2I0LA

X-ray crystal structure of sap97 pdz2 bound to the c-terminal peptide of hpv18 e6.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
83
structure length
83
Chain Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Structures of a Human Papillomavirus (HPV) E6 Polypeptide Bound to MAGUK Proteins: Mechanisms of Targeting Tumor Suppressors by a High-Risk HPV Oncoprotein.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 16
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2i0lA00
5D13A 3MH6A 1OZIA 2CS5A 3GDVA 2Q3GA 3LNYA 5HFCA 2L4TA 3EGGC 2M0ZA 2OZFA 2VSVA 1WIFA 3JXTA 1QLCA 1X8SA 2PKTA 2E7KA 5A2PA 2R4HA 3OTPA 1WI2A 1QAVB 1UEQA 2EHRA 2YUBA 2EJYA 1W9QA 5HEDA 1PDRA 2KRGA 1Y8TA 4P0CA 3GSLA 2EGNA 2EDVA 1N6FA 1V1TA 4JOKA 1WF7A 3O5NA 2W7RA 4NXPA 2I1NA 2EEHA 1VAEA 5HEBA 3DIWA 4O06A 1Q3OA 2LOBA 2AWXA 3RL7A 1B8QA 2I0IA 3GDSA 4REYA 5FB8C 2Q9VA 4Q2QA 2V1WA 1M5ZA 3CBYA 1RGRA 2AWUA 1GQ5A 2GZVA 4GVCA 3QJMA 4NNLA 5B6LA 2EXGA 2M10A 2D90A 2FNEA 4K75A 3CC0A 3K1RA 3GJ9A 1Z86A 2AWWA 4XHVA 5HEYA 2KJDA 1YBOA 2O2TA 4NMRA 2EEIA 4YDPA 4UU6A 5G1DA 5EZ0A 3GDUA 4MPAA 2IWOA 3KZDA 2BYGA 1U37A 1U38A 2EDZA 1VA8A 2M0VA 4NMQA 5E21A 2KAWA 2EV8A 2YT7A 1UHPA 4GVDA 2FE5A 4K78A 1GQ4A 4AMHA 3DJ3A 3K50A 4E35A 1FCFA 2DLSA 2YTWA 2D8IA 2EGOA 2DJTA 3MH7A 2QT5A 3QIKA 1Z87A 2G5MB 2P3WA 3GCOA 1UEWA 2JINA 1WI4A 3PDVA 2REYA 3TSVA 4G69A 1MC7A 2PDZA 4EDJA 1W9EA 2IWQA 5F3XA 2YUYA 1N6EA 4JORA 2I0LA 1P1DA 2M0TA 1FC7A 2PKUA 2KA9A 3O46A 1WH1A 3QO6A 2QKUA 2L97A 1X5QA 4F8KA 2EEJA 5G1EA 2LA8A 5HFDA 5H3JA 1XZ9A 3R68A 1N7TA 1LCYA 1VCWA 2DAZA 3NFLA 5JXBA 3QJNA 5I7ZA 2OCSA 2IWNA 2KQFA 2F5YA 3PV5A 3NFKA 2KPLA 4H11A 1UEPA 2MHOA 4JOJA 1RY4A 2DM8A 5F67A 3CBZA 3L4FD 3BPUA 2M0UA 5HETA 2IWPA 1ZUBA 2DLUA 3HPKA 2ENOA 4YYXA 5EYZA 1N6DA 5HJ1A 3SUZA 1V6BA 3GCNA 4JOHA 1NF3C 3OU0A 2KG2A 2M3MA 1VJ6A 2RRMA 2Z9IA 4IC6A 4R2ZA 3TMHA 2HE4A 2L4SA 1OBYA 2PA1A 2H2CA 2Z17A 2AINA 4Q3HA 2QKTA 4WYTA 2I4SA 1BFEA 1G9OA 2OQSA 3PS4A 2VZ5A 4Q6SA 3R69A 2OMJA 4E34A 1P1EA 3B76A 2RCZA 1U3BA 1ZOKA 1FC6A 1OBXA 5HFBA 1TP5A 3I1EA 2I04A 3DJ1A 3NGHA 4JOEA 1X5NA 3WKMA 2OSGA 3RL8A 4OAJA 4Z33A 4RI0A 1UFXA 1UM7A 2JIKA 1R6JA 5E11A 2DMZA 3VQFA 2F0AA 3TSZA 2VSPA 4E3BA 5E22A 1WJLA 4UU5A 2X7ZA 3AXAA 1Q7XA 4NXRA 1SOZA 1WHAA 1UJUA 2EGKA 3FY5A 3ID2A 3DJAA 4K72A 3EGHC 3VQGA 2MX6A 1V5QA 2EEGA 1VB7A 1K32A 4K6YA 2H3LA 2KOHA 4PQWA 2KV8A 2UZCA 1UJVA 2VRFA 2KBSA 1MFGA 3SHWA 1UJDA 2HE2A 1X45A 5HDYA 1L6OA 1X6DA 4NXQA 3WKLA 3R0HA 2KOJA 3DORA 3CS0A 3STJA 2LC7A 1V5LA 2KPKA 2EDPA 2KJKA 1N99A 5GNDA 1SOTA 3CBXA 1V62A 3ZRTA 2VWRA 4K76A 5HF1A 3I18A 5E6PB 3SFJA 4N6XA 1U39A 1FC9A 3QGLA 4Z8JA 2K20A 2W4FA 4LMMA 2JILA 2JXOA 1N7FA 2H2BA 4L8NA 2I6VA 2QKVA 3ID1A 1BE9A 3QDOA 2YT8A 3LNXA 4GHNA 2DKRA 4FGMA 1T2MA 2LUIA 1KEFA 4Q6HA 4JOGA 4Q2OA 4OEOA 4Q2NA 1WFVA 1TE0A 2OGPA 3HPMA 3K82A 2D92A 2KOMA 4KFVA 4P2AB 3HVQC 1NTEA 1TQ3A 3ID3A 5HF4A 1UF1A 1MFLA 3PV4A 2FCFA 3SOEA 5DTHA 3ID4A 4HOPA 2DB5A 2DC2A 2CSJA 1N7EA 4Q2PA 1I92A 2QBWA 2KL1A 1Q3PA 2LC6A 1WF8A 1UEZA 1W9OA 1KWAA 1RZXA 1QAUA 2FN5A 1I16A 1KY9A 2K1ZA 1IU0A 1UM1A 4JL7A 2KYLA 3KHFA 1D5GA 3I4WA 1RGWA 3QE1A 3GGEA 2WL7A 1OBZA 3KZEA 4NNMA 1GM1A 4NMTA 1TP3A 4KFWA 4NMPA 2KJPA 2H3MA 4NMVA 3MH4A 1WG6A 1QAVA 2CSSA 5HFEA 2HGAA 2OS6A 4OEPA 3TSWA 4NMSA 2G2LA 5E1YA 2JOAA 2V90A 2VPHA 2QG1A 3SHUA 1WFGA 1WHDA 2JWEA 5HFFA 2ZPMA 3CH8A 3PV2A 2ZPLA 1X5RA 4JOFA 4WYUA 5FHTA 3CYYA 1Y7NA 4JOPA 2OPGA 2PNTA 4NMOA 1IU2A 4HOPB 5GLJA 1IHJA 3PDZA 3RLEA 3E17A 2PZDA 2R3YA 2EAQA 2JREA 1UITA
chains in the Genus database with same CATH superfamily
5D13A 5B42A 3MH6A 1OZIA 2CS5A 3GDVA 2Q3GA 3LNYA 5HFCA 2L4TA 3EGGC 2M0ZA 2OZFA 2VSVA 1WIFA 3JXTA 1QLCA 1X8SA 2PKTA 2E7KA 5A2PA 2R4HA 3OTPA 1WI2A 1QAVB 1UEQA 2EHRA 2YUBA 2EJYA 1W9QA 5HEDA 1PDRA 2KRGA 1Y8TA 4P0CA 3GSLA 2EGNA 2EDVA 1N6FA 1V1TA 4JOKA 1WF7A 3O5NA 2W7RA 4NXPA 2I1NA 2EEHA 1VAEA 5HEBA 3DIWA 4O06A 1Q3OA 2LOBA 2AWXA 3RL7A 1B8QA 2I0IA 3GDSA 4REYA 5FB8C 2Q9VA 4Q2QA 2V1WA 1M5ZA 3CBYA 5IL9A 4JJ0A 1RGRA 2AWUA 1GQ5A 2GZVA 4GVCA 3QJMA 4NNLA 5B6LA 2EXGA 2M10A 2D90A 2FNEA 4K75A 3CC0A 3K1RA 3GJ9A 1Z86A 2AWWA 4XHVA 5HEYA 2KJDA 1YBOA 2O2TA 4NMRA 2EEIA 4YDPA 4UU6A 5G1DA 5EZ0A 3GDUA 4MPAA 2IWOA 3KZDA 2BYGA 1U37A 1U38A 2EDZA 1VA8A 2M0VA 4NMQA 5E21A 2KAWA 2EV8A 2YT7A 1UHPA 4GVDA 2FE5A 4K78A 1GQ4A 4AMHA 3DJ3A 3K50A 4E35A 1FCFA 2DLSA 2YTWA 2D8IA 2EGOA 2DJTA 3MH7A 2QT5A 3QIKA 1Z87A 2G5MB 2P3WA 3GCOA 3GABA 1UEWA 2JINA 1WI4A 3PDVA 2REYA 3TSVA 4G69A 1MC7A 2PDZA 4EDJA 1W9EA 2IWQA 5F3XA 2YUYA 1N6EA 4JORA 2I0LA 1P1DA 2M0TA 1FC7A 2PKUA 2KA9A 3O46A 1WH1A 3QO6A 2QKUA 2L97A 1X5QA 4F8KA 2EEJA 5G1EA 2LA8A 5HFDA 5H3JA 1XZ9A 3R68A 1N7TA 1LCYA 1VCWA 2DAZA 3NFLA 5JXBA 3QJNA 5I7ZA 2OCSA 2IWNA 2KQFA 2F5YA 3PV5A 3NFKA 2KPLA 4H11A 1UEPA 2MHOA 4JOJA 1RY4A 1X9ZA 2DM8A 5F67A 3CBZA 3L4FD 3BPUA 2M0UA 5HETA 2IWPA 1ZUBA 2DLUA 3HPKA 2ENOA 4YYXA 5EYZA 1N6DA 5HJ1A 3SUZA 1V6BA 3GCNA 4JOHA 1NF3C 3OU0A 2KG2A 2M3MA 1VJ6A 2RRMA 2Z9IA 4IC6A 4R2ZA 3TMHA 5ILBA 2HE4A 2L4SA 1OBYA 2PA1A 2H2CA 2Z17A 2AINA 4Q3HA 2QKTA 4WYTA 2I4SA 1BFEA 1G9OA 2OQSA 3PS4A 2VZ5A 4Q6SA 3R69A 2OMJA 4E34A 1P1EA 3B76A 2RCZA 1U3BA 1ZOKA 1FC6A 1OBXA 5HFBA 1TP5A 3I1EA 2I04A 3DJ1A 3NGHA 4JOEA 1X5NA 3WKMA 2OSGA 3RL8A 4OAJA 4Z33A 4RI0A 1UFXA 1UM7A 2JIKA 1R6JA 5E11A 2DMZA 3VQFA 2F0AA 3TSZA 2VSPA 4E3BA 5E22A 1WJLA 4UU5A 2X7ZA 3AXAA 1Q7XA 4NXRA 1SOZA 1WHAA 1UJUA 2EGKA 3FY5A 3ID2A 3DJAA 4K72A 3EGHC 3VQGA 2MX6A 1V5QA 2EEGA 1VB7A 1K32A 4K6YA 2H3LA 2KOHA 4PQWA 2KV8A 2UZCA 1UJVA 2VRFA 4JJ3A 2KBSA 1MFGA 3SHWA 1UJDA 2HE2A 1X45A 5HDYA 1L6OA 1X6DA 4NXQA 3WKLA 3R0HA 2KOJA 3DORA 3CS0A 3STJA 2LC7A 1V5LA 2KPKA 2EDPA 2KJKA 1N99A 5GNDA 1SOTA 3CBXA 1V62A 3ZRTA 2VWRA 4K76A 5HF1A 3I18A 5E6PB 3SFJA 4N6XA 1U39A 1FC9A 3QGLA 4Z8JA 2K20A 2W4FA 4LMMA 2JILA 2JXOA 1N7FA 2H2BA 4L8NA 2I6VA 2QKVA 3ID1A 1BE9A 3QDOA 2YT8A 3LNXA 4GHNA 2DKRA 4FGMA 1T2MA 2LUIA 1KEFA 4Q6HA 4JOGA 4Q2OA 4OEOA 4Q2NA 1WFVA 1TE0A 2OGPA 3HPMA 3K82A 2D92A 2KOMA 4KFVA 4P2AB 3HVQC 1NTEA 2JSNA 3KDKA 1TQ3A 3ID3A 5HF4A 1UF1A 1MFLA 3PV4A 2FCFA 3SOEA 5DTHA 3ID4A 4HOPA 2DB5A 2DC2A 2CSJA 1N7EA 4Q2PA 1I92A 2QBWA 2KL1A 1Q3PA 2LC6A 1WF8A 1UEZA 1W9OA 1KWAA 1RZXA 1QAUA 2FN5A 1I16A 1KY9A 2K1ZA 1IU0A 1UM1A 4JL7A 2KYLA 3KHFA 1D5GA 3I4WA 1RGWA 3QE1A 3GGEA 2WL7A 1OBZA 3KZEA 4NNMA 1GM1A 4NMTA 1TP3A 4KFWA 4NMPA 2KJPA 2H3MA 4NMVA 3MH4A 1WG6A 1QAVA 2CSSA 5HFEA 2HGAA 3KDGA 2OS6A 4OEPA 3TSWA 2GEFA 4NMSA 2G2LA 5E1YA 2JOAA 2V90A 2VPHA 2QG1A 3SHUA 1WFGA 1WHDA 2JWEA 5HFFA 2ZPMA 3CH8A 3PV2A 2ZPLA 1X5RA 4JOFA 4WYUA 3NCVA 3CYYA 1Y7NA 5FHTA 4JOPA 2OPGA 2PNTA 4NMOA 1IU2A 4HOPB 5GLJA 1IHJA 4FLNA 3PDZA 3RLEA 3E17A 2PZDA 2R3YA 2EAQA 2JREA 1UITA
chains in the Genus database with same CATH topology
5D13A 5B42A 3MH6A 1OZIA 2CS5A 3GDVA 2Q3GA 3LNYA 5HFCA 2L4TA 3EGGC 2M0ZA 2OZFA 2VSVA 1WIFA 3JXTA 1QLCA 1X8SA 2PKTA 2E7KA 5A2PA 2R4HA 3OTPA 1WI2A 1QAVB 1UEQA 2EHRA 2YUBA 2EJYA 1W9QA 5HEDA 1PDRA 2KRGA 1Y8TA 4P0CA 3GSLA 2EGNA 2EDVA 1N6FA 1V1TA 4JOKA 1WF7A 3O5NA 2W7RA 4NXPA 2I1NA 2EEHA 1VAEA 5HEBA 3DIWA 4O06A 1Q3OA 2LOBA 2AWXA 3RL7A 1B8QA 2I0IA 3GDSA 4REYA 5FB8C 2Q9VA 4Q2QA 2V1WA 1M5ZA 3CBYA 5IL9A 4JJ0A 1RGRA 2AWUA 1GQ5A 2GZVA 4GVCA 3QJMA 4NNLA 5B6LA 2EXGA 2M10A 2D90A 2FNEA 4K75A 3CC0A 3K1RA 3GJ9A 1Z86A 2AWWA 4XHVA 5HEYA 2KJDA 1YBOA 2O2TA 4NMRA 2EEIA 4YDPA 4UU6A 5G1DA 5EZ0A 3GDUA 4MPAA 2IWOA 3KZDA 2BYGA 1U37A 1U38A 2EDZA 1VA8A 2M0VA 4NMQA 5E21A 2KAWA 2EV8A 2YT7A 1UHPA 4GVDA 2FE5A 4K78A 1GQ4A 4AMHA 3DJ3A 3K50A 4E35A 1FCFA 2DLSA 2YTWA 2D8IA 2EGOA 2DJTA 3MH7A 2QT5A 3QIKA 1Z87A 2G5MB 2P3WA 3GCOA 3GABA 1UEWA 2JINA 1WI4A 3PDVA 2REYA 3TSVA 4G69A 1MC7A 2PDZA 4EDJA 1W9EA 2IWQA 5F3XA 2YUYA 1N6EA 4JORA 2I0LA 1P1DA 2M0TA 1FC7A 2PKUA 2KA9A 3O46A 1WH1A 3QO6A 2QKUA 2L97A 1X5QA 4F8KA 2EEJA 5G1EA 2LA8A 5HFDA 5H3JA 1XZ9A 3R68A 1N7TA 1LCYA 1VCWA 2DAZA 3NFLA 5JXBA 3QJNA 5I7ZA 2OCSA 2IWNA 2KQFA 2F5YA 3PV5A 3NFKA 2KPLA 4H11A 1UEPA 2MHOA 4JOJA 1RY4A 1X9ZA 2DM8A 5F67A 3CBZA 3L4FD 3BPUA 2M0UA 5HETA 2IWPA 1ZUBA 2DLUA 3HPKA 2ENOA 4YYXA 5EYZA 1N6DA 5HJ1A 3SUZA 1V6BA 3GCNA 4JOHA 1NF3C 3OU0A 2KG2A 2M3MA 1VJ6A 2RRMA 2Z9IA 4IC6A 4R2ZA 3TMHA 5ILBA 2HE4A 2L4SA 1OBYA 2PA1A 2H2CA 2Z17A 2AINA 4Q3HA 2QKTA 4WYTA 2I4SA 1BFEA 1G9OA 2OQSA 3PS4A 2VZ5A 4Q6SA 3R69A 2OMJA 4E34A 1P1EA 3B76A 2RCZA 1U3BA 1ZOKA 1FC6A 1OBXA 5HFBA 1TP5A 3I1EA 2I04A 3DJ1A 3NGHA 4JOEA 1X5NA 3WKMA 2OSGA 3RL8A 4OAJA 4Z33A 4RI0A 1UFXA 1UM7A 2JIKA 1R6JA 5E11A 2DMZA 3VQFA 2F0AA 3TSZA 2VSPA 4E3BA 5E22A 1WJLA 4UU5A 2X7ZA 3AXAA 1Q7XA 4NXRA 1SOZA 1WHAA 1UJUA 2EGKA 3FY5A 3ID2A 3DJAA 4K72A 3EGHC 3VQGA 2MX6A 1V5QA 2EEGA 1VB7A 1K32A 4K6YA 2H3LA 2KOHA 4PQWA 2KV8A 2UZCA 1UJVA 2VRFA 4JJ3A 2KBSA 1MFGA 3SHWA 1UJDA 2HE2A 1X45A 5HDYA 1L6OA 1X6DA 4NXQA 3WKLA 3R0HA 2KOJA 3DORA 3CS0A 3STJA 2LC7A 1V5LA 2KPKA 2EDPA 2KJKA 1N99A 5GNDA 1SOTA 3CBXA 1V62A 3ZRTA 2VWRA 4K76A 5HF1A 3I18A 5E6PB 3SFJA 4N6XA 1U39A 1FC9A 3QGLA 4Z8JA 2K20A 2W4FA 4LMMA 2JILA 2JXOA 1N7FA 2H2BA 4L8NA 2I6VA 2QKVA 3ID1A 1BE9A 3QDOA 2YT8A 3LNXA 4GHNA 2DKRA 4FGMA 1T2MA 2LUIA 1KEFA 4Q6HA 4JOGA 4Q2OA 4OEOA 4Q2NA 1WFVA 1TE0A 2OGPA 3HPMA 3K82A 2D92A 2KOMA 4KFVA 4P2AB 3HVQC 1NTEA 2JSNA 3KDKA 1TQ3A 3ID3A 5HF4A 1UF1A 1MFLA 3PV4A 2FCFA 3SOEA 5DTHA 3ID4A 4HOPA 2DB5A 2DC2A 2CSJA 1N7EA 4Q2PA 1I92A 2QBWA 2KL1A 1Q3PA 2LC6A 1WF8A 1UEZA 1W9OA 1KWAA 1RZXA 1QAUA 2FN5A 1I16A 1KY9A 2K1ZA 1IU0A 1UM1A 4JL7A 2KYLA 3KHFA 1D5GA 3I4WA 1RGWA 3QE1A 3GGEA 2WL7A 1OBZA 3KZEA 4NNMA 1GM1A 4NMTA 1TP3A 4KFWA 4NMPA 2KJPA 2H3MA 4NMVA 3MH4A 1WG6A 1QAVA 2CSSA 5HFEA 2HGAA 3KDGA 2OS6A 4OEPA 3TSWA 2GEFA 4NMSA 2G2LA 5E1YA 2JOAA 2V90A 2VPHA 2QG1A 3SHUA 1WFGA 1WHDA 2JWEA 5HFFA 2ZPMA 3CH8A 3PV2A 2ZPLA 1X5RA 4JOFA 4WYUA 3NCVA 3CYYA 1Y7NA 5FHTA 4JOPA 2OPGA 2PNTA 4NMOA 1IU2A 4HOPB 5GLJA 1IHJA 4FLNA 3PDZA 3RLEA 3E17A 2PZDA 2R3YA 2EAQA 2JREA 1UITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D13 A;  3MH6 A;  1OZI A;  2CS5 A;  3GDV A;  2Q3G A;  3LNY A;  5HFC A;  2L4T A;  3EGG C;  2M0Z A;  2OZF A;  2VSV A;  1WIF A;  3JXT A;  1QLC A;  1X8S A;  2PKT A;  2E7K A;  5A2P A;  2R4H A;  3OTP A;  1WI2 A;  1QAV B;  1UEQ A;  2EHR A;  2YUB A;  2EJY A;  1W9Q A;  5HED A;  1PDR A;  2KRG A;  1Y8T A;  4P0C A;  3GSL A;  2EGN A;  2EDV A;  1N6F A;  1V1T A;  4JOK A;  1WF7 A;  3O5N A;  2W7R A;  4NXP A;  2I1N A;  2EEH A;  1VAE A;  5HEB A;  3DIW A;  4O06 A;  1Q3O A;  2LOB A;  2AWX A;  3RL7 A;  1B8Q A;  2I0I A;  3GDS A;  4REY A;  5FB8 C;  2Q9V A;  4Q2Q A;  2V1W A;  1M5Z A;  3CBY A;  1RGR A;  2AWU A;  1GQ5 A;  2GZV A;  4GVC A;  3QJM A;  4NNL A;  5B6L A;  2EXG A;  2M10 A;  2D90 A;  2FNE A;  4K75 A;  3CC0 A;  3K1R A;  3GJ9 A;  1Z86 A;  2AWW A;  4XHV A;  5HEY A;  2KJD A;  1YBO A;  2O2T A;  4NMR A;  2EEI A;  4YDP A;  4UU6 A;  5G1D A;  5EZ0 A;  3GDU A;  4MPA A;  2IWO A;  3KZD A;  2BYG A;  1U37 A;  1U38 A;  2EDZ A;  1VA8 A;  2M0V A;  4NMQ A;  5E21 A;  2KAW A;  2EV8 A;  2YT7 A;  1UHP A;  4GVD A;  2FE5 A;  4K78 A;  1GQ4 A;  4AMH A;  3DJ3 A;  3K50 A;  4E35 A;  1FCF A;  2DLS A;  2YTW A;  2D8I A;  2EGO A;  2DJT A;  3MH7 A;  2QT5 A;  3QIK A;  1Z87 A;  2G5M B;  2P3W A;  3GCO A;  1UEW A;  2JIN A;  1WI4 A;  3PDV A;  2REY A;  3TSV A;  4G69 A;  1MC7 A;  2PDZ A;  4EDJ A;  1W9E A;  2IWQ A;  5F3X A;  2YUY A;  1N6E A;  4JOR A;  2I0L A;  1P1D A;  2M0T A;  1FC7 A;  2PKU A;  2KA9 A;  3O46 A;  1WH1 A;  3QO6 A;  2QKU A;  2L97 A;  1X5Q A;  4F8K A;  2EEJ A;  5G1E A;  2LA8 A;  5HFD A;  5H3J A;  1XZ9 A;  3R68 A;  1N7T A;  1LCY A;  1VCW A;  2DAZ A;  3NFL A;  5JXB A;  3QJN A;  5I7Z A;  2OCS A;  2IWN A;  2KQF A;  2F5Y A;  3PV5 A;  3NFK A;  2KPL A;  4H11 A;  1UEP A;  2MHO A;  4JOJ A;  1RY4 A;  2DM8 A;  5F67 A;  3CBZ A;  3L4F D;  3BPU A;  2M0U A;  5HET A;  2IWP A;  1ZUB A;  2DLU A;  3HPK A;  2ENO A;  4YYX A;  5EYZ A;  1N6D A;  5HJ1 A;  3SUZ A;  1V6B A;  3GCN A;  4JOH A;  1NF3 C;  3OU0 A;  2KG2 A;  2M3M A;  1VJ6 A;  2RRM A;  2Z9I A;  4IC6 A;  4R2Z A;  3TMH A;  2HE4 A;  2L4S A;  1OBY A;  2PA1 A;  2H2C A;  2Z17 A;  2AIN A;  4Q3H A;  2QKT A;  4WYT A;  2I4S A;  1BFE A;  1G9O A;  2OQS A;  3PS4 A;  2VZ5 A;  4Q6S A;  3R69 A;  2OMJ A;  4E34 A;  1P1E A;  3B76 A;  2RCZ A;  1U3B A;  1ZOK A;  1FC6 A;  1OBX A;  5HFB A;  1TP5 A;  3I1E A;  2I04 A;  3DJ1 A;  3NGH A;  4JOE A;  1X5N A;  3WKM A;  2OSG A;  3RL8 A;  4OAJ A;  4Z33 A;  4RI0 A;  1UFX A;  1UM7 A;  2JIK A;  1R6J A;  5E11 A;  2DMZ A;  3VQF A;  2F0A A;  3TSZ A;  2VSP A;  4E3B A;  5E22 A;  1WJL A;  4UU5 A;  2X7Z A;  3AXA A;  1Q7X A;  4NXR A;  1SOZ A;  1WHA A;  1UJU A;  2EGK A;  3FY5 A;  3ID2 A;  3DJA A;  4K72 A;  3EGH C;  3VQG A;  2MX6 A;  1V5Q A;  2EEG A;  1VB7 A;  1K32 A;  4K6Y A;  2H3L A;  2KOH A;  4PQW A;  2KV8 A;  2UZC A;  1UJV A;  2VRF A;  2KBS A;  1MFG A;  3SHW A;  1UJD A;  2HE2 A;  1X45 A;  5HDY A;  1L6O A;  1X6D A;  4NXQ A;  3WKL A;  3R0H A;  2KOJ A;  3DOR A;  3CS0 A;  3STJ A;  2LC7 A;  1V5L A;  2KPK A;  2EDP A;  2KJK A;  1N99 A;  5GND A;  1SOT A;  3CBX A;  1V62 A;  3ZRT A;  2VWR A;  4K76 A;  5HF1 A;  3I18 A;  5E6P B;  3SFJ A;  4N6X A;  1U39 A;  1FC9 A;  3QGL A;  4Z8J A;  2K20 A;  2W4F A;  4LMM A;  2JIL A;  2JXO A;  1N7F A;  2H2B A;  4L8N A;  2I6V A;  2QKV A;  3ID1 A;  1BE9 A;  3QDO A;  2YT8 A;  3LNX A;  4GHN A;  2DKR A;  4FGM A;  1T2M A;  2LUI A;  1KEF A;  4Q6H A;  4JOG A;  4Q2O A;  4OEO A;  4Q2N A;  1WFV A;  1TE0 A;  2OGP A;  3HPM A;  3K82 A;  2D92 A;  2KOM A;  4KFV A;  4P2A B;  3HVQ C;  1NTE A;  1TQ3 A;  3ID3 A;  5HF4 A;  1UF1 A;  1MFL A;  3PV4 A;  2FCF A;  3SOE A;  5DTH A;  3ID4 A;  4HOP A;  2DB5 A;  2DC2 A;  2CSJ A;  1N7E A;  4Q2P A;  1I92 A;  2QBW A;  2KL1 A;  1Q3P A;  2LC6 A;  1WF8 A;  1UEZ A;  1W9O A;  1KWA A;  1RZX A;  1QAU A;  2FN5 A;  1I16 A;  1KY9 A;  2K1Z A;  1IU0 A;  1UM1 A;  4JL7 A;  2KYL A;  3KHF A;  1D5G A;  3I4W A;  1RGW A;  3QE1 A;  3GGE A;  2WL7 A;  1OBZ A;  3KZE A;  4NNM A;  1GM1 A;  4NMT A;  1TP3 A;  4KFW A;  4NMP A;  2KJP A;  2H3M A;  4NMV A;  3MH4 A;  1WG6 A;  1QAV A;  2CSS A;  5HFE A;  2HGA A;  2OS6 A;  4OEP A;  3TSW A;  4NMS A;  2G2L A;  5E1Y A;  2JOA A;  2V90 A;  2VPH A;  2QG1 A;  3SHU A;  1WFG A;  1WHD A;  2JWE A;  5HFF A;  2ZPM A;  3CH8 A;  3PV2 A;  2ZPL A;  1X5R A;  4JOF A;  4WYU A;  5FHT A;  3CYY A;  1Y7N A;  4JOP A;  2OPG A;  2PNT A;  4NMO A;  1IU2 A;  4HOP B;  5GLJ A;  1IHJ A;  3PDZ A;  3RLE A;  3E17 A;  2PZD A;  2R3Y A;  2EAQ A;  2JRE A;  1UIT A; 
#chains in the Genus database with same CATH topology
 5D13 A;  5B42 A;  3MH6 A;  1OZI A;  2CS5 A;  3GDV A;  2Q3G A;  3LNY A;  5HFC A;  2L4T A;  3EGG C;  2M0Z A;  2OZF A;  2VSV A;  1WIF A;  3JXT A;  1QLC A;  1X8S A;  2PKT A;  2E7K A;  5A2P A;  2R4H A;  3OTP A;  1WI2 A;  1QAV B;  1UEQ A;  2EHR A;  2YUB A;  2EJY A;  1W9Q A;  5HED A;  1PDR A;  2KRG A;  1Y8T A;  4P0C A;  3GSL A;  2EGN A;  2EDV A;  1N6F A;  1V1T A;  4JOK A;  1WF7 A;  3O5N A;  2W7R A;  4NXP A;  2I1N A;  2EEH A;  1VAE A;  5HEB A;  3DIW A;  4O06 A;  1Q3O A;  2LOB A;  2AWX A;  3RL7 A;  1B8Q A;  2I0I A;  3GDS A;  4REY A;  5FB8 C;  2Q9V A;  4Q2Q A;  2V1W A;  1M5Z A;  3CBY A;  5IL9 A;  4JJ0 A;  1RGR A;  2AWU A;  1GQ5 A;  2GZV A;  4GVC A;  3QJM A;  4NNL A;  5B6L A;  2EXG A;  2M10 A;  2D90 A;  2FNE A;  4K75 A;  3CC0 A;  3K1R A;  3GJ9 A;  1Z86 A;  2AWW A;  4XHV A;  5HEY A;  2KJD A;  1YBO A;  2O2T A;  4NMR A;  2EEI A;  4YDP A;  4UU6 A;  5G1D A;  5EZ0 A;  3GDU A;  4MPA A;  2IWO A;  3KZD A;  2BYG A;  1U37 A;  1U38 A;  2EDZ A;  1VA8 A;  2M0V A;  4NMQ A;  5E21 A;  2KAW A;  2EV8 A;  2YT7 A;  1UHP A;  4GVD A;  2FE5 A;  4K78 A;  1GQ4 A;  4AMH A;  3DJ3 A;  3K50 A;  4E35 A;  1FCF A;  2DLS A;  2YTW A;  2D8I A;  2EGO A;  2DJT A;  3MH7 A;  2QT5 A;  3QIK A;  1Z87 A;  2G5M B;  2P3W A;  3GCO A;  3GAB A;  1UEW A;  2JIN A;  1WI4 A;  3PDV A;  2REY A;  3TSV A;  4G69 A;  1MC7 A;  2PDZ A;  4EDJ A;  1W9E A;  2IWQ A;  5F3X A;  2YUY A;  1N6E A;  4JOR A;  2I0L A;  1P1D A;  2M0T A;  1FC7 A;  2PKU A;  2KA9 A;  3O46 A;  1WH1 A;  3QO6 A;  2QKU A;  2L97 A;  1X5Q A;  4F8K A;  2EEJ A;  5G1E A;  2LA8 A;  5HFD A;  5H3J A;  1XZ9 A;  3R68 A;  1N7T A;  1LCY A;  1VCW A;  2DAZ A;  3NFL A;  5JXB A;  3QJN A;  5I7Z A;  2OCS A;  2IWN A;  2KQF A;  2F5Y A;  3PV5 A;  3NFK A;  2KPL A;  4H11 A;  1UEP A;  2MHO A;  4JOJ A;  1RY4 A;  1X9Z A;  2DM8 A;  5F67 A;  3CBZ A;  3L4F D;  3BPU A;  2M0U A;  5HET A;  2IWP A;  1ZUB A;  2DLU A;  3HPK A;  2ENO A;  4YYX A;  5EYZ A;  1N6D A;  5HJ1 A;  3SUZ A;  1V6B A;  3GCN A;  4JOH A;  1NF3 C;  3OU0 A;  2KG2 A;  2M3M A;  1VJ6 A;  2RRM A;  2Z9I A;  4IC6 A;  4R2Z A;  3TMH A;  5ILB A;  2HE4 A;  2L4S A;  1OBY A;  2PA1 A;  2H2C A;  2Z17 A;  2AIN A;  4Q3H A;  2QKT A;  4WYT A;  2I4S A;  1BFE A;  1G9O A;  2OQS A;  3PS4 A;  2VZ5 A;  4Q6S A;  3R69 A;  2OMJ A;  4E34 A;  1P1E A;  3B76 A;  2RCZ A;  1U3B A;  1ZOK A;  1FC6 A;  1OBX A;  5HFB A;  1TP5 A;  3I1E A;  2I04 A;  3DJ1 A;  3NGH A;  4JOE A;  1X5N A;  3WKM A;  2OSG A;  3RL8 A;  4OAJ A;  4Z33 A;  4RI0 A;  1UFX A;  1UM7 A;  2JIK A;  1R6J A;  5E11 A;  2DMZ A;  3VQF A;  2F0A A;  3TSZ A;  2VSP A;  4E3B A;  5E22 A;  1WJL A;  4UU5 A;  2X7Z A;  3AXA A;  1Q7X A;  4NXR A;  1SOZ A;  1WHA A;  1UJU A;  2EGK A;  3FY5 A;  3ID2 A;  3DJA A;  4K72 A;  3EGH C;  3VQG A;  2MX6 A;  1V5Q A;  2EEG A;  1VB7 A;  1K32 A;  4K6Y A;  2H3L A;  2KOH A;  4PQW A;  2KV8 A;  2UZC A;  1UJV A;  2VRF A;  4JJ3 A;  2KBS A;  1MFG A;  3SHW A;  1UJD A;  2HE2 A;  1X45 A;  5HDY A;  1L6O A;  1X6D A;  4NXQ A;  3WKL A;  3R0H A;  2KOJ A;  3DOR A;  3CS0 A;  3STJ A;  2LC7 A;  1V5L A;  2KPK A;  2EDP A;  2KJK A;  1N99 A;  5GND A;  1SOT A;  3CBX A;  1V62 A;  3ZRT A;  2VWR A;  4K76 A;  5HF1 A;  3I18 A;  5E6P B;  3SFJ A;  4N6X A;  1U39 A;  1FC9 A;  3QGL A;  4Z8J A;  2K20 A;  2W4F A;  4LMM A;  2JIL A;  2JXO A;  1N7F A;  2H2B A;  4L8N A;  2I6V A;  2QKV A;  3ID1 A;  1BE9 A;  3QDO A;  2YT8 A;  3LNX A;  4GHN A;  2DKR A;  4FGM A;  1T2M A;  2LUI A;  1KEF A;  4Q6H A;  4JOG A;  4Q2O A;  4OEO A;  4Q2N A;  1WFV A;  1TE0 A;  2OGP A;  3HPM A;  3K82 A;  2D92 A;  2KOM A;  4KFV A;  4P2A B;  3HVQ C;  1NTE A;  2JSN A;  3KDK A;  1TQ3 A;  3ID3 A;  5HF4 A;  1UF1 A;  1MFL A;  3PV4 A;  2FCF A;  3SOE A;  5DTH A;  3ID4 A;  4HOP A;  2DB5 A;  2DC2 A;  2CSJ A;  1N7E A;  4Q2P A;  1I92 A;  2QBW A;  2KL1 A;  1Q3P A;  2LC6 A;  1WF8 A;  1UEZ A;  1W9O A;  1KWA A;  1RZX A;  1QAU A;  2FN5 A;  1I16 A;  1KY9 A;  2K1Z A;  1IU0 A;  1UM1 A;  4JL7 A;  2KYL A;  3KHF A;  1D5G A;  3I4W A;  1RGW A;  3QE1 A;  3GGE A;  2WL7 A;  1OBZ A;  3KZE A;  4NNM A;  1GM1 A;  4NMT A;  1TP3 A;  4KFW A;  4NMP A;  2KJP A;  2H3M A;  4NMV A;  3MH4 A;  1WG6 A;  1QAV A;  2CSS A;  5HFE A;  2HGA A;  3KDG A;  2OS6 A;  4OEP A;  3TSW A;  2GEF A;  4NMS A;  2G2L A;  5E1Y A;  2JOA A;  2V90 A;  2VPH A;  2QG1 A;  3SHU A;  1WFG A;  1WHD A;  2JWE A;  5HFF A;  2ZPM A;  3CH8 A;  3PV2 A;  2ZPL A;  1X5R A;  4JOF A;  4WYU A;  3NCV A;  3CYY A;  1Y7N A;  5FHT A;  4JOP A;  2OPG A;  2PNT A;  4NMO A;  1IU2 A;  4HOP B;  5GLJ A;  1IHJ A;  4FLN A;  3PDZ A;  3RLE A;  3E17 A;  2PZD A;  2R3Y A;  2EAQ A;  2JRE A;  1UIT A; 
#chains in the Genus database with same CATH homology
 5D13 A;  5B42 A;  3MH6 A;  1OZI A;  2CS5 A;  3GDV A;  2Q3G A;  3LNY A;  5HFC A;  2L4T A;  3EGG C;  2M0Z A;  2OZF A;  2VSV A;  1WIF A;  3JXT A;  1QLC A;  1X8S A;  2PKT A;  2E7K A;  5A2P A;  2R4H A;  3OTP A;  1WI2 A;  1QAV B;  1UEQ A;  2EHR A;  2YUB A;  2EJY A;  1W9Q A;  5HED A;  1PDR A;  2KRG A;  1Y8T A;  4P0C A;  3GSL A;  2EGN A;  2EDV A;  1N6F A;  1V1T A;  4JOK A;  1WF7 A;  3O5N A;  2W7R A;  4NXP A;  2I1N A;  2EEH A;  1VAE A;  5HEB A;  3DIW A;  4O06 A;  1Q3O A;  2LOB A;  2AWX A;  3RL7 A;  1B8Q A;  2I0I A;  3GDS A;  4REY A;  5FB8 C;  2Q9V A;  4Q2Q A;  2V1W A;  1M5Z A;  3CBY A;  5IL9 A;  4JJ0 A;  1RGR A;  2AWU A;  1GQ5 A;  2GZV A;  4GVC A;  3QJM A;  4NNL A;  5B6L A;  2EXG A;  2M10 A;  2D90 A;  2FNE A;  4K75 A;  3CC0 A;  3K1R A;  3GJ9 A;  1Z86 A;  2AWW A;  4XHV A;  5HEY A;  2KJD A;  1YBO A;  2O2T A;  4NMR A;  2EEI A;  4YDP A;  4UU6 A;  5G1D A;  5EZ0 A;  3GDU A;  4MPA A;  2IWO A;  3KZD A;  2BYG A;  1U37 A;  1U38 A;  2EDZ A;  1VA8 A;  2M0V A;  4NMQ A;  5E21 A;  2KAW A;  2EV8 A;  2YT7 A;  1UHP A;  4GVD A;  2FE5 A;  4K78 A;  1GQ4 A;  4AMH A;  3DJ3 A;  3K50 A;  4E35 A;  1FCF A;  2DLS A;  2YTW A;  2D8I A;  2EGO A;  2DJT A;  3MH7 A;  2QT5 A;  3QIK A;  1Z87 A;  2G5M B;  2P3W A;  3GCO A;  3GAB A;  1UEW A;  2JIN A;  1WI4 A;  3PDV A;  2REY A;  3TSV A;  4G69 A;  1MC7 A;  2PDZ A;  4EDJ A;  1W9E A;  2IWQ A;  5F3X A;  2YUY A;  1N6E A;  4JOR A;  2I0L A;  1P1D A;  2M0T A;  1FC7 A;  2PKU A;  2KA9 A;  3O46 A;  1WH1 A;  3QO6 A;  2QKU A;  2L97 A;  1X5Q A;  4F8K A;  2EEJ A;  5G1E A;  2LA8 A;  5HFD A;  5H3J A;  1XZ9 A;  3R68 A;  1N7T A;  1LCY A;  1VCW A;  2DAZ A;  3NFL A;  5JXB A;  3QJN A;  5I7Z A;  2OCS A;  2IWN A;  2KQF A;  2F5Y A;  3PV5 A;  3NFK A;  2KPL A;  4H11 A;  1UEP A;  2MHO A;  4JOJ A;  1RY4 A;  1X9Z A;  2DM8 A;  5F67 A;  3CBZ A;  3L4F D;  3BPU A;  2M0U A;  5HET A;  2IWP A;  1ZUB A;  2DLU A;  3HPK A;  2ENO A;  4YYX A;  5EYZ A;  1N6D A;  5HJ1 A;  3SUZ A;  1V6B A;  3GCN A;  4JOH A;  1NF3 C;  3OU0 A;  2KG2 A;  2M3M A;  1VJ6 A;  2RRM A;  2Z9I A;  4IC6 A;  4R2Z A;  3TMH A;  5ILB A;  2HE4 A;  2L4S A;  1OBY A;  2PA1 A;  2H2C A;  2Z17 A;  2AIN A;  4Q3H A;  2QKT A;  4WYT A;  2I4S A;  1BFE A;  1G9O A;  2OQS A;  3PS4 A;  2VZ5 A;  4Q6S A;  3R69 A;  2OMJ A;  4E34 A;  1P1E A;  3B76 A;  2RCZ A;  1U3B A;  1ZOK A;  1FC6 A;  1OBX A;  5HFB A;  1TP5 A;  3I1E A;  2I04 A;  3DJ1 A;  3NGH A;  4JOE A;  1X5N A;  3WKM A;  2OSG A;  3RL8 A;  4OAJ A;  4Z33 A;  4RI0 A;  1UFX A;  1UM7 A;  2JIK A;  1R6J A;  5E11 A;  2DMZ A;  3VQF A;  2F0A A;  3TSZ A;  2VSP A;  4E3B A;  5E22 A;  1WJL A;  4UU5 A;  2X7Z A;  3AXA A;  1Q7X A;  4NXR A;  1SOZ A;  1WHA A;  1UJU A;  2EGK A;  3FY5 A;  3ID2 A;  3DJA A;  4K72 A;  3EGH C;  3VQG A;  2MX6 A;  1V5Q A;  2EEG A;  1VB7 A;  1K32 A;  4K6Y A;  2H3L A;  2KOH A;  4PQW A;  2KV8 A;  2UZC A;  1UJV A;  2VRF A;  4JJ3 A;  2KBS A;  1MFG A;  3SHW A;  1UJD A;  2HE2 A;  1X45 A;  5HDY A;  1L6O A;  1X6D A;  4NXQ A;  3WKL A;  3R0H A;  2KOJ A;  3DOR A;  3CS0 A;  3STJ A;  2LC7 A;  1V5L A;  2KPK A;  2EDP A;  2KJK A;  1N99 A;  5GND A;  1SOT A;  3CBX A;  1V62 A;  3ZRT A;  2VWR A;  4K76 A;  5HF1 A;  3I18 A;  5E6P B;  3SFJ A;  4N6X A;  1U39 A;  1FC9 A;  3QGL A;  4Z8J A;  2K20 A;  2W4F A;  4LMM A;  2JIL A;  2JXO A;  1N7F A;  2H2B A;  4L8N A;  2I6V A;  2QKV A;  3ID1 A;  1BE9 A;  3QDO A;  2YT8 A;  3LNX A;  4GHN A;  2DKR A;  4FGM A;  1T2M A;  2LUI A;  1KEF A;  4Q6H A;  4JOG A;  4Q2O A;  4OEO A;  4Q2N A;  1WFV A;  1TE0 A;  2OGP A;  3HPM A;  3K82 A;  2D92 A;  2KOM A;  4KFV A;  4P2A B;  3HVQ C;  1NTE A;  2JSN A;  3KDK A;  1TQ3 A;  3ID3 A;  5HF4 A;  1UF1 A;  1MFL A;  3PV4 A;  2FCF A;  3SOE A;  5DTH A;  3ID4 A;  4HOP A;  2DB5 A;  2DC2 A;  2CSJ A;  1N7E A;  4Q2P A;  1I92 A;  2QBW A;  2KL1 A;  1Q3P A;  2LC6 A;  1WF8 A;  1UEZ A;  1W9O A;  1KWA A;  1RZX A;  1QAU A;  2FN5 A;  1I16 A;  1KY9 A;  2K1Z A;  1IU0 A;  1UM1 A;  4JL7 A;  2KYL A;  3KHF A;  1D5G A;  3I4W A;  1RGW A;  3QE1 A;  3GGE A;  2WL7 A;  1OBZ A;  3KZE A;  4NNM A;  1GM1 A;  4NMT A;  1TP3 A;  4KFW A;  4NMP A;  2KJP A;  2H3M A;  4NMV A;  3MH4 A;  1WG6 A;  1QAV A;  2CSS A;  5HFE A;  2HGA A;  3KDG A;  2OS6 A;  4OEP A;  3TSW A;  2GEF A;  4NMS A;  2G2L A;  5E1Y A;  2JOA A;  2V90 A;  2VPH A;  2QG1 A;  3SHU A;  1WFG A;  1WHD A;  2JWE A;  5HFF A;  2ZPM A;  3CH8 A;  3PV2 A;  2ZPL A;  1X5R A;  4JOF A;  4WYU A;  3NCV A;  3CYY A;  1Y7N A;  5FHT A;  4JOP A;  2OPG A;  2PNT A;  4NMO A;  1IU2 A;  4HOP B;  5GLJ A;  1IHJ A;  4FLN A;  3PDZ A;  3RLE A;  3E17 A;  2PZD A;  2R3Y A;  2EAQ A;  2JRE A;  1UIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...