2OS6A

Solution structure of larg pdz domain in complex with c-terminal octa-peptide of plexin b1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
89
structure length
89
Chain Sequence
GSHMGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSYVALTVQGRPPGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 12
publication title Solution structure of the LARG PDZ domain in complex with C-terminal peptide of Plexin B1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 11
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2os6A00
1WFVA 3ID1A 2DLUA 1N7TA 3PDVA 1RGWA 1X5RA 2KQFA 2M0TA 2KRGA 5HFDA 4OAJA 1WJLA 2DLSA 2KOMA 2YTWA 1QAUA 4WYUA 1UF1A 2PKUA 1UEZA 5E1YA 4E34A 2H2CA 2H2BA 1WHAA 3NGHA 3RL7A 2D92A 2D8IA 3PDZA 5HF4A 4Q2QA 5FB8C 1N7EA 1P1DA 2JXOA 4EDJA 1U39A 1KY9A 2AINA 2H3LA 3GDUA 3ID4A 1OBZA 2EDPA 5A2PA 2AWXA 1UM7A 4P2AB 3PV4A 3LNYA 2JWEA 1V6BA 5G1EA 4GHNA 4UU6A 2EDVA 3ID2A 2O2TA 2Z9IA 2QG1A 3E17A 2KA9A 2KOJA 1KWAA 3NFLA 1V62A 5HEYA 3B76A 2FN5A 3EGHC 3SFJA 1VCWA 1LCYA 1U38A 3TSWA 5F67A 5D13A 4Z33A 2QT5A 4NMRA 2Z17A 3ID3A 2BYGA 2FNEA 5E22A 5HJ1A 2ZPMA 2JIKA 1WI2A 2FE5A 2QBWA 1VJ6A 4KFWA 3SHUA 2IWPA 2KAWA 3DORA 2W4FA 2IWNA 1UEWA 2OPGA 2JILA 2QKVA 2JINA 3PV2A 4JOPA 5GNDA 2I4SA 2P3WA 3QO6A 3CC0A 1K32A 2VWRA 1TQ3A 1PDRA 2EGOA 1WF8A 4MPAA 3R69A 2G5MB 2YT7A 2JREA 2DJTA 1W9EA 1GM1A 3TMHA 4NMQA 2ENOA 2EAQA 1N6DA 5HFFA 1B8QA 1VAEA 5EYZA 1NF3C 2W7RA 1ZUBA 3K82A 1UJVA 2KJKA 2JOAA 3QIKA 1UJUA 2WL7A 3O46A 3DJ3A 3SUZA 5HDYA 1Z87A 1N7FA 3CBZA 3RL8A 1T2MA 1I92A 4Q6HA 2F0AA 5I7ZA 5F3XA 4AMHA 4JOGA 2DAZA 2M0VA 3GSLA 4Q2OA 5JXBA 3QJMA 2YT8A 1Y7NA 2H3MA 4F8KA 1Q3OA 4K78A 1NTEA 2OMJA 5FHTA 3FY5A 2DC2A 3QE1A 4G69A 1W9OA 2RRMA 4WYTA 4NXQA 2YUBA 2M3MA 4GVCA 2L97A 4JOFA 4YYXA 2LC7A 1Z86A 2EEGA 4E3BA 5DTHA 4OEPA 4IC6A 2OZFA 2OQSA 1IU0A 2F5YA 1WH1A 2MHOA 2OCSA 3GCNA 4JOJA 1FC9A 2V1WA 3VQFA 4NXPA 2LOBA 4L8NA 2GZVA 1XZ9A 2X7ZA 4UU5A 2D90A 4K75A 1R6JA 2HE4A 2I0LA 2EXGA 4JOKA 4NNLA 1G9OA 1TE0A 2EDZA 3LNXA 4NNMA 4RI0A 4YDPA 5HF1A 3MH4A 1BE9A 1M5ZA 3R0HA 2KYLA 1ZOKA 2DB5A 2PNTA 5E6PB 2RCZA 2FCFA 4Z8JA 2HGAA 3BPUA 1MFGA 2OGPA 2KG2A 2VPHA 1U3BA 1MFLA 4KFVA 3CBXA 5B6LA 1L6OA 1UFXA 4O06A 5HEBA 4Q3HA 2VRFA 2R4HA 1FCFA 2VZ5A 2L4SA 2HE2A 3AXAA 1N6FA 2G2LA 2EGNA 3MH7A 4H11A 3CH8A 4Q6SA 1V5QA 2PA1A 1RY4A 1X45A 1V5LA 2CS5A 1FC7A 2KPLA 1U37A 3STJA 1X8SA 3RLEA 4GVDA 1GQ4A 3I18A 2YUYA 2KL1A 3CYYA 3KZEA 2KBSA 2M0UA 3PS4A 3DIWA 4JOHA 2L4TA 2OSGA 3QJNA 4NXRA 2Q9VA 3HPMA 4NMOA 2DKRA 2CSSA 4NMSA 1RZXA 5EZ0A 3PV5A 2VSVA 4R2ZA 2EEJA 4FGMA 2LC6A 2I6VA 1I16A 3MH6A 5G1DA 2OS6A 2LA8A 5E11A 1P1EA 3GDVA 1V1TA 3SHWA 1FC6A 1IHJA 1OBXA 1VA8A 1BFEA 1N6EA 4N6XA 5H3JA 2ZPLA 2Q3GA 3CBYA 3QGLA 3DJAA 4K72A 1IU2A 4OEOA 2DM8A 3O5NA 3R68A 3HVQC 4LMMA 1WHDA 4E35A 2R3YA 1UJDA 5HETA 3TSZA 3I1EA 1WF7A 3WKLA 4Q2PA 1Q7XA 3NFKA 1Y8TA 4JORA 4NMTA 2IWQA 2EEIA 2EV8A 3GCOA 3GJ9A 3K50A 2I04A 1UHPA 2K20A 1GQ5A 2REYA 1SOZA 4NMPA 4NMVA 2I0IA 3ZRTA 2KV8A 2EEHA 1SOTA 3K1RA 4P0CA 2AWUA 5E21A 1WFGA 1QAVB 2KOHA 2IWOA 3I4WA 1WG6A 1QAVA 1OBYA 2I1NA 2KPKA 3JXTA 1X5NA 2PDZA 5GLJA 1YBOA 2DMZA 1VB7A 2LUIA 2E7KA 3OU0A 4XHVA 3KZDA 3GGEA 3WKMA 2UZCA 1UITA 1MC7A 1OZIA 2MX6A 3HPKA 1TP5A 2V90A 4Q2NA 5HFBA 1UEQA 3OTPA 3DJ1A 1KEFA 1N99A 2QKUA 2M0ZA 3QDOA 2PKTA 4JL7A 1WIFA 4JOEA 2AWWA 4K76A 2EGKA 4REYA 2CSJA 5HFCA 1UEPA 2VSPA 2EHRA 4PQWA 1W9QA 2PZDA 1UM1A 1Q3PA 2EJYA 3VQGA 2KJDA 3KHFA 2K1ZA 1TP3A 2QKTA 3EGGC 1D5GA 2M10A 4HOPB 4K6YA 1X5QA 4HOPA 5HFEA 3TSVA 5HEDA 3SOEA 1WI4A 3CS0A 1RGRA 1QLCA 1X6DA 3L4FD 3GDSA 2KJPA
chains in the Genus database with same CATH superfamily
3GABA 1WFVA 3ID1A 2DLUA 1N7TA 3PDVA 1RGWA 1X5RA 2KQFA 2M0TA 2KRGA 5HFDA 4OAJA 1WJLA 2DLSA 2KOMA 2YTWA 3KDKA 1QAUA 4WYUA 1UF1A 2PKUA 1UEZA 5E1YA 4E34A 2H2CA 2H2BA 1WHAA 3NGHA 3RL7A 2D92A 2D8IA 3PDZA 5HF4A 4Q2QA 5FB8C 1N7EA 1P1DA 2JXOA 4EDJA 1U39A 1KY9A 2AINA 2H3LA 3GDUA 3ID4A 1OBZA 2EDPA 5A2PA 2AWXA 1UM7A 4P2AB 3PV4A 3LNYA 2JWEA 1V6BA 5G1EA 4GHNA 4UU6A 2EDVA 3ID2A 2O2TA 2Z9IA 2QG1A 3E17A 2KA9A 2KOJA 1KWAA 3NFLA 1V62A 5HEYA 3B76A 2FN5A 3EGHC 3SFJA 1VCWA 2JSNA 1LCYA 1U38A 3TSWA 5F67A 5D13A 4Z33A 2QT5A 4NMRA 2Z17A 3ID3A 2BYGA 2FNEA 5E22A 5HJ1A 2ZPMA 2JIKA 1WI2A 2FE5A 2QBWA 2GEFA 1VJ6A 4KFWA 3SHUA 2IWPA 2KAWA 3DORA 2W4FA 2IWNA 1UEWA 2OPGA 2JILA 2QKVA 2JINA 3PV2A 4JOPA 5GNDA 2I4SA 2P3WA 3QO6A 3CC0A 1K32A 2VWRA 1TQ3A 1PDRA 2EGOA 1WF8A 4MPAA 3R69A 2G5MB 2YT7A 2JREA 2DJTA 1W9EA 1GM1A 3TMHA 4NMQA 2ENOA 2EAQA 1N6DA 5HFFA 1B8QA 1VAEA 5EYZA 1NF3C 2W7RA 1ZUBA 3K82A 1UJVA 2KJKA 2JOAA 3QIKA 1UJUA 2WL7A 3O46A 3DJ3A 3SUZA 5HDYA 1Z87A 1N7FA 3CBZA 3RL8A 1T2MA 1I92A 4Q6HA 2F0AA 5I7ZA 5F3XA 4AMHA 4JOGA 2DAZA 2M0VA 3GSLA 4Q2OA 5JXBA 3QJMA 2YT8A 1Y7NA 2H3MA 4F8KA 1Q3OA 4K78A 1NTEA 2OMJA 5FHTA 3FY5A 2DC2A 3QE1A 4G69A 1W9OA 2RRMA 4WYTA 4NXQA 2YUBA 2M3MA 4GVCA 4FLNA 2L97A 4JOFA 4YYXA 2LC7A 1Z86A 2EEGA 4E3BA 5DTHA 4OEPA 4IC6A 2OZFA 2OQSA 1IU0A 2F5YA 1WH1A 2MHOA 2OCSA 3GCNA 4JJ3A 4JOJA 1FC9A 2V1WA 3VQFA 4NXPA 5IL9A 2LOBA 4L8NA 2GZVA 1XZ9A 2X7ZA 4UU5A 2D90A 4K75A 1R6JA 2HE4A 2I0LA 2EXGA 4JOKA 4NNLA 1G9OA 1TE0A 2EDZA 3LNXA 4NNMA 4RI0A 4YDPA 5HF1A 3MH4A 1BE9A 1M5ZA 3R0HA 2KYLA 1ZOKA 2DB5A 2PNTA 5E6PB 2RCZA 2FCFA 4Z8JA 2HGAA 3BPUA 1MFGA 2OGPA 2KG2A 2VPHA 1U3BA 1MFLA 4KFVA 3CBXA 5B6LA 1L6OA 1UFXA 4O06A 5HEBA 4Q3HA 2VRFA 2R4HA 1FCFA 2VZ5A 2L4SA 2HE2A 3AXAA 1N6FA 2G2LA 2EGNA 3MH7A 4H11A 3CH8A 4Q6SA 1V5QA 2PA1A 1RY4A 1X45A 1V5LA 2CS5A 1FC7A 2KPLA 1U37A 3STJA 1X8SA 3RLEA 4GVDA 1GQ4A 3I18A 5B42A 2YUYA 2KL1A 3CYYA 3KZEA 2KBSA 2M0UA 3PS4A 3DIWA 4JOHA 2L4TA 2OSGA 3QJNA 4NXRA 2Q9VA 3HPMA 4NMOA 2DKRA 2CSSA 4NMSA 1RZXA 5EZ0A 3PV5A 2VSVA 1X9ZA 4R2ZA 2EEJA 4FGMA 2LC6A 2I6VA 1I16A 3MH6A 5G1DA 2OS6A 4JJ0A 2LA8A 5E11A 1P1EA 3GDVA 3KDGA 1V1TA 3SHWA 1FC6A 1IHJA 1OBXA 1VA8A 1BFEA 1N6EA 4N6XA 5H3JA 2ZPLA 2Q3GA 3CBYA 3QGLA 3DJAA 4K72A 1IU2A 4OEOA 2DM8A 3O5NA 3R68A 3HVQC 4LMMA 1WHDA 4E35A 2R3YA 1UJDA 5HETA 3TSZA 3I1EA 1WF7A 3WKLA 4Q2PA 1Q7XA 3NFKA 1Y8TA 4JORA 4NMTA 2IWQA 2EEIA 2EV8A 3GCOA 3GJ9A 3K50A 2I04A 1UHPA 2K20A 1GQ5A 5ILBA 2REYA 1SOZA 4NMPA 4NMVA 2I0IA 3ZRTA 2KV8A 2EEHA 1SOTA 3K1RA 4P0CA 2AWUA 5E21A 1WFGA 1QAVB 2KOHA 2IWOA 3I4WA 1WG6A 1QAVA 1OBYA 2I1NA 2KPKA 3JXTA 1X5NA 2PDZA 5GLJA 1YBOA 2DMZA 1VB7A 2LUIA 2E7KA 3OU0A 4XHVA 3KZDA 3GGEA 3WKMA 2UZCA 3NCVA 1UITA 1MC7A 1OZIA 2MX6A 3HPKA 1TP5A 2V90A 4Q2NA 5HFBA 1UEQA 3OTPA 3DJ1A 1KEFA 1N99A 2QKUA 2M0ZA 3QDOA 2PKTA 4JL7A 1WIFA 4JOEA 2AWWA 4K76A 2EGKA 4REYA 2CSJA 5HFCA 1UEPA 2VSPA 2EHRA 4PQWA 1W9QA 2PZDA 1UM1A 1Q3PA 2EJYA 3VQGA 2KJDA 3KHFA 2K1ZA 1TP3A 2QKTA 3EGGC 1D5GA 2M10A 4HOPB 4K6YA 1X5QA 4HOPA 5HFEA 3TSVA 5HEDA 3SOEA 1WI4A 3CS0A 1RGRA 1QLCA 1X6DA 3L4FD 3GDSA 2KJPA
chains in the Genus database with same CATH topology
3GABA 1WFVA 3ID1A 2DLUA 1N7TA 3PDVA 1RGWA 1X5RA 2KQFA 2M0TA 2KRGA 5HFDA 4OAJA 1WJLA 2DLSA 2KOMA 2YTWA 3KDKA 1QAUA 4WYUA 1UF1A 2PKUA 1UEZA 5E1YA 4E34A 2H2CA 2H2BA 1WHAA 3NGHA 3RL7A 2D92A 2D8IA 3PDZA 5HF4A 4Q2QA 5FB8C 1N7EA 1P1DA 2JXOA 4EDJA 1U39A 1KY9A 2AINA 2H3LA 3GDUA 3ID4A 1OBZA 2EDPA 5A2PA 2AWXA 1UM7A 4P2AB 3PV4A 3LNYA 2JWEA 1V6BA 5G1EA 4GHNA 4UU6A 2EDVA 3ID2A 2O2TA 2Z9IA 2QG1A 3E17A 2KA9A 2KOJA 1KWAA 3NFLA 1V62A 5HEYA 3B76A 2FN5A 3EGHC 3SFJA 1VCWA 2JSNA 1LCYA 1U38A 3TSWA 5F67A 5D13A 4Z33A 2QT5A 4NMRA 2Z17A 3ID3A 2BYGA 2FNEA 5E22A 5HJ1A 2ZPMA 2JIKA 1WI2A 2FE5A 2QBWA 2GEFA 1VJ6A 4KFWA 3SHUA 2IWPA 2KAWA 3DORA 2W4FA 2IWNA 1UEWA 2OPGA 2JILA 2QKVA 2JINA 3PV2A 4JOPA 5GNDA 2I4SA 2P3WA 3QO6A 3CC0A 1K32A 2VWRA 1TQ3A 1PDRA 2EGOA 1WF8A 4MPAA 3R69A 2G5MB 2YT7A 2JREA 2DJTA 1W9EA 1GM1A 3TMHA 4NMQA 2ENOA 2EAQA 1N6DA 5HFFA 1B8QA 1VAEA 5EYZA 1NF3C 2W7RA 1ZUBA 3K82A 1UJVA 2KJKA 2JOAA 3QIKA 1UJUA 2WL7A 3O46A 3DJ3A 3SUZA 5HDYA 1Z87A 1N7FA 3CBZA 3RL8A 1T2MA 1I92A 4Q6HA 2F0AA 5I7ZA 5F3XA 4AMHA 4JOGA 2DAZA 2M0VA 3GSLA 4Q2OA 5JXBA 3QJMA 2YT8A 1Y7NA 2H3MA 4F8KA 1Q3OA 4K78A 1NTEA 2OMJA 5FHTA 3FY5A 2DC2A 3QE1A 4G69A 1W9OA 2RRMA 4WYTA 4NXQA 2YUBA 2M3MA 4GVCA 4FLNA 2L97A 4JOFA 4YYXA 2LC7A 1Z86A 2EEGA 4E3BA 5DTHA 4OEPA 4IC6A 2OZFA 2OQSA 1IU0A 2F5YA 1WH1A 2MHOA 2OCSA 3GCNA 4JJ3A 4JOJA 1FC9A 2V1WA 3VQFA 4NXPA 5IL9A 2LOBA 4L8NA 2GZVA 1XZ9A 2X7ZA 4UU5A 2D90A 4K75A 1R6JA 2HE4A 2I0LA 2EXGA 4JOKA 4NNLA 1G9OA 1TE0A 2EDZA 3LNXA 4NNMA 4RI0A 4YDPA 5HF1A 3MH4A 1BE9A 1M5ZA 3R0HA 2KYLA 1ZOKA 2DB5A 2PNTA 5E6PB 2RCZA 2FCFA 4Z8JA 2HGAA 3BPUA 1MFGA 2OGPA 2KG2A 2VPHA 1U3BA 1MFLA 4KFVA 3CBXA 5B6LA 1L6OA 1UFXA 4O06A 5HEBA 4Q3HA 2VRFA 2R4HA 1FCFA 2VZ5A 2L4SA 2HE2A 3AXAA 1N6FA 2G2LA 2EGNA 3MH7A 4H11A 3CH8A 4Q6SA 1V5QA 2PA1A 1RY4A 1X45A 1V5LA 2CS5A 1FC7A 2KPLA 1U37A 3STJA 1X8SA 3RLEA 4GVDA 1GQ4A 3I18A 5B42A 2YUYA 2KL1A 3CYYA 3KZEA 2KBSA 2M0UA 3PS4A 3DIWA 4JOHA 2L4TA 2OSGA 3QJNA 4NXRA 2Q9VA 3HPMA 4NMOA 2DKRA 2CSSA 4NMSA 1RZXA 5EZ0A 3PV5A 2VSVA 1X9ZA 4R2ZA 2EEJA 4FGMA 2LC6A 2I6VA 1I16A 3MH6A 5G1DA 2OS6A 4JJ0A 2LA8A 5E11A 1P1EA 3GDVA 3KDGA 1V1TA 3SHWA 1FC6A 1IHJA 1OBXA 1VA8A 1BFEA 1N6EA 4N6XA 5H3JA 2ZPLA 2Q3GA 3CBYA 3QGLA 3DJAA 4K72A 1IU2A 4OEOA 2DM8A 3O5NA 3R68A 3HVQC 4LMMA 1WHDA 4E35A 2R3YA 1UJDA 5HETA 3TSZA 3I1EA 1WF7A 3WKLA 4Q2PA 1Q7XA 3NFKA 1Y8TA 4JORA 4NMTA 2IWQA 2EEIA 2EV8A 3GCOA 3GJ9A 3K50A 2I04A 1UHPA 2K20A 1GQ5A 5ILBA 2REYA 1SOZA 4NMPA 4NMVA 2I0IA 3ZRTA 2KV8A 2EEHA 1SOTA 3K1RA 4P0CA 2AWUA 5E21A 1WFGA 1QAVB 2KOHA 2IWOA 3I4WA 1WG6A 1QAVA 1OBYA 2I1NA 2KPKA 3JXTA 1X5NA 2PDZA 5GLJA 1YBOA 2DMZA 1VB7A 2LUIA 2E7KA 3OU0A 4XHVA 3KZDA 3GGEA 3WKMA 2UZCA 3NCVA 1UITA 1MC7A 1OZIA 2MX6A 3HPKA 1TP5A 2V90A 4Q2NA 5HFBA 1UEQA 3OTPA 3DJ1A 1KEFA 1N99A 2QKUA 2M0ZA 3QDOA 2PKTA 4JL7A 1WIFA 4JOEA 2AWWA 4K76A 2EGKA 4REYA 2CSJA 5HFCA 1UEPA 2VSPA 2EHRA 4PQWA 1W9QA 2PZDA 1UM1A 1Q3PA 2EJYA 3VQGA 2KJDA 3KHFA 2K1ZA 1TP3A 2QKTA 3EGGC 1D5GA 2M10A 4HOPB 4K6YA 1X5QA 4HOPA 5HFEA 3TSVA 5HEDA 3SOEA 1WI4A 3CS0A 1RGRA 1QLCA 1X6DA 3L4FD 3GDSA 2KJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFV A;  3ID1 A;  2DLU A;  1N7T A;  3PDV A;  1RGW A;  1X5R A;  2KQF A;  2M0T A;  2KRG A;  5HFD A;  4OAJ A;  1WJL A;  2DLS A;  2KOM A;  2YTW A;  1QAU A;  4WYU A;  1UF1 A;  2PKU A;  1UEZ A;  5E1Y A;  4E34 A;  2H2C A;  2H2B A;  1WHA A;  3NGH A;  3RL7 A;  2D92 A;  2D8I A;  3PDZ A;  5HF4 A;  4Q2Q A;  5FB8 C;  1N7E A;  1P1D A;  2JXO A;  4EDJ A;  1U39 A;  1KY9 A;  2AIN A;  2H3L A;  3GDU A;  3ID4 A;  1OBZ A;  2EDP A;  5A2P A;  2AWX A;  1UM7 A;  4P2A B;  3PV4 A;  3LNY A;  2JWE A;  1V6B A;  5G1E A;  4GHN A;  4UU6 A;  2EDV A;  3ID2 A;  2O2T A;  2Z9I A;  2QG1 A;  3E17 A;  2KA9 A;  2KOJ A;  1KWA A;  3NFL A;  1V62 A;  5HEY A;  3B76 A;  2FN5 A;  3EGH C;  3SFJ A;  1VCW A;  1LCY A;  1U38 A;  3TSW A;  5F67 A;  5D13 A;  4Z33 A;  2QT5 A;  4NMR A;  2Z17 A;  3ID3 A;  2BYG A;  2FNE A;  5E22 A;  5HJ1 A;  2ZPM A;  2JIK A;  1WI2 A;  2FE5 A;  2QBW A;  1VJ6 A;  4KFW A;  3SHU A;  2IWP A;  2KAW A;  3DOR A;  2W4F A;  2IWN A;  1UEW A;  2OPG A;  2JIL A;  2QKV A;  2JIN A;  3PV2 A;  4JOP A;  5GND A;  2I4S A;  2P3W A;  3QO6 A;  3CC0 A;  1K32 A;  2VWR A;  1TQ3 A;  1PDR A;  2EGO A;  1WF8 A;  4MPA A;  3R69 A;  2G5M B;  2YT7 A;  2JRE A;  2DJT A;  1W9E A;  1GM1 A;  3TMH A;  4NMQ A;  2ENO A;  2EAQ A;  1N6D A;  5HFF A;  1B8Q A;  1VAE A;  5EYZ A;  1NF3 C;  2W7R A;  1ZUB A;  3K82 A;  1UJV A;  2KJK A;  2JOA A;  3QIK A;  1UJU A;  2WL7 A;  3O46 A;  3DJ3 A;  3SUZ A;  5HDY A;  1Z87 A;  1N7F A;  3CBZ A;  3RL8 A;  1T2M A;  1I92 A;  4Q6H A;  2F0A A;  5I7Z A;  5F3X A;  4AMH A;  4JOG A;  2DAZ A;  2M0V A;  3GSL A;  4Q2O A;  5JXB A;  3QJM A;  2YT8 A;  1Y7N A;  2H3M A;  4F8K A;  1Q3O A;  4K78 A;  1NTE A;  2OMJ A;  5FHT A;  3FY5 A;  2DC2 A;  3QE1 A;  4G69 A;  1W9O A;  2RRM A;  4WYT A;  4NXQ A;  2YUB A;  2M3M A;  4GVC A;  2L97 A;  4JOF A;  4YYX A;  2LC7 A;  1Z86 A;  2EEG A;  4E3B A;  5DTH A;  4OEP A;  4IC6 A;  2OZF A;  2OQS A;  1IU0 A;  2F5Y A;  1WH1 A;  2MHO A;  2OCS A;  3GCN A;  4JOJ A;  1FC9 A;  2V1W A;  3VQF A;  4NXP A;  2LOB A;  4L8N A;  2GZV A;  1XZ9 A;  2X7Z A;  4UU5 A;  2D90 A;  4K75 A;  1R6J A;  2HE4 A;  2I0L A;  2EXG A;  4JOK A;  4NNL A;  1G9O A;  1TE0 A;  2EDZ A;  3LNX A;  4NNM A;  4RI0 A;  4YDP A;  5HF1 A;  3MH4 A;  1BE9 A;  1M5Z A;  3R0H A;  2KYL A;  1ZOK A;  2DB5 A;  2PNT A;  5E6P B;  2RCZ A;  2FCF A;  4Z8J A;  2HGA A;  3BPU A;  1MFG A;  2OGP A;  2KG2 A;  2VPH A;  1U3B A;  1MFL A;  4KFV A;  3CBX A;  5B6L A;  1L6O A;  1UFX A;  4O06 A;  5HEB A;  4Q3H A;  2VRF A;  2R4H A;  1FCF A;  2VZ5 A;  2L4S A;  2HE2 A;  3AXA A;  1N6F A;  2G2L A;  2EGN A;  3MH7 A;  4H11 A;  3CH8 A;  4Q6S A;  1V5Q A;  2PA1 A;  1RY4 A;  1X45 A;  1V5L A;  2CS5 A;  1FC7 A;  2KPL A;  1U37 A;  3STJ A;  1X8S A;  3RLE A;  4GVD A;  1GQ4 A;  3I18 A;  2YUY A;  2KL1 A;  3CYY A;  3KZE A;  2KBS A;  2M0U A;  3PS4 A;  3DIW A;  4JOH A;  2L4T A;  2OSG A;  3QJN A;  4NXR A;  2Q9V A;  3HPM A;  4NMO A;  2DKR A;  2CSS A;  4NMS A;  1RZX A;  5EZ0 A;  3PV5 A;  2VSV A;  4R2Z A;  2EEJ A;  4FGM A;  2LC6 A;  2I6V A;  1I16 A;  3MH6 A;  5G1D A;  2OS6 A;  2LA8 A;  5E11 A;  1P1E A;  3GDV A;  1V1T A;  3SHW A;  1FC6 A;  1IHJ A;  1OBX A;  1VA8 A;  1BFE A;  1N6E A;  4N6X A;  5H3J A;  2ZPL A;  2Q3G A;  3CBY A;  3QGL A;  3DJA A;  4K72 A;  1IU2 A;  4OEO A;  2DM8 A;  3O5N A;  3R68 A;  3HVQ C;  4LMM A;  1WHD A;  4E35 A;  2R3Y A;  1UJD A;  5HET A;  3TSZ A;  3I1E A;  1WF7 A;  3WKL A;  4Q2P A;  1Q7X A;  3NFK A;  1Y8T A;  4JOR A;  4NMT A;  2IWQ A;  2EEI A;  2EV8 A;  3GCO A;  3GJ9 A;  3K50 A;  2I04 A;  1UHP A;  2K20 A;  1GQ5 A;  2REY A;  1SOZ A;  4NMP A;  4NMV A;  2I0I A;  3ZRT A;  2KV8 A;  2EEH A;  1SOT A;  3K1R A;  4P0C A;  2AWU A;  5E21 A;  1WFG A;  1QAV B;  2KOH A;  2IWO A;  3I4W A;  1WG6 A;  1QAV A;  1OBY A;  2I1N A;  2KPK A;  3JXT A;  1X5N A;  2PDZ A;  5GLJ A;  1YBO A;  2DMZ A;  1VB7 A;  2LUI A;  2E7K A;  3OU0 A;  4XHV A;  3KZD A;  3GGE A;  3WKM A;  2UZC A;  1UIT A;  1MC7 A;  1OZI A;  2MX6 A;  3HPK A;  1TP5 A;  2V90 A;  4Q2N A;  5HFB A;  1UEQ A;  3OTP A;  3DJ1 A;  1KEF A;  1N99 A;  2QKU A;  2M0Z A;  3QDO A;  2PKT A;  4JL7 A;  1WIF A;  4JOE A;  2AWW A;  4K76 A;  2EGK A;  4REY A;  2CSJ A;  5HFC A;  1UEP A;  2VSP A;  2EHR A;  4PQW A;  1W9Q A;  2PZD A;  1UM1 A;  1Q3P A;  2EJY A;  3VQG A;  2KJD A;  3KHF A;  2K1Z A;  1TP3 A;  2QKT A;  3EGG C;  1D5G A;  2M10 A;  4HOP B;  4K6Y A;  1X5Q A;  4HOP A;  5HFE A;  3TSV A;  5HED A;  3SOE A;  1WI4 A;  3CS0 A;  1RGR A;  1QLC A;  1X6D A;  3L4F D;  3GDS A;  2KJP A; 
#chains in the Genus database with same CATH topology
 3GAB A;  1WFV A;  3ID1 A;  2DLU A;  1N7T A;  3PDV A;  1RGW A;  1X5R A;  2KQF A;  2M0T A;  2KRG A;  5HFD A;  4OAJ A;  1WJL A;  2DLS A;  2KOM A;  2YTW A;  3KDK A;  1QAU A;  4WYU A;  1UF1 A;  2PKU A;  1UEZ A;  5E1Y A;  4E34 A;  2H2C A;  2H2B A;  1WHA A;  3NGH A;  3RL7 A;  2D92 A;  2D8I A;  3PDZ A;  5HF4 A;  4Q2Q A;  5FB8 C;  1N7E A;  1P1D A;  2JXO A;  4EDJ A;  1U39 A;  1KY9 A;  2AIN A;  2H3L A;  3GDU A;  3ID4 A;  1OBZ A;  2EDP A;  5A2P A;  2AWX A;  1UM7 A;  4P2A B;  3PV4 A;  3LNY A;  2JWE A;  1V6B A;  5G1E A;  4GHN A;  4UU6 A;  2EDV A;  3ID2 A;  2O2T A;  2Z9I A;  2QG1 A;  3E17 A;  2KA9 A;  2KOJ A;  1KWA A;  3NFL A;  1V62 A;  5HEY A;  3B76 A;  2FN5 A;  3EGH C;  3SFJ A;  1VCW A;  2JSN A;  1LCY A;  1U38 A;  3TSW A;  5F67 A;  5D13 A;  4Z33 A;  2QT5 A;  4NMR A;  2Z17 A;  3ID3 A;  2BYG A;  2FNE A;  5E22 A;  5HJ1 A;  2ZPM A;  2JIK A;  1WI2 A;  2FE5 A;  2QBW A;  2GEF A;  1VJ6 A;  4KFW A;  3SHU A;  2IWP A;  2KAW A;  3DOR A;  2W4F A;  2IWN A;  1UEW A;  2OPG A;  2JIL A;  2QKV A;  2JIN A;  3PV2 A;  4JOP A;  5GND A;  2I4S A;  2P3W A;  3QO6 A;  3CC0 A;  1K32 A;  2VWR A;  1TQ3 A;  1PDR A;  2EGO A;  1WF8 A;  4MPA A;  3R69 A;  2G5M B;  2YT7 A;  2JRE A;  2DJT A;  1W9E A;  1GM1 A;  3TMH A;  4NMQ A;  2ENO A;  2EAQ A;  1N6D A;  5HFF A;  1B8Q A;  1VAE A;  5EYZ A;  1NF3 C;  2W7R A;  1ZUB A;  3K82 A;  1UJV A;  2KJK A;  2JOA A;  3QIK A;  1UJU A;  2WL7 A;  3O46 A;  3DJ3 A;  3SUZ A;  5HDY A;  1Z87 A;  1N7F A;  3CBZ A;  3RL8 A;  1T2M A;  1I92 A;  4Q6H A;  2F0A A;  5I7Z A;  5F3X A;  4AMH A;  4JOG A;  2DAZ A;  2M0V A;  3GSL A;  4Q2O A;  5JXB A;  3QJM A;  2YT8 A;  1Y7N A;  2H3M A;  4F8K A;  1Q3O A;  4K78 A;  1NTE A;  2OMJ A;  5FHT A;  3FY5 A;  2DC2 A;  3QE1 A;  4G69 A;  1W9O A;  2RRM A;  4WYT A;  4NXQ A;  2YUB A;  2M3M A;  4GVC A;  4FLN A;  2L97 A;  4JOF A;  4YYX A;  2LC7 A;  1Z86 A;  2EEG A;  4E3B A;  5DTH A;  4OEP A;  4IC6 A;  2OZF A;  2OQS A;  1IU0 A;  2F5Y A;  1WH1 A;  2MHO A;  2OCS A;  3GCN A;  4JJ3 A;  4JOJ A;  1FC9 A;  2V1W A;  3VQF A;  4NXP A;  5IL9 A;  2LOB A;  4L8N A;  2GZV A;  1XZ9 A;  2X7Z A;  4UU5 A;  2D90 A;  4K75 A;  1R6J A;  2HE4 A;  2I0L A;  2EXG A;  4JOK A;  4NNL A;  1G9O A;  1TE0 A;  2EDZ A;  3LNX A;  4NNM A;  4RI0 A;  4YDP A;  5HF1 A;  3MH4 A;  1BE9 A;  1M5Z A;  3R0H A;  2KYL A;  1ZOK A;  2DB5 A;  2PNT A;  5E6P B;  2RCZ A;  2FCF A;  4Z8J A;  2HGA A;  3BPU A;  1MFG A;  2OGP A;  2KG2 A;  2VPH A;  1U3B A;  1MFL A;  4KFV A;  3CBX A;  5B6L A;  1L6O A;  1UFX A;  4O06 A;  5HEB A;  4Q3H A;  2VRF A;  2R4H A;  1FCF A;  2VZ5 A;  2L4S A;  2HE2 A;  3AXA A;  1N6F A;  2G2L A;  2EGN A;  3MH7 A;  4H11 A;  3CH8 A;  4Q6S A;  1V5Q A;  2PA1 A;  1RY4 A;  1X45 A;  1V5L A;  2CS5 A;  1FC7 A;  2KPL A;  1U37 A;  3STJ A;  1X8S A;  3RLE A;  4GVD A;  1GQ4 A;  3I18 A;  5B42 A;  2YUY A;  2KL1 A;  3CYY A;  3KZE A;  2KBS A;  2M0U A;  3PS4 A;  3DIW A;  4JOH A;  2L4T A;  2OSG A;  3QJN A;  4NXR A;  2Q9V A;  3HPM A;  4NMO A;  2DKR A;  2CSS A;  4NMS A;  1RZX A;  5EZ0 A;  3PV5 A;  2VSV A;  1X9Z A;  4R2Z A;  2EEJ A;  4FGM A;  2LC6 A;  2I6V A;  1I16 A;  3MH6 A;  5G1D A;  2OS6 A;  4JJ0 A;  2LA8 A;  5E11 A;  1P1E A;  3GDV A;  3KDG A;  1V1T A;  3SHW A;  1FC6 A;  1IHJ A;  1OBX A;  1VA8 A;  1BFE A;  1N6E A;  4N6X A;  5H3J A;  2ZPL A;  2Q3G A;  3CBY A;  3QGL A;  3DJA A;  4K72 A;  1IU2 A;  4OEO A;  2DM8 A;  3O5N A;  3R68 A;  3HVQ C;  4LMM A;  1WHD A;  4E35 A;  2R3Y A;  1UJD A;  5HET A;  3TSZ A;  3I1E A;  1WF7 A;  3WKL A;  4Q2P A;  1Q7X A;  3NFK A;  1Y8T A;  4JOR A;  4NMT A;  2IWQ A;  2EEI A;  2EV8 A;  3GCO A;  3GJ9 A;  3K50 A;  2I04 A;  1UHP A;  2K20 A;  1GQ5 A;  5ILB A;  2REY A;  1SOZ A;  4NMP A;  4NMV A;  2I0I A;  3ZRT A;  2KV8 A;  2EEH A;  1SOT A;  3K1R A;  4P0C A;  2AWU A;  5E21 A;  1WFG A;  1QAV B;  2KOH A;  2IWO A;  3I4W A;  1WG6 A;  1QAV A;  1OBY A;  2I1N A;  2KPK A;  3JXT A;  1X5N A;  2PDZ A;  5GLJ A;  1YBO A;  2DMZ A;  1VB7 A;  2LUI A;  2E7K A;  3OU0 A;  4XHV A;  3KZD A;  3GGE A;  3WKM A;  2UZC A;  3NCV A;  1UIT A;  1MC7 A;  1OZI A;  2MX6 A;  3HPK A;  1TP5 A;  2V90 A;  4Q2N A;  5HFB A;  1UEQ A;  3OTP A;  3DJ1 A;  1KEF A;  1N99 A;  2QKU A;  2M0Z A;  3QDO A;  2PKT A;  4JL7 A;  1WIF A;  4JOE A;  2AWW A;  4K76 A;  2EGK A;  4REY A;  2CSJ A;  5HFC A;  1UEP A;  2VSP A;  2EHR A;  4PQW A;  1W9Q A;  2PZD A;  1UM1 A;  1Q3P A;  2EJY A;  3VQG A;  2KJD A;  3KHF A;  2K1Z A;  1TP3 A;  2QKT A;  3EGG C;  1D5G A;  2M10 A;  4HOP B;  4K6Y A;  1X5Q A;  4HOP A;  5HFE A;  3TSV A;  5HED A;  3SOE A;  1WI4 A;  3CS0 A;  1RGR A;  1QLC A;  1X6D A;  3L4F D;  3GDS A;  2KJP A; 
#chains in the Genus database with same CATH homology
 3GAB A;  1WFV A;  3ID1 A;  2DLU A;  1N7T A;  3PDV A;  1RGW A;  1X5R A;  2KQF A;  2M0T A;  2KRG A;  5HFD A;  4OAJ A;  1WJL A;  2DLS A;  2KOM A;  2YTW A;  3KDK A;  1QAU A;  4WYU A;  1UF1 A;  2PKU A;  1UEZ A;  5E1Y A;  4E34 A;  2H2C A;  2H2B A;  1WHA A;  3NGH A;  3RL7 A;  2D92 A;  2D8I A;  3PDZ A;  5HF4 A;  4Q2Q A;  5FB8 C;  1N7E A;  1P1D A;  2JXO A;  4EDJ A;  1U39 A;  1KY9 A;  2AIN A;  2H3L A;  3GDU A;  3ID4 A;  1OBZ A;  2EDP A;  5A2P A;  2AWX A;  1UM7 A;  4P2A B;  3PV4 A;  3LNY A;  2JWE A;  1V6B A;  5G1E A;  4GHN A;  4UU6 A;  2EDV A;  3ID2 A;  2O2T A;  2Z9I A;  2QG1 A;  3E17 A;  2KA9 A;  2KOJ A;  1KWA A;  3NFL A;  1V62 A;  5HEY A;  3B76 A;  2FN5 A;  3EGH C;  3SFJ A;  1VCW A;  2JSN A;  1LCY A;  1U38 A;  3TSW A;  5F67 A;  5D13 A;  4Z33 A;  2QT5 A;  4NMR A;  2Z17 A;  3ID3 A;  2BYG A;  2FNE A;  5E22 A;  5HJ1 A;  2ZPM A;  2JIK A;  1WI2 A;  2FE5 A;  2QBW A;  2GEF A;  1VJ6 A;  4KFW A;  3SHU A;  2IWP A;  2KAW A;  3DOR A;  2W4F A;  2IWN A;  1UEW A;  2OPG A;  2JIL A;  2QKV A;  2JIN A;  3PV2 A;  4JOP A;  5GND A;  2I4S A;  2P3W A;  3QO6 A;  3CC0 A;  1K32 A;  2VWR A;  1TQ3 A;  1PDR A;  2EGO A;  1WF8 A;  4MPA A;  3R69 A;  2G5M B;  2YT7 A;  2JRE A;  2DJT A;  1W9E A;  1GM1 A;  3TMH A;  4NMQ A;  2ENO A;  2EAQ A;  1N6D A;  5HFF A;  1B8Q A;  1VAE A;  5EYZ A;  1NF3 C;  2W7R A;  1ZUB A;  3K82 A;  1UJV A;  2KJK A;  2JOA A;  3QIK A;  1UJU A;  2WL7 A;  3O46 A;  3DJ3 A;  3SUZ A;  5HDY A;  1Z87 A;  1N7F A;  3CBZ A;  3RL8 A;  1T2M A;  1I92 A;  4Q6H A;  2F0A A;  5I7Z A;  5F3X A;  4AMH A;  4JOG A;  2DAZ A;  2M0V A;  3GSL A;  4Q2O A;  5JXB A;  3QJM A;  2YT8 A;  1Y7N A;  2H3M A;  4F8K A;  1Q3O A;  4K78 A;  1NTE A;  2OMJ A;  5FHT A;  3FY5 A;  2DC2 A;  3QE1 A;  4G69 A;  1W9O A;  2RRM A;  4WYT A;  4NXQ A;  2YUB A;  2M3M A;  4GVC A;  4FLN A;  2L97 A;  4JOF A;  4YYX A;  2LC7 A;  1Z86 A;  2EEG A;  4E3B A;  5DTH A;  4OEP A;  4IC6 A;  2OZF A;  2OQS A;  1IU0 A;  2F5Y A;  1WH1 A;  2MHO A;  2OCS A;  3GCN A;  4JJ3 A;  4JOJ A;  1FC9 A;  2V1W A;  3VQF A;  4NXP A;  5IL9 A;  2LOB A;  4L8N A;  2GZV A;  1XZ9 A;  2X7Z A;  4UU5 A;  2D90 A;  4K75 A;  1R6J A;  2HE4 A;  2I0L A;  2EXG A;  4JOK A;  4NNL A;  1G9O A;  1TE0 A;  2EDZ A;  3LNX A;  4NNM A;  4RI0 A;  4YDP A;  5HF1 A;  3MH4 A;  1BE9 A;  1M5Z A;  3R0H A;  2KYL A;  1ZOK A;  2DB5 A;  2PNT A;  5E6P B;  2RCZ A;  2FCF A;  4Z8J A;  2HGA A;  3BPU A;  1MFG A;  2OGP A;  2KG2 A;  2VPH A;  1U3B A;  1MFL A;  4KFV A;  3CBX A;  5B6L A;  1L6O A;  1UFX A;  4O06 A;  5HEB A;  4Q3H A;  2VRF A;  2R4H A;  1FCF A;  2VZ5 A;  2L4S A;  2HE2 A;  3AXA A;  1N6F A;  2G2L A;  2EGN A;  3MH7 A;  4H11 A;  3CH8 A;  4Q6S A;  1V5Q A;  2PA1 A;  1RY4 A;  1X45 A;  1V5L A;  2CS5 A;  1FC7 A;  2KPL A;  1U37 A;  3STJ A;  1X8S A;  3RLE A;  4GVD A;  1GQ4 A;  3I18 A;  5B42 A;  2YUY A;  2KL1 A;  3CYY A;  3KZE A;  2KBS A;  2M0U A;  3PS4 A;  3DIW A;  4JOH A;  2L4T A;  2OSG A;  3QJN A;  4NXR A;  2Q9V A;  3HPM A;  4NMO A;  2DKR A;  2CSS A;  4NMS A;  1RZX A;  5EZ0 A;  3PV5 A;  2VSV A;  1X9Z A;  4R2Z A;  2EEJ A;  4FGM A;  2LC6 A;  2I6V A;  1I16 A;  3MH6 A;  5G1D A;  2OS6 A;  4JJ0 A;  2LA8 A;  5E11 A;  1P1E A;  3GDV A;  3KDG A;  1V1T A;  3SHW A;  1FC6 A;  1IHJ A;  1OBX A;  1VA8 A;  1BFE A;  1N6E A;  4N6X A;  5H3J A;  2ZPL A;  2Q3G A;  3CBY A;  3QGL A;  3DJA A;  4K72 A;  1IU2 A;  4OEO A;  2DM8 A;  3O5N A;  3R68 A;  3HVQ C;  4LMM A;  1WHD A;  4E35 A;  2R3Y A;  1UJD A;  5HET A;  3TSZ A;  3I1E A;  1WF7 A;  3WKL A;  4Q2P A;  1Q7X A;  3NFK A;  1Y8T A;  4JOR A;  4NMT A;  2IWQ A;  2EEI A;  2EV8 A;  3GCO A;  3GJ9 A;  3K50 A;  2I04 A;  1UHP A;  2K20 A;  1GQ5 A;  5ILB A;  2REY A;  1SOZ A;  4NMP A;  4NMV A;  2I0I A;  3ZRT A;  2KV8 A;  2EEH A;  1SOT A;  3K1R A;  4P0C A;  2AWU A;  5E21 A;  1WFG A;  1QAV B;  2KOH A;  2IWO A;  3I4W A;  1WG6 A;  1QAV A;  1OBY A;  2I1N A;  2KPK A;  3JXT A;  1X5N A;  2PDZ A;  5GLJ A;  1YBO A;  2DMZ A;  1VB7 A;  2LUI A;  2E7K A;  3OU0 A;  4XHV A;  3KZD A;  3GGE A;  3WKM A;  2UZC A;  3NCV A;  1UIT A;  1MC7 A;  1OZI A;  2MX6 A;  3HPK A;  1TP5 A;  2V90 A;  4Q2N A;  5HFB A;  1UEQ A;  3OTP A;  3DJ1 A;  1KEF A;  1N99 A;  2QKU A;  2M0Z A;  3QDO A;  2PKT A;  4JL7 A;  1WIF A;  4JOE A;  2AWW A;  4K76 A;  2EGK A;  4REY A;  2CSJ A;  5HFC A;  1UEP A;  2VSP A;  2EHR A;  4PQW A;  1W9Q A;  2PZD A;  1UM1 A;  1Q3P A;  2EJY A;  3VQG A;  2KJD A;  3KHF A;  2K1Z A;  1TP3 A;  2QKT A;  3EGG C;  1D5G A;  2M10 A;  4HOP B;  4K6Y A;  1X5Q A;  4HOP A;  5HFE A;  3TSV A;  5HED A;  3SOE A;  1WI4 A;  3CS0 A;  1RGR A;  1QLC A;  1X6D A;  3L4F D;  3GDS A;  2KJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...