3CBZA

The dvl2 pdz domain in complex with the n2 inhibitory peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
104
Chain Sequence
MNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKSGGSGNEVWIDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dishevelled-2
publication title Inhibition of Wnt signaling by Dishevelled PDZ peptides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 24
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3cbzA00
2G2LA 2LA8A 3QGLA 2EAQA 1UITA 2PKTA 4NMPA 5GLJA 2KG2A 4LMMA 1Q7XA 3QJNA 3R69A 5D13A 1OBXA 1WG6A 2LOBA 2REYA 4L8NA 1BE9A 1OZIA 1GQ4A 1P1EA 2KJKA 4Q6SA 2HE4A 2QG1A 2HE2A 2I0LA 2KPKA 4E35A 1KEFA 3CBYA 3PDZA 1XZ9A 1FCFA 4RI0A 2KRGA 2K20A 3QIKA 4JOPA 4XHVA 1QAUA 2GZVA 1X6DA 2M10A 1NTEA 1UHPA 3I1EA 5G1DA 2Q9VA 4Z33A 2UZCA 3ID4A 4NXQA 3BPUA 2M0UA 3GJ9A 4WYUA 2KPLA 2DLUA 1Z87A 5HFBA 2FCFA 2KAWA 2IWPA 1N7FA 1WHAA 2DJTA 2KV8A 5HFEA 1QLCA 4K72A 3SHUA 1RY4A 3ZRTA 2ZPMA 1KY9A 1N99A 2L4SA 1PDRA 4E34A 1U3BA 3WKMA 3R0HA 4K6YA 3SHWA 2X7ZA 3I4WA 3TSZA 5H3JA 2QT5A 1UJVA 4GVDA 2BYGA 3MH7A 4MPAA 5G1EA 2I04A 4H11A 2M0TA 2OPGA 4OEOA 2ENOA 2OS6A 1V62A 4Q3HA 3QJMA 3L4FD 1WI2A 4OEPA 2YT8A 3MH6A 2F5YA 1W9OA 3MH4A 4JOHA 3K82A 2IWNA 3CS0A 2LUIA 2KJPA 4R2ZA 2Q3GA 4NXRA 1I92A 4PQWA 1VAEA 1WH1A 4WYTA 1B8QA 2EGOA 2CSSA 5HETA 3O46A 2M0VA 1V5QA 2MHOA 1OBZA 2PA1A 5B6LA 2OCSA 3VQFA 1Y8TA 1X5RA 1ZOKA 2KOHA 3VQGA 1UM1A 4JOGA 2KYLA 2OSGA 4NMTA 5HF1A 3NGHA 2H3LA 2VZ5A 2VRFA 1X45A 5E21A 1ZUBA 2I0IA 4JOJA 2EXGA 1R6JA 5E6PB 1IHJA 5E22A 2QKTA 3HVQC 3QO6A 2H2BA 4JOKA 1D5GA 3SFJA 3K50A 1IU2A 1OBYA 5E1YA 3DJ3A 4F8KA 2JIKA 2H3MA 3TMHA 1VA8A 4Q6HA 1T2MA 2DB5A 3PS4A 2KQFA 1UFXA 2YUBA 2OMJA 2VSPA 4HOPA 1FC7A 2VPHA 5F67A 1N6DA 1WFVA 1WFGA 4YDPA 2G5MB 1QAVA 1WJLA 2PKUA 2V1WA 4HOPB 2JWEA 2RRMA 3KZEA 1QAVB 2EDPA 2FNEA 1P1DA 4N6XA 2KBSA 3TSWA 1UF1A 1W9EA 3ID3A 2QBWA 3DJ1A 5HFDA 4G69A 1FC9A 3B76A 4KFVA 3PDVA 2I1NA 1M5ZA 2JXOA 2PDZA 4NNLA 1U37A 3EGHC 2FE5A 4REYA 1X5QA 3I18A 2P3WA 2D92A 3WKLA 2DKRA 3ID2A 1UEPA 5FHTA 1Y7NA 4Q2OA 2VWRA 1RGRA 1L6OA 4GHNA 2KA9A 3CBXA 1FC6A 2EEJA 2KL1A 1UEWA 1UM7A 4Z8JA 1GQ5A 1N7EA 3GDVA 5HEDA 3GCNA 2JILA 4K75A 3NFKA 1V5LA 2CSJA 2JOAA 4Q2QA 1X5NA 2O2TA 1WIFA 4Q2PA 3DJAA 1WF7A 1SOZA 1WF8A 2D8IA 2EDVA 5GNDA 1KWAA 4NMQA 2EV8A 2FN5A 2DAZA 2KJDA 3PV4A 4E3BA 2MX6A 2AINA 2EEIA 2YUYA 1U39A 2EHRA 2OZFA 1SOTA 2OQSA 4P0CA 1VJ6A 1X8SA 3OU0A 3E17A 5HEYA 3LNXA 1Q3PA 2EGKA 5HFFA 1MFGA 2I6VA 3CC0A 4UU6A 5DTHA 1TE0A 1TQ3A 2H2CA 5EYZA 4K78A 4O06A 1Q3OA 1UEZA 1N6FA 4NMRA 3SUZA 4KFWA 2IWOA 3CBZA 2VSVA 4JOEA 3TSVA 1YBOA 3NFLA 1G9OA 3QDOA 2Z9IA 3O5NA 1V6BA 2Z17A 4NMSA 4OAJA 2YT7A 3RLEA 1N7TA 2M3MA 2R3YA 4EDJA 1Z86A 1TP3A 2EEGA 3PV2A 2W4FA 1VCWA 2QKUA 4JL7A 3ID1A 4IC6A 3KZDA 2YTWA 1WI4A 3GDSA 3OTPA 4NMVA 5HF4A 2AWUA 2JINA 1NF3C 2EDZA 5HEBA 4P2AB 1RZXA 2V90A 3HPKA 4NXPA 2KOJA 1W9QA 2CS5A 1UEQA 2ZPLA 2E7KA 3R68A 3LNYA 5HFCA 4JORA 2AWXA 1V1TA 2R4HA 2LC7A 4NNMA 2LC6A 1GM1A 4UU5A 3GCOA 2IWQA 3PV5A 1I16A 2DC2A 1UJUA 2DM8A 5E11A 1U38A 2K1ZA 2RCZA 3DORA 1RGWA 2QKVA 4K76A 3K1RA 2EGNA 5HDYA 3SOEA 2M0ZA 3CH8A 3STJA 3QE1A 1TP5A 2DLSA 5JXBA 2EJYA 1K32A 2D90A 2JREA 3EGGC 3GSLA 2L97A 3AXAA 1MFLA 4JOFA 2HGAA 3DIWA 1VB7A 3FY5A 1WHDA 2EEHA 5EZ0A 1IU0A 5FB8C 5F3XA 2AWWA 3CYYA 3RL7A 4AMHA 1MC7A 1N6EA 4FGMA 1UJDA 4Q2NA 2PZDA 2PNTA 5A2PA 2I4SA 4GVCA 5HJ1A 3GDUA 3HPMA 3RL8A 4NMOA 4YYXA 2DMZA 1LCYA 2WL7A 5I7ZA 1BFEA 2F0AA 2KOMA 2OGPA 3KHFA 3JXTA 3GGEA 2W7RA 2L4TA
chains in the Genus database with same CATH superfamily
2G2LA 2LA8A 3QGLA 2EAQA 1UITA 2PKTA 4NMPA 5GLJA 2KG2A 4LMMA 1Q7XA 3QJNA 3R69A 5D13A 1OBXA 1WG6A 2LOBA 2REYA 4L8NA 1BE9A 1OZIA 1GQ4A 1P1EA 2KJKA 4Q6SA 2HE4A 2QG1A 2HE2A 2I0LA 2KPKA 4E35A 1KEFA 3CBYA 3PDZA 1XZ9A 1FCFA 4RI0A 2KRGA 2K20A 3QIKA 4JOPA 4XHVA 1QAUA 2GZVA 1X6DA 2M10A 1NTEA 1UHPA 3I1EA 5G1DA 2Q9VA 4Z33A 2UZCA 3ID4A 4NXQA 3BPUA 2M0UA 3GJ9A 4WYUA 2KPLA 2DLUA 1Z87A 5HFBA 5B42A 2FCFA 2KAWA 2IWPA 1N7FA 1WHAA 2DJTA 2KV8A 5HFEA 1QLCA 4K72A 3SHUA 1RY4A 3ZRTA 2ZPMA 1KY9A 1N99A 2L4SA 1PDRA 4E34A 1U3BA 3WKMA 3GABA 3R0HA 4K6YA 3SHWA 2X7ZA 3I4WA 3TSZA 5H3JA 2QT5A 1UJVA 4GVDA 2BYGA 3MH7A 4MPAA 5G1EA 2I04A 4H11A 2M0TA 2OPGA 4OEOA 2ENOA 2OS6A 1V62A 4Q3HA 3QJMA 3L4FD 1WI2A 4OEPA 2YT8A 3MH6A 2F5YA 1W9OA 3MH4A 4JOHA 3K82A 2IWNA 3CS0A 2LUIA 2KJPA 4R2ZA 2Q3GA 4NXRA 1I92A 4PQWA 1VAEA 1WH1A 4WYTA 1B8QA 2EGOA 2CSSA 5HETA 3O46A 2M0VA 1V5QA 2MHOA 1OBZA 2PA1A 5B6LA 2OCSA 3VQFA 1Y8TA 1X5RA 1ZOKA 2KOHA 3VQGA 1UM1A 4JOGA 2KYLA 2OSGA 4NMTA 5HF1A 3NGHA 2H3LA 2VZ5A 2VRFA 1X45A 5E21A 1ZUBA 2I0IA 4JOJA 2EXGA 1R6JA 5E6PB 1IHJA 5E22A 2QKTA 3HVQC 3QO6A 2H2BA 4JOKA 1D5GA 3SFJA 3K50A 3NCVA 1IU2A 1OBYA 5E1YA 3DJ3A 4F8KA 2JIKA 2H3MA 3TMHA 1VA8A 4Q6HA 1T2MA 2DB5A 3PS4A 2KQFA 1UFXA 2YUBA 2OMJA 2VSPA 4HOPA 1FC7A 2VPHA 5F67A 4FLNA 1N6DA 1WFVA 1WFGA 4YDPA 2G5MB 1QAVA 1WJLA 2PKUA 2V1WA 4HOPB 2JWEA 2RRMA 3KZEA 1QAVB 4JJ3A 2EDPA 2FNEA 1P1DA 4N6XA 2KBSA 3TSWA 1UF1A 1W9EA 2QBWA 3DJ1A 3ID3A 5HFDA 4G69A 1FC9A 3B76A 4KFVA 3PDVA 2I1NA 1M5ZA 2JXOA 2PDZA 4NNLA 1U37A 3EGHC 2FE5A 4REYA 1X5QA 3I18A 2P3WA 2D92A 3WKLA 2DKRA 3ID2A 1UEPA 5FHTA 1Y7NA 4Q2OA 2VWRA 1RGRA 1L6OA 4GHNA 2KA9A 3CBXA 1FC6A 2EEJA 2KL1A 1UEWA 1UM7A 4Z8JA 1GQ5A 1N7EA 3GDVA 5HEDA 3GCNA 2JILA 4K75A 3NFKA 5IL9A 1V5LA 2CSJA 2JOAA 4Q2QA 1X5NA 2O2TA 1WIFA 4Q2PA 3DJAA 1WF7A 1SOZA 1WF8A 2D8IA 2EDVA 5GNDA 1KWAA 4NMQA 2EV8A 3KDGA 2FN5A 2DAZA 2KJDA 3PV4A 4E3BA 2MX6A 2AINA 2EEIA 2GEFA 2YUYA 1U39A 3KDKA 2EHRA 5ILBA 2OZFA 1SOTA 2OQSA 4P0CA 1VJ6A 1X8SA 3OU0A 3E17A 5HEYA 3LNXA 1Q3PA 2EGKA 5HFFA 1MFGA 2I6VA 3CC0A 4UU6A 5DTHA 1TE0A 1TQ3A 2H2CA 5EYZA 4K78A 4O06A 1Q3OA 1UEZA 1N6FA 4NMRA 3SUZA 4KFWA 2IWOA 3CBZA 2VSVA 4JOEA 3TSVA 1YBOA 3NFLA 1G9OA 3QDOA 2Z9IA 3O5NA 1V6BA 2Z17A 4NMSA 4OAJA 2YT7A 3RLEA 1N7TA 2M3MA 2R3YA 4EDJA 1Z86A 1TP3A 2EEGA 3PV2A 2W4FA 1VCWA 2QKUA 4JL7A 3ID1A 4IC6A 3KZDA 2YTWA 1WI4A 3GDSA 3OTPA 2JSNA 4NMVA 5HF4A 2AWUA 2JINA 1NF3C 2EDZA 5HEBA 4P2AB 1RZXA 2V90A 3HPKA 4NXPA 2KOJA 1W9QA 2CS5A 1UEQA 2ZPLA 2E7KA 3R68A 3LNYA 5HFCA 4JORA 2AWXA 1V1TA 2R4HA 2LC7A 4NNMA 2LC6A 1GM1A 4UU5A 3GCOA 2IWQA 3PV5A 1I16A 1X9ZA 2DC2A 1UJUA 2DM8A 5E11A 1U38A 4JJ0A 2K1ZA 2RCZA 3DORA 1RGWA 2QKVA 4K76A 3K1RA 2EGNA 5HDYA 3SOEA 2M0ZA 3CH8A 3STJA 3QE1A 1TP5A 2DLSA 5JXBA 2EJYA 1K32A 2D90A 2JREA 3EGGC 3GSLA 2L97A 3AXAA 1MFLA 4JOFA 2HGAA 3DIWA 1VB7A 3FY5A 1WHDA 2EEHA 5EZ0A 1IU0A 5FB8C 5F3XA 2AWWA 3CYYA 3RL7A 4AMHA 1MC7A 1N6EA 4FGMA 1UJDA 4Q2NA 2PZDA 2PNTA 5A2PA 2I4SA 4GVCA 5HJ1A 3GDUA 3HPMA 3RL8A 4NMOA 4YYXA 2DMZA 1LCYA 2WL7A 5I7ZA 1BFEA 2F0AA 2KOMA 2OGPA 3KHFA 3JXTA 3GGEA 2W7RA 2L4TA
chains in the Genus database with same CATH topology
2G2LA 2LA8A 3QGLA 2EAQA 1UITA 2PKTA 4NMPA 5GLJA 2KG2A 4LMMA 1Q7XA 3QJNA 3R69A 5D13A 1OBXA 1WG6A 2LOBA 2REYA 4L8NA 1BE9A 1OZIA 1GQ4A 1P1EA 2KJKA 4Q6SA 2HE4A 2QG1A 2HE2A 2I0LA 2KPKA 4E35A 1KEFA 3CBYA 3PDZA 1XZ9A 1FCFA 4RI0A 2KRGA 2K20A 3QIKA 4JOPA 4XHVA 1QAUA 2GZVA 1X6DA 2M10A 1NTEA 1UHPA 3I1EA 5G1DA 2Q9VA 4Z33A 2UZCA 3ID4A 4NXQA 3BPUA 2M0UA 3GJ9A 4WYUA 2KPLA 2DLUA 1Z87A 5HFBA 5B42A 2FCFA 2KAWA 2IWPA 1N7FA 1WHAA 2DJTA 2KV8A 5HFEA 1QLCA 4K72A 3SHUA 1RY4A 3ZRTA 2ZPMA 1KY9A 1N99A 2L4SA 1PDRA 4E34A 1U3BA 3WKMA 3GABA 3R0HA 4K6YA 3SHWA 2X7ZA 3I4WA 3TSZA 5H3JA 2QT5A 1UJVA 4GVDA 2BYGA 3MH7A 4MPAA 5G1EA 2I04A 4H11A 2M0TA 2OPGA 4OEOA 2ENOA 2OS6A 1V62A 4Q3HA 3QJMA 3L4FD 1WI2A 4OEPA 2YT8A 3MH6A 2F5YA 1W9OA 3MH4A 4JOHA 3K82A 2IWNA 3CS0A 2LUIA 2KJPA 4R2ZA 2Q3GA 4NXRA 1I92A 4PQWA 1VAEA 1WH1A 4WYTA 1B8QA 2EGOA 2CSSA 5HETA 3O46A 2M0VA 1V5QA 2MHOA 1OBZA 2PA1A 5B6LA 2OCSA 3VQFA 1Y8TA 1X5RA 1ZOKA 2KOHA 3VQGA 1UM1A 4JOGA 2KYLA 2OSGA 4NMTA 5HF1A 3NGHA 2H3LA 2VZ5A 2VRFA 1X45A 5E21A 1ZUBA 2I0IA 4JOJA 2EXGA 1R6JA 5E6PB 1IHJA 5E22A 2QKTA 3HVQC 3QO6A 2H2BA 4JOKA 1D5GA 3SFJA 3K50A 3NCVA 1IU2A 1OBYA 5E1YA 3DJ3A 4F8KA 2JIKA 2H3MA 3TMHA 1VA8A 4Q6HA 1T2MA 2DB5A 3PS4A 2KQFA 1UFXA 2YUBA 2OMJA 2VSPA 4HOPA 1FC7A 2VPHA 5F67A 4FLNA 1N6DA 1WFVA 1WFGA 4YDPA 2G5MB 1QAVA 1WJLA 2PKUA 2V1WA 4HOPB 2JWEA 2RRMA 3KZEA 1QAVB 4JJ3A 2EDPA 2FNEA 1P1DA 4N6XA 2KBSA 3TSWA 1UF1A 1W9EA 2QBWA 3DJ1A 3ID3A 5HFDA 4G69A 1FC9A 3B76A 4KFVA 3PDVA 2I1NA 1M5ZA 2JXOA 2PDZA 4NNLA 1U37A 3EGHC 2FE5A 4REYA 1X5QA 3I18A 2P3WA 2D92A 3WKLA 2DKRA 3ID2A 1UEPA 5FHTA 1Y7NA 4Q2OA 2VWRA 1RGRA 1L6OA 4GHNA 2KA9A 3CBXA 1FC6A 2EEJA 2KL1A 1UEWA 1UM7A 4Z8JA 1GQ5A 1N7EA 3GDVA 5HEDA 3GCNA 2JILA 4K75A 3NFKA 5IL9A 1V5LA 2CSJA 2JOAA 4Q2QA 1X5NA 2O2TA 1WIFA 4Q2PA 3DJAA 1WF7A 1SOZA 1WF8A 2D8IA 2EDVA 5GNDA 1KWAA 4NMQA 2EV8A 3KDGA 2FN5A 2DAZA 2KJDA 3PV4A 4E3BA 2MX6A 2AINA 2EEIA 2GEFA 2YUYA 1U39A 3KDKA 2EHRA 5ILBA 2OZFA 1SOTA 2OQSA 4P0CA 1VJ6A 1X8SA 3OU0A 3E17A 5HEYA 3LNXA 1Q3PA 2EGKA 5HFFA 1MFGA 2I6VA 3CC0A 4UU6A 5DTHA 1TE0A 1TQ3A 2H2CA 5EYZA 4K78A 4O06A 1Q3OA 1UEZA 1N6FA 4NMRA 3SUZA 4KFWA 2IWOA 3CBZA 2VSVA 4JOEA 3TSVA 1YBOA 3NFLA 1G9OA 3QDOA 2Z9IA 3O5NA 1V6BA 2Z17A 4NMSA 4OAJA 2YT7A 3RLEA 1N7TA 2M3MA 2R3YA 4EDJA 1Z86A 1TP3A 2EEGA 3PV2A 2W4FA 1VCWA 2QKUA 4JL7A 3ID1A 4IC6A 3KZDA 2YTWA 1WI4A 3GDSA 3OTPA 2JSNA 4NMVA 5HF4A 2AWUA 2JINA 1NF3C 2EDZA 5HEBA 4P2AB 1RZXA 2V90A 3HPKA 4NXPA 2KOJA 1W9QA 2CS5A 1UEQA 2ZPLA 2E7KA 3R68A 3LNYA 5HFCA 4JORA 2AWXA 1V1TA 2R4HA 2LC7A 4NNMA 2LC6A 1GM1A 4UU5A 3GCOA 2IWQA 3PV5A 1I16A 1X9ZA 2DC2A 1UJUA 2DM8A 5E11A 1U38A 4JJ0A 2K1ZA 2RCZA 3DORA 1RGWA 2QKVA 4K76A 3K1RA 2EGNA 5HDYA 3SOEA 2M0ZA 3CH8A 3STJA 3QE1A 1TP5A 2DLSA 5JXBA 2EJYA 1K32A 2D90A 2JREA 3EGGC 3GSLA 2L97A 3AXAA 1MFLA 4JOFA 2HGAA 3DIWA 1VB7A 3FY5A 1WHDA 2EEHA 5EZ0A 1IU0A 5FB8C 5F3XA 2AWWA 3CYYA 3RL7A 4AMHA 1MC7A 1N6EA 4FGMA 1UJDA 4Q2NA 2PZDA 2PNTA 5A2PA 2I4SA 4GVCA 5HJ1A 3GDUA 3HPMA 3RL8A 4NMOA 4YYXA 2DMZA 1LCYA 2WL7A 5I7ZA 1BFEA 2F0AA 2KOMA 2OGPA 3KHFA 3JXTA 3GGEA 2W7RA 2L4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2L A;  2LA8 A;  3QGL A;  2EAQ A;  1UIT A;  2PKT A;  4NMP A;  5GLJ A;  2KG2 A;  4LMM A;  1Q7X A;  3QJN A;  3R69 A;  5D13 A;  1OBX A;  1WG6 A;  2LOB A;  2REY A;  4L8N A;  1BE9 A;  1OZI A;  1GQ4 A;  1P1E A;  2KJK A;  4Q6S A;  2HE4 A;  2QG1 A;  2HE2 A;  2I0L A;  2KPK A;  4E35 A;  1KEF A;  3CBY A;  3PDZ A;  1XZ9 A;  1FCF A;  4RI0 A;  2KRG A;  2K20 A;  3QIK A;  4JOP A;  4XHV A;  1QAU A;  2GZV A;  1X6D A;  2M10 A;  1NTE A;  1UHP A;  3I1E A;  5G1D A;  2Q9V A;  4Z33 A;  2UZC A;  3ID4 A;  4NXQ A;  3BPU A;  2M0U A;  3GJ9 A;  4WYU A;  2KPL A;  2DLU A;  1Z87 A;  5HFB A;  2FCF A;  2KAW A;  2IWP A;  1N7F A;  1WHA A;  2DJT A;  2KV8 A;  5HFE A;  1QLC A;  4K72 A;  3SHU A;  1RY4 A;  3ZRT A;  2ZPM A;  1KY9 A;  1N99 A;  2L4S A;  1PDR A;  4E34 A;  1U3B A;  3WKM A;  3R0H A;  4K6Y A;  3SHW A;  2X7Z A;  3I4W A;  3TSZ A;  5H3J A;  2QT5 A;  1UJV A;  4GVD A;  2BYG A;  3MH7 A;  4MPA A;  5G1E A;  2I04 A;  4H11 A;  2M0T A;  2OPG A;  4OEO A;  2ENO A;  2OS6 A;  1V62 A;  4Q3H A;  3QJM A;  3L4F D;  1WI2 A;  4OEP A;  2YT8 A;  3MH6 A;  2F5Y A;  1W9O A;  3MH4 A;  4JOH A;  3K82 A;  2IWN A;  3CS0 A;  2LUI A;  2KJP A;  4R2Z A;  2Q3G A;  4NXR A;  1I92 A;  4PQW A;  1VAE A;  1WH1 A;  4WYT A;  1B8Q A;  2EGO A;  2CSS A;  5HET A;  3O46 A;  2M0V A;  1V5Q A;  2MHO A;  1OBZ A;  2PA1 A;  5B6L A;  2OCS A;  3VQF A;  1Y8T A;  1X5R A;  1ZOK A;  2KOH A;  3VQG A;  1UM1 A;  4JOG A;  2KYL A;  2OSG A;  4NMT A;  5HF1 A;  3NGH A;  2H3L A;  2VZ5 A;  2VRF A;  1X45 A;  5E21 A;  1ZUB A;  2I0I A;  4JOJ A;  2EXG A;  1R6J A;  5E6P B;  1IHJ A;  5E22 A;  2QKT A;  3HVQ C;  3QO6 A;  2H2B A;  4JOK A;  1D5G A;  3SFJ A;  3K50 A;  1IU2 A;  1OBY A;  5E1Y A;  3DJ3 A;  4F8K A;  2JIK A;  2H3M A;  3TMH A;  1VA8 A;  4Q6H A;  1T2M A;  2DB5 A;  3PS4 A;  2KQF A;  1UFX A;  2YUB A;  2OMJ A;  2VSP A;  4HOP A;  1FC7 A;  2VPH A;  5F67 A;  1N6D A;  1WFV A;  1WFG A;  4YDP A;  2G5M B;  1QAV A;  1WJL A;  2PKU A;  2V1W A;  4HOP B;  2JWE A;  2RRM A;  3KZE A;  1QAV B;  2EDP A;  2FNE A;  1P1D A;  4N6X A;  2KBS A;  3TSW A;  1UF1 A;  1W9E A;  3ID3 A;  2QBW A;  3DJ1 A;  5HFD A;  4G69 A;  1FC9 A;  3B76 A;  4KFV A;  3PDV A;  2I1N A;  1M5Z A;  2JXO A;  2PDZ A;  4NNL A;  1U37 A;  3EGH C;  2FE5 A;  4REY A;  1X5Q A;  3I18 A;  2P3W A;  2D92 A;  3WKL A;  2DKR A;  3ID2 A;  1UEP A;  5FHT A;  1Y7N A;  4Q2O A;  2VWR A;  1RGR A;  1L6O A;  4GHN A;  2KA9 A;  3CBX A;  1FC6 A;  2EEJ A;  2KL1 A;  1UEW A;  1UM7 A;  4Z8J A;  1GQ5 A;  1N7E A;  3GDV A;  5HED A;  3GCN A;  2JIL A;  4K75 A;  3NFK A;  1V5L A;  2CSJ A;  2JOA A;  4Q2Q A;  1X5N A;  2O2T A;  1WIF A;  4Q2P A;  3DJA A;  1WF7 A;  1SOZ A;  1WF8 A;  2D8I A;  2EDV A;  5GND A;  1KWA A;  4NMQ A;  2EV8 A;  2FN5 A;  2DAZ A;  2KJD A;  3PV4 A;  4E3B A;  2MX6 A;  2AIN A;  2EEI A;  2YUY A;  1U39 A;  2EHR A;  2OZF A;  1SOT A;  2OQS A;  4P0C A;  1VJ6 A;  1X8S A;  3OU0 A;  3E17 A;  5HEY A;  3LNX A;  1Q3P A;  2EGK A;  5HFF A;  1MFG A;  2I6V A;  3CC0 A;  4UU6 A;  5DTH A;  1TE0 A;  1TQ3 A;  2H2C A;  5EYZ A;  4K78 A;  4O06 A;  1Q3O A;  1UEZ A;  1N6F A;  4NMR A;  3SUZ A;  4KFW A;  2IWO A;  3CBZ A;  2VSV A;  4JOE A;  3TSV A;  1YBO A;  3NFL A;  1G9O A;  3QDO A;  2Z9I A;  3O5N A;  1V6B A;  2Z17 A;  4NMS A;  4OAJ A;  2YT7 A;  3RLE A;  1N7T A;  2M3M A;  2R3Y A;  4EDJ A;  1Z86 A;  1TP3 A;  2EEG A;  3PV2 A;  2W4F A;  1VCW A;  2QKU A;  4JL7 A;  3ID1 A;  4IC6 A;  3KZD A;  2YTW A;  1WI4 A;  3GDS A;  3OTP A;  4NMV A;  5HF4 A;  2AWU A;  2JIN A;  1NF3 C;  2EDZ A;  5HEB A;  4P2A B;  1RZX A;  2V90 A;  3HPK A;  4NXP A;  2KOJ A;  1W9Q A;  2CS5 A;  1UEQ A;  2ZPL A;  2E7K A;  3R68 A;  3LNY A;  5HFC A;  4JOR A;  2AWX A;  1V1T A;  2R4H A;  2LC7 A;  4NNM A;  2LC6 A;  1GM1 A;  4UU5 A;  3GCO A;  2IWQ A;  3PV5 A;  1I16 A;  2DC2 A;  1UJU A;  2DM8 A;  5E11 A;  1U38 A;  2K1Z A;  2RCZ A;  3DOR A;  1RGW A;  2QKV A;  4K76 A;  3K1R A;  2EGN A;  5HDY A;  3SOE A;  2M0Z A;  3CH8 A;  3STJ A;  3QE1 A;  1TP5 A;  2DLS A;  5JXB A;  2EJY A;  1K32 A;  2D90 A;  2JRE A;  3EGG C;  3GSL A;  2L97 A;  3AXA A;  1MFL A;  4JOF A;  2HGA A;  3DIW A;  1VB7 A;  3FY5 A;  1WHD A;  2EEH A;  5EZ0 A;  1IU0 A;  5FB8 C;  5F3X A;  2AWW A;  3CYY A;  3RL7 A;  4AMH A;  1MC7 A;  1N6E A;  4FGM A;  1UJD A;  4Q2N A;  2PZD A;  2PNT A;  5A2P A;  2I4S A;  4GVC A;  5HJ1 A;  3GDU A;  3HPM A;  3RL8 A;  4NMO A;  4YYX A;  2DMZ A;  1LCY A;  2WL7 A;  5I7Z A;  1BFE A;  2F0A A;  2KOM A;  2OGP A;  3KHF A;  3JXT A;  3GGE A;  2W7R A;  2L4T A; 
#chains in the Genus database with same CATH topology
 2G2L A;  2LA8 A;  3QGL A;  2EAQ A;  1UIT A;  2PKT A;  4NMP A;  5GLJ A;  2KG2 A;  4LMM A;  1Q7X A;  3QJN A;  3R69 A;  5D13 A;  1OBX A;  1WG6 A;  2LOB A;  2REY A;  4L8N A;  1BE9 A;  1OZI A;  1GQ4 A;  1P1E A;  2KJK A;  4Q6S A;  2HE4 A;  2QG1 A;  2HE2 A;  2I0L A;  2KPK A;  4E35 A;  1KEF A;  3CBY A;  3PDZ A;  1XZ9 A;  1FCF A;  4RI0 A;  2KRG A;  2K20 A;  3QIK A;  4JOP A;  4XHV A;  1QAU A;  2GZV A;  1X6D A;  2M10 A;  1NTE A;  1UHP A;  3I1E A;  5G1D A;  2Q9V A;  4Z33 A;  2UZC A;  3ID4 A;  4NXQ A;  3BPU A;  2M0U A;  3GJ9 A;  4WYU A;  2KPL A;  2DLU A;  1Z87 A;  5HFB A;  5B42 A;  2FCF A;  2KAW A;  2IWP A;  1N7F A;  1WHA A;  2DJT A;  2KV8 A;  5HFE A;  1QLC A;  4K72 A;  3SHU A;  1RY4 A;  3ZRT A;  2ZPM A;  1KY9 A;  1N99 A;  2L4S A;  1PDR A;  4E34 A;  1U3B A;  3WKM A;  3GAB A;  3R0H A;  4K6Y A;  3SHW A;  2X7Z A;  3I4W A;  3TSZ A;  5H3J A;  2QT5 A;  1UJV A;  4GVD A;  2BYG A;  3MH7 A;  4MPA A;  5G1E A;  2I04 A;  4H11 A;  2M0T A;  2OPG A;  4OEO A;  2ENO A;  2OS6 A;  1V62 A;  4Q3H A;  3QJM A;  3L4F D;  1WI2 A;  4OEP A;  2YT8 A;  3MH6 A;  2F5Y A;  1W9O A;  3MH4 A;  4JOH A;  3K82 A;  2IWN A;  3CS0 A;  2LUI A;  2KJP A;  4R2Z A;  2Q3G A;  4NXR A;  1I92 A;  4PQW A;  1VAE A;  1WH1 A;  4WYT A;  1B8Q A;  2EGO A;  2CSS A;  5HET A;  3O46 A;  2M0V A;  1V5Q A;  2MHO A;  1OBZ A;  2PA1 A;  5B6L A;  2OCS A;  3VQF A;  1Y8T A;  1X5R A;  1ZOK A;  2KOH A;  3VQG A;  1UM1 A;  4JOG A;  2KYL A;  2OSG A;  4NMT A;  5HF1 A;  3NGH A;  2H3L A;  2VZ5 A;  2VRF A;  1X45 A;  5E21 A;  1ZUB A;  2I0I A;  4JOJ A;  2EXG A;  1R6J A;  5E6P B;  1IHJ A;  5E22 A;  2QKT A;  3HVQ C;  3QO6 A;  2H2B A;  4JOK A;  1D5G A;  3SFJ A;  3K50 A;  3NCV A;  1IU2 A;  1OBY A;  5E1Y A;  3DJ3 A;  4F8K A;  2JIK A;  2H3M A;  3TMH A;  1VA8 A;  4Q6H A;  1T2M A;  2DB5 A;  3PS4 A;  2KQF A;  1UFX A;  2YUB A;  2OMJ A;  2VSP A;  4HOP A;  1FC7 A;  2VPH A;  5F67 A;  4FLN A;  1N6D A;  1WFV A;  1WFG A;  4YDP A;  2G5M B;  1QAV A;  1WJL A;  2PKU A;  2V1W A;  4HOP B;  2JWE A;  2RRM A;  3KZE A;  1QAV B;  4JJ3 A;  2EDP A;  2FNE A;  1P1D A;  4N6X A;  2KBS A;  3TSW A;  1UF1 A;  1W9E A;  2QBW A;  3DJ1 A;  3ID3 A;  5HFD A;  4G69 A;  1FC9 A;  3B76 A;  4KFV A;  3PDV A;  2I1N A;  1M5Z A;  2JXO A;  2PDZ A;  4NNL A;  1U37 A;  3EGH C;  2FE5 A;  4REY A;  1X5Q A;  3I18 A;  2P3W A;  2D92 A;  3WKL A;  2DKR A;  3ID2 A;  1UEP A;  5FHT A;  1Y7N A;  4Q2O A;  2VWR A;  1RGR A;  1L6O A;  4GHN A;  2KA9 A;  3CBX A;  1FC6 A;  2EEJ A;  2KL1 A;  1UEW A;  1UM7 A;  4Z8J A;  1GQ5 A;  1N7E A;  3GDV A;  5HED A;  3GCN A;  2JIL A;  4K75 A;  3NFK A;  5IL9 A;  1V5L A;  2CSJ A;  2JOA A;  4Q2Q A;  1X5N A;  2O2T A;  1WIF A;  4Q2P A;  3DJA A;  1WF7 A;  1SOZ A;  1WF8 A;  2D8I A;  2EDV A;  5GND A;  1KWA A;  4NMQ A;  2EV8 A;  3KDG A;  2FN5 A;  2DAZ A;  2KJD A;  3PV4 A;  4E3B A;  2MX6 A;  2AIN A;  2EEI A;  2GEF A;  2YUY A;  1U39 A;  3KDK A;  2EHR A;  5ILB A;  2OZF A;  1SOT A;  2OQS A;  4P0C A;  1VJ6 A;  1X8S A;  3OU0 A;  3E17 A;  5HEY A;  3LNX A;  1Q3P A;  2EGK A;  5HFF A;  1MFG A;  2I6V A;  3CC0 A;  4UU6 A;  5DTH A;  1TE0 A;  1TQ3 A;  2H2C A;  5EYZ A;  4K78 A;  4O06 A;  1Q3O A;  1UEZ A;  1N6F A;  4NMR A;  3SUZ A;  4KFW A;  2IWO A;  3CBZ A;  2VSV A;  4JOE A;  3TSV A;  1YBO A;  3NFL A;  1G9O A;  3QDO A;  2Z9I A;  3O5N A;  1V6B A;  2Z17 A;  4NMS A;  4OAJ A;  2YT7 A;  3RLE A;  1N7T A;  2M3M A;  2R3Y A;  4EDJ A;  1Z86 A;  1TP3 A;  2EEG A;  3PV2 A;  2W4F A;  1VCW A;  2QKU A;  4JL7 A;  3ID1 A;  4IC6 A;  3KZD A;  2YTW A;  1WI4 A;  3GDS A;  3OTP A;  2JSN A;  4NMV A;  5HF4 A;  2AWU A;  2JIN A;  1NF3 C;  2EDZ A;  5HEB A;  4P2A B;  1RZX A;  2V90 A;  3HPK A;  4NXP A;  2KOJ A;  1W9Q A;  2CS5 A;  1UEQ A;  2ZPL A;  2E7K A;  3R68 A;  3LNY A;  5HFC A;  4JOR A;  2AWX A;  1V1T A;  2R4H A;  2LC7 A;  4NNM A;  2LC6 A;  1GM1 A;  4UU5 A;  3GCO A;  2IWQ A;  3PV5 A;  1I16 A;  1X9Z A;  2DC2 A;  1UJU A;  2DM8 A;  5E11 A;  1U38 A;  4JJ0 A;  2K1Z A;  2RCZ A;  3DOR A;  1RGW A;  2QKV A;  4K76 A;  3K1R A;  2EGN A;  5HDY A;  3SOE A;  2M0Z A;  3CH8 A;  3STJ A;  3QE1 A;  1TP5 A;  2DLS A;  5JXB A;  2EJY A;  1K32 A;  2D90 A;  2JRE A;  3EGG C;  3GSL A;  2L97 A;  3AXA A;  1MFL A;  4JOF A;  2HGA A;  3DIW A;  1VB7 A;  3FY5 A;  1WHD A;  2EEH A;  5EZ0 A;  1IU0 A;  5FB8 C;  5F3X A;  2AWW A;  3CYY A;  3RL7 A;  4AMH A;  1MC7 A;  1N6E A;  4FGM A;  1UJD A;  4Q2N A;  2PZD A;  2PNT A;  5A2P A;  2I4S A;  4GVC A;  5HJ1 A;  3GDU A;  3HPM A;  3RL8 A;  4NMO A;  4YYX A;  2DMZ A;  1LCY A;  2WL7 A;  5I7Z A;  1BFE A;  2F0A A;  2KOM A;  2OGP A;  3KHF A;  3JXT A;  3GGE A;  2W7R A;  2L4T A; 
#chains in the Genus database with same CATH homology
 2G2L A;  2LA8 A;  3QGL A;  2EAQ A;  1UIT A;  2PKT A;  4NMP A;  5GLJ A;  2KG2 A;  4LMM A;  1Q7X A;  3QJN A;  3R69 A;  5D13 A;  1OBX A;  1WG6 A;  2LOB A;  2REY A;  4L8N A;  1BE9 A;  1OZI A;  1GQ4 A;  1P1E A;  2KJK A;  4Q6S A;  2HE4 A;  2QG1 A;  2HE2 A;  2I0L A;  2KPK A;  4E35 A;  1KEF A;  3CBY A;  3PDZ A;  1XZ9 A;  1FCF A;  4RI0 A;  2KRG A;  2K20 A;  3QIK A;  4JOP A;  4XHV A;  1QAU A;  2GZV A;  1X6D A;  2M10 A;  1NTE A;  1UHP A;  3I1E A;  5G1D A;  2Q9V A;  4Z33 A;  2UZC A;  3ID4 A;  4NXQ A;  3BPU A;  2M0U A;  3GJ9 A;  4WYU A;  2KPL A;  2DLU A;  1Z87 A;  5HFB A;  5B42 A;  2FCF A;  2KAW A;  2IWP A;  1N7F A;  1WHA A;  2DJT A;  2KV8 A;  5HFE A;  1QLC A;  4K72 A;  3SHU A;  1RY4 A;  3ZRT A;  2ZPM A;  1KY9 A;  1N99 A;  2L4S A;  1PDR A;  4E34 A;  1U3B A;  3WKM A;  3GAB A;  3R0H A;  4K6Y A;  3SHW A;  2X7Z A;  3I4W A;  3TSZ A;  5H3J A;  2QT5 A;  1UJV A;  4GVD A;  2BYG A;  3MH7 A;  4MPA A;  5G1E A;  2I04 A;  4H11 A;  2M0T A;  2OPG A;  4OEO A;  2ENO A;  2OS6 A;  1V62 A;  4Q3H A;  3QJM A;  3L4F D;  1WI2 A;  4OEP A;  2YT8 A;  3MH6 A;  2F5Y A;  1W9O A;  3MH4 A;  4JOH A;  3K82 A;  2IWN A;  3CS0 A;  2LUI A;  2KJP A;  4R2Z A;  2Q3G A;  4NXR A;  1I92 A;  4PQW A;  1VAE A;  1WH1 A;  4WYT A;  1B8Q A;  2EGO A;  2CSS A;  5HET A;  3O46 A;  2M0V A;  1V5Q A;  2MHO A;  1OBZ A;  2PA1 A;  5B6L A;  2OCS A;  3VQF A;  1Y8T A;  1X5R A;  1ZOK A;  2KOH A;  3VQG A;  1UM1 A;  4JOG A;  2KYL A;  2OSG A;  4NMT A;  5HF1 A;  3NGH A;  2H3L A;  2VZ5 A;  2VRF A;  1X45 A;  5E21 A;  1ZUB A;  2I0I A;  4JOJ A;  2EXG A;  1R6J A;  5E6P B;  1IHJ A;  5E22 A;  2QKT A;  3HVQ C;  3QO6 A;  2H2B A;  4JOK A;  1D5G A;  3SFJ A;  3K50 A;  3NCV A;  1IU2 A;  1OBY A;  5E1Y A;  3DJ3 A;  4F8K A;  2JIK A;  2H3M A;  3TMH A;  1VA8 A;  4Q6H A;  1T2M A;  2DB5 A;  3PS4 A;  2KQF A;  1UFX A;  2YUB A;  2OMJ A;  2VSP A;  4HOP A;  1FC7 A;  2VPH A;  5F67 A;  4FLN A;  1N6D A;  1WFV A;  1WFG A;  4YDP A;  2G5M B;  1QAV A;  1WJL A;  2PKU A;  2V1W A;  4HOP B;  2JWE A;  2RRM A;  3KZE A;  1QAV B;  4JJ3 A;  2EDP A;  2FNE A;  1P1D A;  4N6X A;  2KBS A;  3TSW A;  1UF1 A;  1W9E A;  2QBW A;  3DJ1 A;  3ID3 A;  5HFD A;  4G69 A;  1FC9 A;  3B76 A;  4KFV A;  3PDV A;  2I1N A;  1M5Z A;  2JXO A;  2PDZ A;  4NNL A;  1U37 A;  3EGH C;  2FE5 A;  4REY A;  1X5Q A;  3I18 A;  2P3W A;  2D92 A;  3WKL A;  2DKR A;  3ID2 A;  1UEP A;  5FHT A;  1Y7N A;  4Q2O A;  2VWR A;  1RGR A;  1L6O A;  4GHN A;  2KA9 A;  3CBX A;  1FC6 A;  2EEJ A;  2KL1 A;  1UEW A;  1UM7 A;  4Z8J A;  1GQ5 A;  1N7E A;  3GDV A;  5HED A;  3GCN A;  2JIL A;  4K75 A;  3NFK A;  5IL9 A;  1V5L A;  2CSJ A;  2JOA A;  4Q2Q A;  1X5N A;  2O2T A;  1WIF A;  4Q2P A;  3DJA A;  1WF7 A;  1SOZ A;  1WF8 A;  2D8I A;  2EDV A;  5GND A;  1KWA A;  4NMQ A;  2EV8 A;  3KDG A;  2FN5 A;  2DAZ A;  2KJD A;  3PV4 A;  4E3B A;  2MX6 A;  2AIN A;  2EEI A;  2GEF A;  2YUY A;  1U39 A;  3KDK A;  2EHR A;  5ILB A;  2OZF A;  1SOT A;  2OQS A;  4P0C A;  1VJ6 A;  1X8S A;  3OU0 A;  3E17 A;  5HEY A;  3LNX A;  1Q3P A;  2EGK A;  5HFF A;  1MFG A;  2I6V A;  3CC0 A;  4UU6 A;  5DTH A;  1TE0 A;  1TQ3 A;  2H2C A;  5EYZ A;  4K78 A;  4O06 A;  1Q3O A;  1UEZ A;  1N6F A;  4NMR A;  3SUZ A;  4KFW A;  2IWO A;  3CBZ A;  2VSV A;  4JOE A;  3TSV A;  1YBO A;  3NFL A;  1G9O A;  3QDO A;  2Z9I A;  3O5N A;  1V6B A;  2Z17 A;  4NMS A;  4OAJ A;  2YT7 A;  3RLE A;  1N7T A;  2M3M A;  2R3Y A;  4EDJ A;  1Z86 A;  1TP3 A;  2EEG A;  3PV2 A;  2W4F A;  1VCW A;  2QKU A;  4JL7 A;  3ID1 A;  4IC6 A;  3KZD A;  2YTW A;  1WI4 A;  3GDS A;  3OTP A;  2JSN A;  4NMV A;  5HF4 A;  2AWU A;  2JIN A;  1NF3 C;  2EDZ A;  5HEB A;  4P2A B;  1RZX A;  2V90 A;  3HPK A;  4NXP A;  2KOJ A;  1W9Q A;  2CS5 A;  1UEQ A;  2ZPL A;  2E7K A;  3R68 A;  3LNY A;  5HFC A;  4JOR A;  2AWX A;  1V1T A;  2R4H A;  2LC7 A;  4NNM A;  2LC6 A;  1GM1 A;  4UU5 A;  3GCO A;  2IWQ A;  3PV5 A;  1I16 A;  1X9Z A;  2DC2 A;  1UJU A;  2DM8 A;  5E11 A;  1U38 A;  4JJ0 A;  2K1Z A;  2RCZ A;  3DOR A;  1RGW A;  2QKV A;  4K76 A;  3K1R A;  2EGN A;  5HDY A;  3SOE A;  2M0Z A;  3CH8 A;  3STJ A;  3QE1 A;  1TP5 A;  2DLS A;  5JXB A;  2EJY A;  1K32 A;  2D90 A;  2JRE A;  3EGG C;  3GSL A;  2L97 A;  3AXA A;  1MFL A;  4JOF A;  2HGA A;  3DIW A;  1VB7 A;  3FY5 A;  1WHD A;  2EEH A;  5EZ0 A;  1IU0 A;  5FB8 C;  5F3X A;  2AWW A;  3CYY A;  3RL7 A;  4AMH A;  1MC7 A;  1N6E A;  4FGM A;  1UJD A;  4Q2N A;  2PZD A;  2PNT A;  5A2P A;  2I4S A;  4GVC A;  5HJ1 A;  3GDU A;  3HPM A;  3RL8 A;  4NMO A;  4YYX A;  2DMZ A;  1LCY A;  2WL7 A;  5I7Z A;  1BFE A;  2F0A A;  2KOM A;  2OGP A;  3KHF A;  3JXT A;  3GGE A;  2W7R A;  2L4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...