  2EEH A;  2EV8 A;  3KZE A;  3SOE A;  3WKM A;  2Q3G A;  2JWE A;  1UM1 A;  2QKU A;  4OEP A;  4GVD A;  4Q6H A;  2ZPL A;  3FY5 A;  1M5Z A;  2EEJ A;  3LNX A;  1Q7X A;  2D90 A;  5EYZ A;  3R68 A;  3PDV A;  4JOE A;  1RY4 A;  2R3Y A;  3GGE A;  1N6D A;  3TSZ A;  2KL1 A;  2VRF A;  2M0U A;  4KFV A;  5DTH A;  2I1N A;  2KA9 A;  1VAE A;  1V5Q A;  2M0T A;  2H2C A;  2JSN A;  1RZX A;  1GM1 A;  2PKT A;  3PS4 A;  4Z33 A;  1IHJ A;  2M0V A;  5GLJ A;  1UFX A;  2QT5 A;  4K72 A;  3ID2 A;  2YUB A;  2IWN A;  1N6E A;  5HFB A;  2KBS A;  1MFL A;  3CBY A;  2LOB A;  5EZ0 A;  1N99 A;  1I92 A;  4JOF A;  3KDG A;  5H3J A;  2KOM A;  2YT8 A;  3DJA A;  2YTW A;  2PDZ A;  3ID4 A;  3VQF A;  2K1Z A;  2KQF A;  2OMJ A;  2QBW A;  3K82 A;  2FNE A;  3RLE A;  2H3M A;  1P1E A;  1TP5 A;  2G5M B;  2FN5 A;  5FB8 C;  1TE0 A;  3B76 A;  1QAV B;  2LC6 A;  2VWR A;  3ZRT A;  3I18 A;  5JXB A;  4F8K A;  2LUI A;  3HPM A;  4NMO A;  4KFW A;  2QKT A;  5F67 A;  4K75 A;  2OPG A;  3TSW A;  2I4S A;  3O46 A;  1V62 A;  1VA8 A;  1YBO A;  1WG6 A;  2JXO A;  3ID1 A;  1WF7 A;  3CYY A;  4K78 A;  5HF4 A;  2EDP A;  2GEF A;  3SUZ A;  2AIN A;  1TQ3 A;  4Q2N A;  1UJD A;  5HED A;  1N7T A;  3DJ3 A;  2GZV A;  3HPK A;  4JOJ A;  4Q3H A;  2QG1 A;  2EAQ A;  2DLS A;  2L97 A;  3QJN A;  3OU0 A;  3E17 A;  4PQW A;  3CC0 A;  2KG2 A;  1BE9 A;  1UJV A;  5GND A;  3PV2 A;  3GDU A;  3VQG A;  4XHV A;  1FCF A;  1KY9 A;  2DLU A;  4K6Y A;  1WHD A;  1U3B A;  1U37 A;  3DIW A;  1UEQ A;  2FE5 A;  5B42 A;  4NMP A;  4NMS A;  4UU6 A;  4R2Z A;  3QO6 A;  2CS5 A;  1WFV A;  4AMH A;  3LNY A;  2EGN A;  4FLN A;  2L4T A;  1WI2 A;  3EGH C;  3K1R A;  5E11 A;  2K20 A;  1UIT A;  3GAB A;  4Q2Q A;  2ENO A;  3MH7 A;  1KWA A;  4NMV A;  3KDK A;  3MH4 A;  1W9Q A;  3L4F D;  3KHF A;  2DJT A;  1MC7 A;  1GQ5 A;  1PDR A;  2FCF A;  2YUY A;  2KOH A;  5E22 A;  1WHA A;  2MX6 A;  2O2T A;  1X6D A;  2EEI A;  2IWP A;  3DJ1 A;  3QDO A;  2V90 A;  3K50 A;  2LC7 A;  3CBZ A;  4NMQ A;  2EGO A;  1NF3 C;  4Q2P A;  1L6O A;  3STJ A;  4GVC A;  1TP3 A;  4P2A B;  2CSJ A; 
#chains in the Genus database with same CATH homology
 5HJ1 A;  3TSV A;  3NFK A;  2EDV A;  1B8Q A;  4N6X A;  1FC6 A;  2W7R A;  5IL9 A;  1VB7 A;  5E6P B;  2OS6 A;  1Y8T A;  1NTE A;  3GSL A;  2JIL A;  2KJK A;  1WFG A;  4FGM A;  4JJ3 A;  2DMZ A;  1WIF A;  2JIN A;  4JOG A;  2MHO A;  4JOH A;  4P0C A;  1BFE A;  2F0A A;  2HGA A;  2KPL A;  2KJD A;  4NXR A;  4JOR A;  5G1D A;  1IU2 A;  1GQ4 A;  2I0L A;  5E1Y A;  1FC7 A;  1QAV A;  4MPA A;  1UF1 A;  2OZF A;  1Y7N A;  5E21 A;  1QAU A;  2WL7 A;  2QKV A;  2D92 A;  1XZ9 A;  1RGW A;  2BYG A;  2PNT A;  5A2P A;  3QE1 A;  2DC2 A;  2OCS A;  5I7Z A;  2RRM A;  5HET A;  2DM8 A;  4JOP A;  1V1T A;  4Q6S A;  1RGR A;  3NGH A;  2EJY A;  3GCN A;  4NNL A;  4UU5 A;  1LCY A;  3PV4 A;  2EDZ A;  3RL7 A;  5HFF A;  2IWO A;  2M0Z A;  1N6F A;  3GDS A;  2I0I A;  2AWX A;  1UHP A;  3RL8 A;  2KJP A;  5FHT A;  4G69 A;  4L8N A;  4E3B A;  3CBX A;  2H3L A;  1U38 A;  4H11 A;  5HDY A;  1X5Q A;  2R4H A;  1D5G A;  3SHW A;  2PKU A;  3R0H A;  2I6V A;  1WI4 A;  2YT7 A;  5ILB A;  4YDP A;  2E7K A;  1OBZ A;  1OBY A;  1WH1 A;  4HOP B;  4OEO A;  2F5Y A;  1V6B A;  2EEG A;  1ZOK A;  2H2B A;  1UM7 A;  4JL7 A;  3GJ9 A;  3WKL A;  2L4S A;  4HOP A;  4NMT A;  5HEY A;  2Z17 A;  2VSP A;  2ZPM A;  2IWQ A;  3JXT A;  4REY A;  4IC6 A;  1N7F A;  2KRG A;  1X9Z A;  3CH8 A;  4OAJ A;  3QJM A;  2PZD A;  4NMR A;  1Q3P A;  2CSS A;  2KYL A;  3QGL A;  1X45 A;  3AXA A;  1VCW A;  3NCV A;  1G9O A;  2HE2 A;  2AWU A;  5HF1 A;  1Z86 A;  3I1E A;  4K76 A;  1W9O A;  2KPK A;  3MH6 A;  2OGP A;  1V5L A;  4WYT A;  4RI0 A;  2LA8 A;  4E34 A;  2KAW A;  2I04 A;  1R6J A;  1UEW A;  5G1E A;  2EHR A;  1ZUB A;  4NNM A;  3GCO A;  1IU0 A;  3GDV A;  2DAZ A;  2UZC A;  1SOT A;  4LMM A;  1UEZ A;  2HE4 A;  2Z9I A;  1VJ6 A;  2KV8 A;  2DKR A;  3DOR A;  2REY A;  1WJL A;  2OQS A;  3KZD A;  3CS0 A;  1W9E A;  3TMH A;  2JIK A;  5B6L A;  3PDZ A;  2P3W A;  2G2L A;  4Z8J A;  1X5R A;  5HFE A;  4NXP A;  3HVQ C;  3SFJ A;  3BPU A;  3OTP A;  2D8I A;  5HFC A;  2KOJ A;  1U39 A;  2RCZ A;  1MFG A;  4O06 A;  1T2M A;  2M10 A;  2PA1 A;  1P1D A;  3ID3 A;  1I16 A;  2Q9V A;  3SHU A;  4E35 A;  1N7E A;  1OBX A;  5HFD A;  3R69 A;  2JOA A;  4EDJ A;  2W4F A;  2X7Z A;  1X8S A;  1K32 A;  3O5N A;  2VZ5 A;  5F3X A;  4GHN A;  1SOZ A;  5HEB A;  1KEF A;  3NFL A;  3EGG C;  2VPH A;  2M3M A;  1FC9 A;  5D13 A;  3PV5 A;  4NXQ A;  2DB5 A;  1OZI A;  3QIK A;  1Q3O A;  2OSG A;  2AWW A;  2JRE A;  4JJ0 A;  2V1W A;  2VSV A;  4Q2O A;  4JOK A;  4WYU A;  2EGK A;  3I4W A;  4YYX A;  1UJU A;  2EXG A;  1X5N A;  1WF8 A;  1UEP A;  1QLC A;  1Z87 A;  2EEH A;  2EV8 A;  3KZE A;  3SOE A;  3WKM A;  2Q3G A;  2JWE A;  1UM1 A;  2QKU A;  4OEP A;  4GVD A;  4Q6H A;  2ZPL A;  3FY5 A;  1M5Z A;  2EEJ A;  3LNX A;  1Q7X A;  2D90 A;  5EYZ A;  3R68 A;  3PDV A;  4JOE A;  1RY4 A;  2R3Y A;  3GGE A;  1N6D A;  3TSZ A;  2KL1 A;  2VRF A;  2M0U A;  4KFV A;  5DTH A;  2I1N A;  2KA9 A;  1VAE A;  1V5Q A;  2M0T A;  2H2C A;  2JSN A;  1RZX A;  1GM1 A;  2PKT A;  3PS4 A;  4Z33 A;  1IHJ A;  2M0V A;  5GLJ A;  1UFX A;  2QT5 A;  4K72 A;  3ID2 A;  2YUB A;  2IWN A;  1N6E A;  5HFB A;  2KBS A;  1MFL A;  3CBY A;  2LOB A;  5EZ0 A;  1N99 A;  1I92 A;  4JOF A;  3KDG A;  5H3J A;  2KOM A;  2YT8 A;  3DJA A;  2YTW A;  2PDZ A;  3ID4 A;  3VQF A;  2K1Z A;  2KQF A;  2OMJ A;  2QBW A;  3K82 A;  2FNE A;  3RLE A;  2H3M A;  1P1E A;  1TP5 A;  2G5M B;  2FN5 A;  5FB8 C;  1TE0 A;  3B76 A;  1QAV B;  2LC6 A;  2VWR A;  3ZRT A;  3I18 A;  5JXB A;  4F8K A;  2LUI A;  3HPM A;  4NMO A;  4KFW A;  2QKT A;  5F67 A;  4K75 A;  2OPG A;  3TSW A;  2I4S A;  3O46 A;  1V62 A;  1VA8 A;  1YBO A;  1WG6 A;  2JXO A;  3ID1 A;  1WF7 A;  3CYY A;  4K78 A;  5HF4 A;  2EDP A;  2GEF A;  3SUZ A;  2AIN A;  1TQ3 A;  4Q2N A;  1UJD A;  5HED A;  1N7T A;  3DJ3 A;  2GZV A;  3HPK A;  4JOJ A;  4Q3H A;  2QG1 A;  2EAQ A;  2DLS A;  2L97 A;  3QJN A;  3OU0 A;  3E17 A;  4PQW A;  3CC0 A;  2KG2 A;  1BE9 A;  1UJV A;  5GND A;  3PV2 A;  3GDU A;  3VQG A;  4XHV A;  1FCF A;  1KY9 A;  2DLU A;  4K6Y A;  1WHD A;  1U3B A;  1U37 A;  3DIW A;  1UEQ A;  2FE5 A;  5B42 A;  4NMP A;  4NMS A;  4UU6 A;  4R2Z A;  3QO6 A;  2CS5 A;  1WFV A;  4AMH A;  3LNY A;  2EGN A;  4FLN A;  2L4T A;  1WI2 A;  3EGH C;  3K1R A;  5E11 A;  2K20 A;  1UIT A;  3GAB A;  4Q2Q A;  2ENO A;  3MH7 A;  1KWA A;  4NMV A;  3KDK A;  3MH4 A;  1W9Q A;  3L4F D;  3KHF A;  2DJT A;  1MC7 A;  1GQ5 A;  1PDR A;  2FCF A;  2YUY A;  2KOH A;  5E22 A;  1WHA A;  2MX6 A;  2O2T A;  1X6D A;  2EEI A;  2IWP A;  3DJ1 A;  3QDO A;  2V90 A;  3K50 A;  2LC7 A;  3CBZ A;  4NMQ A;  2EGO A;  1NF3 C;  4Q2P A;  1L6O A;  3STJ A;  4GVC A;  1TP3 A;  4P2A B;  2CSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...