1I92A

Structural basis of the nherf pdz1-cftr interaction
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPEQDTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NA+/H+ EXCHANGE REGULATORY CO-FACTOR
publication title Structural basis of the Na+/H+ exchanger regulatory factor PDZ1 interaction with the carboxyl-terminal region of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1i92A00
1Q3OA 1WJLA 1SOZA 2KJKA 2H3MA 3PS4A 4PQWA 3PDVA 1N7TA 5E6PB 4YYXA 3SOEA 1OBXA 2KOHA 5H3JA 2Q3GA 3QDOA 4JOPA 2D8IA 3DIWA 4NXQA 1WIFA 3QE1A 4FGMA 4NMRA 2CSSA 4NMSA 2W4FA 4Q2PA 1G9OA 2I04A 4F8KA 3RL7A 2CS5A 3ZRTA 1WHAA 4WYUA 3KHFA 2BYGA 2AWXA 1NTEA 2KL1A 2DAZA 3HVQC 1N6FA 2EGNA 2M0ZA 3VQFA 3CYYA 1FC6A 2FN5A 4Q6HA 3GDVA 1UEZA 3ID1A 1N6DA 2F5YA 1KY9A 3MH7A 4E3BA 2WL7A 3SHUA 4NMVA 3PV2A 2REYA 4JOJA 3E17A 1Q3PA 3R68A 4E35A 2EGOA 3BPUA 5A2PA 1X5NA 2L4SA 5FB8C 2EEHA 2ZPLA 4N6XA 3K82A 4LMMA 1VAEA 1MFGA 3HPKA 4JOHA 2K20A 2KV8A 5DTHA 2D92A 2JOAA 2EJYA 1KWAA 5HFBA 2KPLA 5HF1A 2EDPA 5E22A 2VWRA 1X8SA 2Z17A 2QBWA 1V5LA 4R2ZA 2GZVA 3EGGC 4AMHA 2QKUA 3DJAA 2OPGA 2OMJA 3R69A 2CSJA 5E21A 5G1DA 4UU6A 2KPKA 3GGEA 2EAQA 1W9EA 3MH6A 2JXOA 1RGRA 5JXBA 3SHWA 3STJA 5HFFA 2ENOA 1M5ZA 2KQFA 2VSVA 5EZ0A 3GDUA 4JOFA 3NGHA 1N6EA 3SFJA 3QJNA 1U39A 2DKRA 2HE4A 3VQGA 3O5NA 2UZCA 4JOEA 2V1WA 1B8QA 1UF1A 2E7KA 5G1EA 2OQSA 2VRFA 3WKMA 2I4SA 1WG6A 5HFEA 1V1TA 2M10A 3NFLA 5HFDA 3L4FD 1YBOA 1UEQA 1KEFA 5HEYA 3PV5A 2X7ZA 1W9QA 3CBZA 3CS0A 3K1RA 5E1YA 2MX6A 5HJ1A 2AINA 2R4HA 3I1EA 1X5QA 1RY4A 3ID2A 3QIKA 2KOJA 2M0UA 1UEWA 1FCFA 3DJ1A 2PNTA 2KJPA 1XZ9A 2D90A 3QJMA 2EEIA 3KZDA 2G2LA 1N7FA 4OEPA 2RCZA 4WYTA 1I92A 2DLUA 2JIKA 4JL7A 3KZEA 1UJDA 2PA1A 3GCNA 4GVCA 2IWNA 4K72A 3CBXA 1UEPA 4P0CA 3MH4A 2AWUA 1U38A 2H2BA 2DB5A 3ID3A 2VSPA 1TQ3A 1OBYA 3CH8A 2I0LA 3I4WA 3GDSA 1MFLA 2M3MA 4H11A 1VA8A 1UM7A 2JINA 2YUYA 4GVDA 4JOGA 2I0IA 2EEGA 3LNYA 1RGWA 1VB7A 2VPHA 5I7ZA 2DLSA 2QKVA 1RZXA 2EEJA 2KG2A 2LUIA 5HDYA 1IHJA 2Z9IA 1WHDA 1V62A 5HFCA 2AWWA 2FNEA 5F3XA 1QAVB 2YUBA 2KYLA 1UJUA 1ZOKA 4Z8JA 3FY5A 1N99A 2JREA 2EV8A 4Z33A 3NFKA 2LA8A 2MHOA 1UM1A 1T2MA 1D5GA 3SUZA 2EHRA 4YDPA 5FHTA 4E34A 2PKUA 1OBZA 2R3YA 3B76A 1QAUA 1LCYA 1GQ5A 2DM8A 2KJDA 2EXGA 5GLJA 1QLCA 5GNDA 4HOPB 4OAJA 2KAWA 4K6YA 1VJ6A 3DJ3A 4GHNA 3TMHA 1NF3C 1IU0A 2YT8A 3JXTA 2ZPMA 4OEOA 4IC6A 2OS6A 2FCFA 2JILA 3PDZA 5HEDA 4Q2NA 2LC6A 2PDZA 2VZ5A 3RLEA 2QT5A 3TSZA 1GQ4A 3QO6A 4KFVA 5F67A 4NMPA 4G69A 2OCSA 3OTPA 2HE2A 1V5QA 2QG1A 5EYZA 1WF8A 1I16A 3TSVA 3QGLA 2PZDA 2P3WA 3GCOA 4NXPA 3WKLA 4Q2QA 2EDVA 5E11A 2OSGA 4MPAA 2H3LA 2M0VA 5HETA 4P2AB 4NMTA 3I18A 4Q3HA 4REYA 1Y8TA 1ZUBA 1WH1A 1OZIA 4JORA 1FC7A 5D13A 2FE5A 1FC9A 1SOTA 2I1NA 4L8NA 1TE0A 4NXRA 2LC7A 3GJ9A 3AXAA 2DC2A 1Q7XA 1W9OA 2KA9A 2OZFA 2PKTA 2KRGA 1U37A 5HF4A 4NNLA 1GM1A 2I6VA 4EDJA 4K78A 3RL8A 1TP3A 1WFVA 2OGPA 1Z86A 1UITA 2RRMA 1UHPA 2L4TA 1IU2A 2IWPA 4NNMA 2IWOA 1Y7NA 1TP5A 2DMZA 3HPMA 1MC7A 2O2TA 2LOBA 1UFXA 2L97A 2HGAA 1X6DA 2K1ZA 1X5RA 4NMQA 3PV4A 1U3BA 1BFEA 2IWQA 4JOKA 1QAVA 3EGHC 2Q9VA 4KFWA 4K75A 2YTWA 1BE9A 4Q2OA 4K76A 1N7EA 3TSWA 3DORA 3O46A 1X45A 4XHVA 5HEBA 1UJVA 2YT7A 2G5MB 1PDRA 2DJTA 3CBYA 1Z87A 4NMOA 2H2CA 2KOMA 4Q6SA 1K32A 1WI2A 2EDZA 4HOPA 4RI0A 3OU0A 2W7RA 2F0AA 2JWEA 4UU5A 1P1EA 3R0HA 2EGKA 1VCWA 2V90A 5B6LA 2KBSA 1P1DA 3ID4A 1V6BA 3CC0A 2QKTA 4O06A 2M0TA 1L6OA 1WFGA 3GSLA 3K50A 1WF7A 1R6JA 1WI4A 3LNXA
chains in the Genus database with same CATH superfamily
1Q3OA 1WJLA 1SOZA 2KJKA 2H3MA 3PS4A 4PQWA 3PDVA 1N7TA 5E6PB 4YYXA 3SOEA 1OBXA 2KOHA 5H3JA 2Q3GA 3QDOA 4JOPA 2D8IA 3DIWA 4NXQA 1WIFA 3QE1A 4FGMA 4NMRA 2CSSA 4NMSA 2W4FA 4Q2PA 1G9OA 2I04A 4F8KA 3RL7A 2CS5A 3ZRTA 1WHAA 4WYUA 3KHFA 2BYGA 2AWXA 1NTEA 2KL1A 5B42A 2DAZA 3HVQC 1N6FA 2EGNA 2M0ZA 3VQFA 3CYYA 1FC6A 2FN5A 4Q6HA 3GDVA 1UEZA 3ID1A 1N6DA 2F5YA 1KY9A 3MH7A 4E3BA 2WL7A 3SHUA 4NMVA 3PV2A 2REYA 4JOJA 3E17A 3GABA 1Q3PA 3R68A 4E35A 2EGOA 3BPUA 5A2PA 1X5NA 2L4SA 5FB8C 2EEHA 2ZPLA 4N6XA 3K82A 4LMMA 1VAEA 1MFGA 3HPKA 4JOHA 2K20A 2KV8A 5DTHA 2D92A 2JOAA 2EJYA 1KWAA 5HFBA 2KPLA 5HF1A 2EDPA 5E22A 2VWRA 1X8SA 2Z17A 2QBWA 1V5LA 4R2ZA 2GZVA 3EGGC 4AMHA 2QKUA 3DJAA 2OPGA 2OMJA 3R69A 2CSJA 5E21A 5G1DA 4UU6A 2KPKA 3GGEA 2EAQA 1W9EA 3MH6A 2JXOA 1RGRA 5JXBA 3SHWA 3STJA 5HFFA 2ENOA 1M5ZA 2KQFA 2VSVA 5EZ0A 3GDUA 4JOFA 3NGHA 1N6EA 3SFJA 3QJNA 1U39A 2DKRA 2HE4A 3VQGA 3O5NA 2UZCA 4JOEA 2V1WA 1B8QA 1UF1A 2E7KA 5G1EA 2OQSA 2VRFA 3WKMA 2I4SA 1WG6A 5HFEA 1V1TA 2M10A 3NFLA 5HFDA 3L4FD 1YBOA 1UEQA 1KEFA 5HEYA 3PV5A 2X7ZA 1W9QA 3CBZA 3CS0A 3K1RA 5E1YA 2MX6A 5HJ1A 2AINA 2R4HA 3I1EA 1X5QA 1RY4A 3ID2A 3QIKA 2KOJA 2M0UA 1UEWA 1FCFA 3DJ1A 2PNTA 2KJPA 1XZ9A 2D90A 3QJMA 2EEIA 3KZDA 2G2LA 1N7FA 4OEPA 2RCZA 4WYTA 1I92A 2DLUA 2JIKA 4JL7A 3KZEA 1UJDA 2PA1A 3GCNA 4GVCA 2IWNA 4K72A 3CBXA 1UEPA 4P0CA 3MH4A 2AWUA 1U38A 2H2BA 2DB5A 3ID3A 2VSPA 1TQ3A 1OBYA 3CH8A 2I0LA 3I4WA 3GDSA 2JSNA 1MFLA 2M3MA 4H11A 1VA8A 1UM7A 2JINA 2YUYA 4GVDA 4JOGA 2I0IA 2EEGA 3LNYA 1RGWA 1VB7A 2VPHA 5I7ZA 2DLSA 2QKVA 1RZXA 2EEJA 2KG2A 2LUIA 5HDYA 5ILBA 1IHJA 2Z9IA 1WHDA 1V62A 5HFCA 2AWWA 2FNEA 5F3XA 1QAVB 2YUBA 2KYLA 1UJUA 1ZOKA 4Z8JA 3FY5A 1N99A 4JJ3A 2JREA 2EV8A 4Z33A 3NFKA 2LA8A 2MHOA 1UM1A 1T2MA 1D5GA 3SUZA 2EHRA 4YDPA 5FHTA 4E34A 2PKUA 1OBZA 2R3YA 3B76A 3KDKA 1QAUA 1LCYA 1GQ5A 2DM8A 2KJDA 2EXGA 5GLJA 1QLCA 5GNDA 4HOPB 4OAJA 2KAWA 4K6YA 1VJ6A 3DJ3A 4GHNA 3TMHA 1NF3C 4FLNA 1IU0A 2YT8A 3JXTA 2ZPMA 4OEOA 4IC6A 2OS6A 3KDGA 2FCFA 2JILA 3PDZA 5HEDA 4Q2NA 2LC6A 2PDZA 2VZ5A 3RLEA 2QT5A 3TSZA 1GQ4A 3QO6A 4KFVA 5F67A 4NMPA 4G69A 2OCSA 3OTPA 2HE2A 1V5QA 2QG1A 5EYZA 1WF8A 1I16A 3TSVA 3QGLA 2PZDA 5IL9A 2P3WA 1X9ZA 3GCOA 4NXPA 3WKLA 4Q2QA 2EDVA 5E11A 2OSGA 4MPAA 4JJ0A 2H3LA 2M0VA 5HETA 4P2AB 4NMTA 3I18A 4Q3HA 4REYA 1Y8TA 1ZUBA 1WH1A 1OZIA 4JORA 1FC7A 5D13A 2FE5A 1FC9A 1SOTA 2I1NA 4L8NA 1TE0A 4NXRA 2LC7A 3GJ9A 3AXAA 2DC2A 1Q7XA 1W9OA 2KA9A 2OZFA 2PKTA 2KRGA 1U37A 5HF4A 4NNLA 1GM1A 2I6VA 4EDJA 3NCVA 4K78A 3RL8A 1TP3A 1WFVA 2OGPA 1Z86A 1UITA 2RRMA 1UHPA 2L4TA 1IU2A 2IWPA 4NNMA 2IWOA 1Y7NA 1TP5A 2DMZA 3HPMA 1MC7A 2O2TA 2LOBA 1UFXA 2L97A 2HGAA 1X6DA 2K1ZA 1X5RA 4NMQA 3PV4A 1U3BA 1BFEA 2IWQA 4JOKA 1QAVA 3EGHC 2Q9VA 4KFWA 4K75A 2YTWA 1BE9A 4Q2OA 4K76A 1N7EA 3TSWA 3DORA 3O46A 1X45A 4XHVA 5HEBA 1UJVA 2YT7A 2G5MB 1PDRA 2DJTA 3CBYA 1Z87A 2GEFA 4NMOA 2H2CA 2KOMA 4Q6SA 1K32A 1WI2A 2EDZA 4HOPA 4RI0A 3OU0A 2W7RA 2F0AA 2JWEA 4UU5A 1P1EA 3R0HA 2EGKA 1VCWA 2V90A 5B6LA 2KBSA 1P1DA 3ID4A 1V6BA 3CC0A 2QKTA 4O06A 2M0TA 1L6OA 1WFGA 3GSLA 3K50A 1WF7A 1R6JA 1WI4A 3LNXA
chains in the Genus database with same CATH topology
1Q3OA 1WJLA 1SOZA 2KJKA 2H3MA 3PS4A 4PQWA 3PDVA 1N7TA 5E6PB 4YYXA 3SOEA 1OBXA 2KOHA 5H3JA 2Q3GA 3QDOA 4JOPA 2D8IA 3DIWA 4NXQA 1WIFA 3QE1A 4FGMA 4NMRA 2CSSA 4NMSA 2W4FA 4Q2PA 1G9OA 2I04A 4F8KA 3RL7A 2CS5A 3ZRTA 1WHAA 4WYUA 3KHFA 2BYGA 2AWXA 1NTEA 2KL1A 5B42A 2DAZA 3HVQC 1N6FA 2EGNA 2M0ZA 3VQFA 3CYYA 1FC6A 2FN5A 4Q6HA 3GDVA 1UEZA 3ID1A 1N6DA 2F5YA 1KY9A 3MH7A 4E3BA 2WL7A 3SHUA 4NMVA 3PV2A 2REYA 4JOJA 3E17A 3GABA 1Q3PA 3R68A 4E35A 2EGOA 3BPUA 5A2PA 1X5NA 2L4SA 5FB8C 2EEHA 2ZPLA 4N6XA 3K82A 4LMMA 1VAEA 1MFGA 3HPKA 4JOHA 2K20A 2KV8A 5DTHA 2D92A 2JOAA 2EJYA 1KWAA 5HFBA 2KPLA 5HF1A 2EDPA 5E22A 2VWRA 1X8SA 2Z17A 2QBWA 1V5LA 4R2ZA 2GZVA 3EGGC 4AMHA 2QKUA 3DJAA 2OPGA 2OMJA 3R69A 2CSJA 5E21A 5G1DA 4UU6A 2KPKA 3GGEA 2EAQA 1W9EA 3MH6A 2JXOA 1RGRA 5JXBA 3SHWA 3STJA 5HFFA 2ENOA 1M5ZA 2KQFA 2VSVA 5EZ0A 3GDUA 4JOFA 3NGHA 1N6EA 3SFJA 3QJNA 1U39A 2DKRA 2HE4A 3VQGA 3O5NA 2UZCA 4JOEA 2V1WA 1B8QA 1UF1A 2E7KA 5G1EA 2OQSA 2VRFA 3WKMA 2I4SA 1WG6A 5HFEA 1V1TA 2M10A 3NFLA 5HFDA 3L4FD 1YBOA 1UEQA 1KEFA 5HEYA 3PV5A 2X7ZA 1W9QA 3CBZA 3CS0A 3K1RA 5E1YA 2MX6A 5HJ1A 2AINA 2R4HA 3I1EA 1X5QA 1RY4A 3ID2A 3QIKA 2KOJA 2M0UA 1UEWA 1FCFA 3DJ1A 2PNTA 2KJPA 1XZ9A 2D90A 3QJMA 2EEIA 3KZDA 2G2LA 1N7FA 4OEPA 2RCZA 4WYTA 1I92A 2DLUA 2JIKA 4JL7A 3KZEA 1UJDA 2PA1A 3GCNA 4GVCA 2IWNA 4K72A 3CBXA 1UEPA 4P0CA 3MH4A 2AWUA 1U38A 2H2BA 2DB5A 3ID3A 2VSPA 1TQ3A 1OBYA 3CH8A 2I0LA 3I4WA 3GDSA 2JSNA 1MFLA 2M3MA 4H11A 1VA8A 1UM7A 2JINA 2YUYA 4GVDA 4JOGA 2I0IA 2EEGA 3LNYA 1RGWA 1VB7A 2VPHA 5I7ZA 2DLSA 2QKVA 1RZXA 2EEJA 2KG2A 2LUIA 5HDYA 5ILBA 1IHJA 2Z9IA 1WHDA 1V62A 5HFCA 2AWWA 2FNEA 5F3XA 1QAVB 2YUBA 2KYLA 1UJUA 1ZOKA 4Z8JA 3FY5A 1N99A 4JJ3A 2JREA 2EV8A 4Z33A 3NFKA 2LA8A 2MHOA 1UM1A 1T2MA 1D5GA 3SUZA 2EHRA 4YDPA 5FHTA 4E34A 2PKUA 1OBZA 2R3YA 3B76A 3KDKA 1QAUA 1LCYA 1GQ5A 2DM8A 2KJDA 2EXGA 5GLJA 1QLCA 5GNDA 4HOPB 4OAJA 2KAWA 4K6YA 1VJ6A 3DJ3A 4GHNA 3TMHA 1NF3C 4FLNA 1IU0A 2YT8A 3JXTA 2ZPMA 4OEOA 4IC6A 2OS6A 3KDGA 2FCFA 2JILA 3PDZA 5HEDA 4Q2NA 2LC6A 2PDZA 2VZ5A 3RLEA 2QT5A 3TSZA 1GQ4A 3QO6A 4KFVA 5F67A 4NMPA 4G69A 2OCSA 3OTPA 2HE2A 1V5QA 2QG1A 5EYZA 1WF8A 1I16A 3TSVA 3QGLA 2PZDA 5IL9A 2P3WA 1X9ZA 3GCOA 4NXPA 3WKLA 4Q2QA 2EDVA 5E11A 2OSGA 4MPAA 4JJ0A 2H3LA 2M0VA 5HETA 4P2AB 4NMTA 3I18A 4Q3HA 4REYA 1Y8TA 1ZUBA 1WH1A 1OZIA 4JORA 1FC7A 5D13A 2FE5A 1FC9A 1SOTA 2I1NA 4L8NA 1TE0A 4NXRA 2LC7A 3GJ9A 3AXAA 2DC2A 1Q7XA 1W9OA 2KA9A 2OZFA 2PKTA 2KRGA 1U37A 5HF4A 4NNLA 1GM1A 2I6VA 4EDJA 3NCVA 4K78A 3RL8A 1TP3A 1WFVA 2OGPA 1Z86A 1UITA 2RRMA 1UHPA 2L4TA 1IU2A 2IWPA 4NNMA 2IWOA 1Y7NA 1TP5A 2DMZA 3HPMA 1MC7A 2O2TA 2LOBA 1UFXA 2L97A 2HGAA 1X6DA 2K1ZA 1X5RA 4NMQA 3PV4A 1U3BA 1BFEA 2IWQA 4JOKA 1QAVA 3EGHC 2Q9VA 4KFWA 4K75A 2YTWA 1BE9A 4Q2OA 4K76A 1N7EA 3TSWA 3DORA 3O46A 1X45A 4XHVA 5HEBA 1UJVA 2YT7A 2G5MB 1PDRA 2DJTA 3CBYA 1Z87A 2GEFA 4NMOA 2H2CA 2KOMA 4Q6SA 1K32A 1WI2A 2EDZA 4HOPA 4RI0A 3OU0A 2W7RA 2F0AA 2JWEA 4UU5A 1P1EA 3R0HA 2EGKA 1VCWA 2V90A 5B6LA 2KBSA 1P1DA 3ID4A 1V6BA 3CC0A 2QKTA 4O06A 2M0TA 1L6OA 1WFGA 3GSLA 3K50A 1WF7A 1R6JA 1WI4A 3LNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3O A;  1WJL A;  1SOZ A;  2KJK A;  2H3M A;  3PS4 A;  4PQW A;  3PDV A;  1N7T A;  5E6P B;  4YYX A;  3SOE A;  1OBX A;  2KOH A;  5H3J A;  2Q3G A;  3QDO A;  4JOP A;  2D8I A;  3DIW A;  4NXQ A;  1WIF A;  3QE1 A;  4FGM A;  4NMR A;  2CSS A;  4NMS A;  2W4F A;  4Q2P A;  1G9O A;  2I04 A;  4F8K A;  3RL7 A;  2CS5 A;  3ZRT A;  1WHA A;  4WYU A;  3KHF A;  2BYG A;  2AWX A;  1NTE A;  2KL1 A;  2DAZ A;  3HVQ C;  1N6F A;  2EGN A;  2M0Z A;  3VQF A;  3CYY A;  1FC6 A;  2FN5 A;  4Q6H A;  3GDV A;  1UEZ A;  3ID1 A;  1N6D A;  2F5Y A;  1KY9 A;  3MH7 A;  4E3B A;  2WL7 A;  3SHU A;  4NMV A;  3PV2 A;  2REY A;  4JOJ A;  3E17 A;  1Q3P A;  3R68 A;  4E35 A;  2EGO A;  3BPU A;  5A2P A;  1X5N A;  2L4S A;  5FB8 C;  2EEH A;  2ZPL A;  4N6X A;  3K82 A;  4LMM A;  1VAE A;  1MFG A;  3HPK A;  4JOH A;  2K20 A;  2KV8 A;  5DTH A;  2D92 A;  2JOA A;  2EJY A;  1KWA A;  5HFB A;  2KPL A;  5HF1 A;  2EDP A;  5E22 A;  2VWR A;  1X8S A;  2Z17 A;  2QBW A;  1V5L A;  4R2Z A;  2GZV A;  3EGG C;  4AMH A;  2QKU A;  3DJA A;  2OPG A;  2OMJ A;  3R69 A;  2CSJ A;  5E21 A;  5G1D A;  4UU6 A;  2KPK A;  3GGE A;  2EAQ A;  1W9E A;  3MH6 A;  2JXO A;  1RGR A;  5JXB A;  3SHW A;  3STJ A;  5HFF A;  2ENO A;  1M5Z A;  2KQF A;  2VSV A;  5EZ0 A;  3GDU A;  4JOF A;  3NGH A;  1N6E A;  3SFJ A;  3QJN A;  1U39 A;  2DKR A;  2HE4 A;  3VQG A;  3O5N A;  2UZC A;  4JOE A;  2V1W A;  1B8Q A;  1UF1 A;  2E7K A;  5G1E A;  2OQS A;  2VRF A;  3WKM A;  2I4S A;  1WG6 A;  5HFE A;  1V1T A;  2M10 A;  3NFL A;  5HFD A;  3L4F D;  1YBO A;  1UEQ A;  1KEF A;  5HEY A;  3PV5 A;  2X7Z A;  1W9Q A;  3CBZ A;  3CS0 A;  3K1R A;  5E1Y A;  2MX6 A;  5HJ1 A;  2AIN A;  2R4H A;  3I1E A;  1X5Q A;  1RY4 A;  3ID2 A;  3QIK A;  2KOJ A;  2M0U A;  1UEW A;  1FCF A;  3DJ1 A;  2PNT A;  2KJP A;  1XZ9 A;  2D90 A;  3QJM A;  2EEI A;  3KZD A;  2G2L A;  1N7F A;  4OEP A;  2RCZ A;  4WYT A;  1I92 A;  2DLU A;  2JIK A;  4JL7 A;  3KZE A;  1UJD A;  2PA1 A;  3GCN A;  4GVC A;  2IWN A;  4K72 A;  3CBX A;  1UEP A;  4P0C A;  3MH4 A;  2AWU A;  1U38 A;  2H2B A;  2DB5 A;  3ID3 A;  2VSP A;  1TQ3 A;  1OBY A;  3CH8 A;  2I0L A;  3I4W A;  3GDS A;  1MFL A;  2M3M A;  4H11 A;  1VA8 A;  1UM7 A;  2JIN A;  2YUY A;  4GVD A;  4JOG A;  2I0I A;  2EEG A;  3LNY A;  1RGW A;  1VB7 A;  2VPH A;  5I7Z A;  2DLS A;  2QKV A;  1RZX A;  2EEJ A;  2KG2 A;  2LUI A;  5HDY A;  1IHJ A;  2Z9I A;  1WHD A;  1V62 A;  5HFC A;  2AWW A;  2FNE A;  5F3X A;  1QAV B;  2YUB A;  2KYL A;  1UJU A;  1ZOK A;  4Z8J A;  3FY5 A;  1N99 A;  2JRE A;  2EV8 A;  4Z33 A;  3NFK A;  2LA8 A;  2MHO A;  1UM1 A;  1T2M A;  1D5G A;  3SUZ A;  2EHR A;  4YDP A;  5FHT A;  4E34 A;  2PKU A;  1OBZ A;  2R3Y A;  3B76 A;  1QAU A;  1LCY A;  1GQ5 A;  2DM8 A;  2KJD A;  2EXG A;  5GLJ A;  1QLC A;  5GND A;  4HOP B;  4OAJ A;  2KAW A;  4K6Y A;  1VJ6 A;  3DJ3 A;  4GHN A;  3TMH A;  1NF3 C;  1IU0 A;  2YT8 A;  3JXT A;  2ZPM A;  4OEO A;  4IC6 A;  2OS6 A;  2FCF A;  2JIL A;  3PDZ A;  5HED A;  4Q2N A;  2LC6 A;  2PDZ A;  2VZ5 A;  3RLE A;  2QT5 A;  3TSZ A;  1GQ4 A;  3QO6 A;  4KFV A;  5F67 A;  4NMP A;  4G69 A;  2OCS A;  3OTP A;  2HE2 A;  1V5Q A;  2QG1 A;  5EYZ A;  1WF8 A;  1I16 A;  3TSV A;  3QGL A;  2PZD A;  2P3W A;  3GCO A;  4NXP A;  3WKL A;  4Q2Q A;  2EDV A;  5E11 A;  2OSG A;  4MPA A;  2H3L A;  2M0V A;  5HET A;  4P2A B;  4NMT A;  3I18 A;  4Q3H A;  4REY A;  1Y8T A;  1ZUB A;  1WH1 A;  1OZI A;  4JOR A;  1FC7 A;  5D13 A;  2FE5 A;  1FC9 A;  1SOT A;  2I1N A;  4L8N A;  1TE0 A;  4NXR A;  2LC7 A;  3GJ9 A;  3AXA A;  2DC2 A;  1Q7X A;  1W9O A;  2KA9 A;  2OZF A;  2PKT A;  2KRG A;  1U37 A;  5HF4 A;  4NNL A;  1GM1 A;  2I6V A;  4EDJ A;  4K78 A;  3RL8 A;  1TP3 A;  1WFV A;  2OGP A;  1Z86 A;  1UIT A;  2RRM A;  1UHP A;  2L4T A;  1IU2 A;  2IWP A;  4NNM A;  2IWO A;  1Y7N A;  1TP5 A;  2DMZ A;  3HPM A;  1MC7 A;  2O2T A;  2LOB A;  1UFX A;  2L97 A;  2HGA A;  1X6D A;  2K1Z A;  1X5R A;  4NMQ A;  3PV4 A;  1U3B A;  1BFE A;  2IWQ A;  4JOK A;  1QAV A;  3EGH C;  2Q9V A;  4KFW A;  4K75 A;  2YTW A;  1BE9 A;  4Q2O A;  4K76 A;  1N7E A;  3TSW A;  3DOR A;  3O46 A;  1X45 A;  4XHV A;  5HEB A;  1UJV A;  2YT7 A;  2G5M B;  1PDR A;  2DJT A;  3CBY A;  1Z87 A;  4NMO A;  2H2C A;  2KOM A;  4Q6S A;  1K32 A;  1WI2 A;  2EDZ A;  4HOP A;  4RI0 A;  3OU0 A;  2W7R A;  2F0A A;  2JWE A;  4UU5 A;  1P1E A;  3R0H A;  2EGK A;  1VCW A;  2V90 A;  5B6L A;  2KBS A;  1P1D A;  3ID4 A;  1V6B A;  3CC0 A;  2QKT A;  4O06 A;  2M0T A;  1L6O A;  1WFG A;  3GSL A;  3K50 A;  1WF7 A;  1R6J A;  1WI4 A;  3LNX A; 
#chains in the Genus database with same CATH topology
 1Q3O A;  1WJL A;  1SOZ A;  2KJK A;  2H3M A;  3PS4 A;  4PQW A;  3PDV A;  1N7T A;  5E6P B;  4YYX A;  3SOE A;  1OBX A;  2KOH A;  5H3J A;  2Q3G A;  3QDO A;  4JOP A;  2D8I A;  3DIW A;  4NXQ A;  1WIF A;  3QE1 A;  4FGM A;  4NMR A;  2CSS A;  4NMS A;  2W4F A;  4Q2P A;  1G9O A;  2I04 A;  4F8K A;  3RL7 A;  2CS5 A;  3ZRT A;  1WHA A;  4WYU A;  3KHF A;  2BYG A;  2AWX A;  1NTE A;  2KL1 A;  5B42 A;  2DAZ A;  3HVQ C;  1N6F A;  2EGN A;  2M0Z A;  3VQF A;  3CYY A;  1FC6 A;  2FN5 A;  4Q6H A;  3GDV A;  1UEZ A;  3ID1 A;  1N6D A;  2F5Y A;  1KY9 A;  3MH7 A;  4E3B A;  2WL7 A;  3SHU A;  4NMV A;  3PV2 A;  2REY A;  4JOJ A;  3E17 A;  3GAB A;  1Q3P A;  3R68 A;  4E35 A;  2EGO A;  3BPU A;  5A2P A;  1X5N A;  2L4S A;  5FB8 C;  2EEH A;  2ZPL A;  4N6X A;  3K82 A;  4LMM A;  1VAE A;  1MFG A;  3HPK A;  4JOH A;  2K20 A;  2KV8 A;  5DTH A;  2D92 A;  2JOA A;  2EJY A;  1KWA A;  5HFB A;  2KPL A;  5HF1 A;  2EDP A;  5E22 A;  2VWR A;  1X8S A;  2Z17 A;  2QBW A;  1V5L A;  4R2Z A;  2GZV A;  3EGG C;  4AMH A;  2QKU A;  3DJA A;  2OPG A;  2OMJ A;  3R69 A;  2CSJ A;  5E21 A;  5G1D A;  4UU6 A;  2KPK A;  3GGE A;  2EAQ A;  1W9E A;  3MH6 A;  2JXO A;  1RGR A;  5JXB A;  3SHW A;  3STJ A;  5HFF A;  2ENO A;  1M5Z A;  2KQF A;  2VSV A;  5EZ0 A;  3GDU A;  4JOF A;  3NGH A;  1N6E A;  3SFJ A;  3QJN A;  1U39 A;  2DKR A;  2HE4 A;  3VQG A;  3O5N A;  2UZC A;  4JOE A;  2V1W A;  1B8Q A;  1UF1 A;  2E7K A;  5G1E A;  2OQS A;  2VRF A;  3WKM A;  2I4S A;  1WG6 A;  5HFE A;  1V1T A;  2M10 A;  3NFL A;  5HFD A;  3L4F D;  1YBO A;  1UEQ A;  1KEF A;  5HEY A;  3PV5 A;  2X7Z A;  1W9Q A;  3CBZ A;  3CS0 A;  3K1R A;  5E1Y A;  2MX6 A;  5HJ1 A;  2AIN A;  2R4H A;  3I1E A;  1X5Q A;  1RY4 A;  3ID2 A;  3QIK A;  2KOJ A;  2M0U A;  1UEW A;  1FCF A;  3DJ1 A;  2PNT A;  2KJP A;  1XZ9 A;  2D90 A;  3QJM A;  2EEI A;  3KZD A;  2G2L A;  1N7F A;  4OEP A;  2RCZ A;  4WYT A;  1I92 A;  2DLU A;  2JIK A;  4JL7 A;  3KZE A;  1UJD A;  2PA1 A;  3GCN A;  4GVC A;  2IWN A;  4K72 A;  3CBX A;  1UEP A;  4P0C A;  3MH4 A;  2AWU A;  1U38 A;  2H2B A;  2DB5 A;  3ID3 A;  2VSP A;  1TQ3 A;  1OBY A;  3CH8 A;  2I0L A;  3I4W A;  3GDS A;  2JSN A;  1MFL A;  2M3M A;  4H11 A;  1VA8 A;  1UM7 A;  2JIN A;  2YUY A;  4GVD A;  4JOG A;  2I0I A;  2EEG A;  3LNY A;  1RGW A;  1VB7 A;  2VPH A;  5I7Z A;  2DLS A;  2QKV A;  1RZX A;  2EEJ A;  2KG2 A;  2LUI A;  5HDY A;  5ILB A;  1IHJ A;  2Z9I A;  1WHD A;  1V62 A;  5HFC A;  2AWW A;  2FNE A;  5F3X A;  1QAV B;  2YUB A;  2KYL A;  1UJU A;  1ZOK A;  4Z8J A;  3FY5 A;  1N99 A;  4JJ3 A;  2JRE A;  2EV8 A;  4Z33 A;  3NFK A;  2LA8 A;  2MHO A;  1UM1 A;  1T2M A;  1D5G A;  3SUZ A;  2EHR A;  4YDP A;  5FHT A;  4E34 A;  2PKU A;  1OBZ A;  2R3Y A;  3B76 A;  3KDK A;  1QAU A;  1LCY A;  1GQ5 A;  2DM8 A;  2KJD A;  2EXG A;  5GLJ A;  1QLC A;  5GND A;  4HOP B;  4OAJ A;  2KAW A;  4K6Y A;  1VJ6 A;  3DJ3 A;  4GHN A;  3TMH A;  1NF3 C;  4FLN A;  1IU0 A;  2YT8 A;  3JXT A;  2ZPM A;  4OEO A;  4IC6 A;  2OS6 A;  3KDG A;  2FCF A;  2JIL A;  3PDZ A;  5HED A;  4Q2N A;  2LC6 A;  2PDZ A;  2VZ5 A;  3RLE A;  2QT5 A;  3TSZ A;  1GQ4 A;  3QO6 A;  4KFV A;  5F67 A;  4NMP A;  4G69 A;  2OCS A;  3OTP A;  2HE2 A;  1V5Q A;  2QG1 A;  5EYZ A;  1WF8 A;  1I16 A;  3TSV A;  3QGL A;  2PZD A;  5IL9 A;  2P3W A;  1X9Z A;  3GCO A;  4NXP A;  3WKL A;  4Q2Q A;  2EDV A;  5E11 A;  2OSG A;  4MPA A;  4JJ0 A;  2H3L A;  2M0V A;  5HET A;  4P2A B;  4NMT A;  3I18 A;  4Q3H A;  4REY A;  1Y8T A;  1ZUB A;  1WH1 A;  1OZI A;  4JOR A;  1FC7 A;  5D13 A;  2FE5 A;  1FC9 A;  1SOT A;  2I1N A;  4L8N A;  1TE0 A;  4NXR A;  2LC7 A;  3GJ9 A;  3AXA A;  2DC2 A;  1Q7X A;  1W9O A;  2KA9 A;  2OZF A;  2PKT A;  2KRG A;  1U37 A;  5HF4 A;  4NNL A;  1GM1 A;  2I6V A;  4EDJ A;  3NCV A;  4K78 A;  3RL8 A;  1TP3 A;  1WFV A;  2OGP A;  1Z86 A;  1UIT A;  2RRM A;  1UHP A;  2L4T A;  1IU2 A;  2IWP A;  4NNM A;  2IWO A;  1Y7N A;  1TP5 A;  2DMZ A;  3HPM A;  1MC7 A;  2O2T A;  2LOB A;  1UFX A;  2L97 A;  2HGA A;  1X6D A;  2K1Z A;  1X5R A;  4NMQ A;  3PV4 A;  1U3B A;  1BFE A;  2IWQ A;  4JOK A;  1QAV A;  3EGH C;  2Q9V A;  4KFW A;  4K75 A;  2YTW A;  1BE9 A;  4Q2O A;  4K76 A;  1N7E A;  3TSW A;  3DOR A;  3O46 A;  1X45 A;  4XHV A;  5HEB A;  1UJV A;  2YT7 A;  2G5M B;  1PDR A;  2DJT A;  3CBY A;  1Z87 A;  2GEF A;  4NMO A;  2H2C A;  2KOM A;  4Q6S A;  1K32 A;  1WI2 A;  2EDZ A;  4HOP A;  4RI0 A;  3OU0 A;  2W7R A;  2F0A A;  2JWE A;  4UU5 A;  1P1E A;  3R0H A;  2EGK A;  1VCW A;  2V90 A;  5B6L A;  2KBS A;  1P1D A;  3ID4 A;  1V6B A;  3CC0 A;  2QKT A;  4O06 A;  2M0T A;  1L6O A;  1WFG A;  3GSL A;  3K50 A;  1WF7 A;  1R6J A;  1WI4 A;  3LNX A; 
#chains in the Genus database with same CATH homology
 1Q3O A;  1WJL A;  1SOZ A;  2KJK A;  2H3M A;  3PS4 A;  4PQW A;  3PDV A;  1N7T A;  5E6P B;  4YYX A;  3SOE A;  1OBX A;  2KOH A;  5H3J A;  2Q3G A;  3QDO A;  4JOP A;  2D8I A;  3DIW A;  4NXQ A;  1WIF A;  3QE1 A;  4FGM A;  4NMR A;  2CSS A;  4NMS A;  2W4F A;  4Q2P A;  1G9O A;  2I04 A;  4F8K A;  3RL7 A;  2CS5 A;  3ZRT A;  1WHA A;  4WYU A;  3KHF A;  2BYG A;  2AWX A;  1NTE A;  2KL1 A;  5B42 A;  2DAZ A;  3HVQ C;  1N6F A;  2EGN A;  2M0Z A;  3VQF A;  3CYY A;  1FC6 A;  2FN5 A;  4Q6H A;  3GDV A;  1UEZ A;  3ID1 A;  1N6D A;  2F5Y A;  1KY9 A;  3MH7 A;  4E3B A;  2WL7 A;  3SHU A;  4NMV A;  3PV2 A;  2REY A;  4JOJ A;  3E17 A;  3GAB A;  1Q3P A;  3R68 A;  4E35 A;  2EGO A;  3BPU A;  5A2P A;  1X5N A;  2L4S A;  5FB8 C;  2EEH A;  2ZPL A;  4N6X A;  3K82 A;  4LMM A;  1VAE A;  1MFG A;  3HPK A;  4JOH A;  2K20 A;  2KV8 A;  5DTH A;  2D92 A;  2JOA A;  2EJY A;  1KWA A;  5HFB A;  2KPL A;  5HF1 A;  2EDP A;  5E22 A;  2VWR A;  1X8S A;  2Z17 A;  2QBW A;  1V5L A;  4R2Z A;  2GZV A;  3EGG C;  4AMH A;  2QKU A;  3DJA A;  2OPG A;  2OMJ A;  3R69 A;  2CSJ A;  5E21 A;  5G1D A;  4UU6 A;  2KPK A;  3GGE A;  2EAQ A;  1W9E A;  3MH6 A;  2JXO A;  1RGR A;  5JXB A;  3SHW A;  3STJ A;  5HFF A;  2ENO A;  1M5Z A;  2KQF A;  2VSV A;  5EZ0 A;  3GDU A;  4JOF A;  3NGH A;  1N6E A;  3SFJ A;  3QJN A;  1U39 A;  2DKR A;  2HE4 A;  3VQG A;  3O5N A;  2UZC A;  4JOE A;  2V1W A;  1B8Q A;  1UF1 A;  2E7K A;  5G1E A;  2OQS A;  2VRF A;  3WKM A;  2I4S A;  1WG6 A;  5HFE A;  1V1T A;  2M10 A;  3NFL A;  5HFD A;  3L4F D;  1YBO A;  1UEQ A;  1KEF A;  5HEY A;  3PV5 A;  2X7Z A;  1W9Q A;  3CBZ A;  3CS0 A;  3K1R A;  5E1Y A;  2MX6 A;  5HJ1 A;  2AIN A;  2R4H A;  3I1E A;  1X5Q A;  1RY4 A;  3ID2 A;  3QIK A;  2KOJ A;  2M0U A;  1UEW A;  1FCF A;  3DJ1 A;  2PNT A;  2KJP A;  1XZ9 A;  2D90 A;  3QJM A;  2EEI A;  3KZD A;  2G2L A;  1N7F A;  4OEP A;  2RCZ A;  4WYT A;  1I92 A;  2DLU A;  2JIK A;  4JL7 A;  3KZE A;  1UJD A;  2PA1 A;  3GCN A;  4GVC A;  2IWN A;  4K72 A;  3CBX A;  1UEP A;  4P0C A;  3MH4 A;  2AWU A;  1U38 A;  2H2B A;  2DB5 A;  3ID3 A;  2VSP A;  1TQ3 A;  1OBY A;  3CH8 A;  2I0L A;  3I4W A;  3GDS A;  2JSN A;  1MFL A;  2M3M A;  4H11 A;  1VA8 A;  1UM7 A;  2JIN A;  2YUY A;  4GVD A;  4JOG A;  2I0I A;  2EEG A;  3LNY A;  1RGW A;  1VB7 A;  2VPH A;  5I7Z A;  2DLS A;  2QKV A;  1RZX A;  2EEJ A;  2KG2 A;  2LUI A;  5HDY A;  5ILB A;  1IHJ A;  2Z9I A;  1WHD A;  1V62 A;  5HFC A;  2AWW A;  2FNE A;  5F3X A;  1QAV B;  2YUB A;  2KYL A;  1UJU A;  1ZOK A;  4Z8J A;  3FY5 A;  1N99 A;  4JJ3 A;  2JRE A;  2EV8 A;  4Z33 A;  3NFK A;  2LA8 A;  2MHO A;  1UM1 A;  1T2M A;  1D5G A;  3SUZ A;  2EHR A;  4YDP A;  5FHT A;  4E34 A;  2PKU A;  1OBZ A;  2R3Y A;  3B76 A;  3KDK A;  1QAU A;  1LCY A;  1GQ5 A;  2DM8 A;  2KJD A;  2EXG A;  5GLJ A;  1QLC A;  5GND A;  4HOP B;  4OAJ A;  2KAW A;  4K6Y A;  1VJ6 A;  3DJ3 A;  4GHN A;  3TMH A;  1NF3 C;  4FLN A;  1IU0 A;  2YT8 A;  3JXT A;  2ZPM A;  4OEO A;  4IC6 A;  2OS6 A;  3KDG A;  2FCF A;  2JIL A;  3PDZ A;  5HED A;  4Q2N A;  2LC6 A;  2PDZ A;  2VZ5 A;  3RLE A;  2QT5 A;  3TSZ A;  1GQ4 A;  3QO6 A;  4KFV A;  5F67 A;  4NMP A;  4G69 A;  2OCS A;  3OTP A;  2HE2 A;  1V5Q A;  2QG1 A;  5EYZ A;  1WF8 A;  1I16 A;  3TSV A;  3QGL A;  2PZD A;  5IL9 A;  2P3W A;  1X9Z A;  3GCO A;  4NXP A;  3WKL A;  4Q2Q A;  2EDV A;  5E11 A;  2OSG A;  4MPA A;  4JJ0 A;  2H3L A;  2M0V A;  5HET A;  4P2A B;  4NMT A;  3I18 A;  4Q3H A;  4REY A;  1Y8T A;  1ZUB A;  1WH1 A;  1OZI A;  4JOR A;  1FC7 A;  5D13 A;  2FE5 A;  1FC9 A;  1SOT A;  2I1N A;  4L8N A;  1TE0 A;  4NXR A;  2LC7 A;  3GJ9 A;  3AXA A;  2DC2 A;  1Q7X A;  1W9O A;  2KA9 A;  2OZF A;  2PKT A;  2KRG A;  1U37 A;  5HF4 A;  4NNL A;  1GM1 A;  2I6V A;  4EDJ A;  3NCV A;  4K78 A;  3RL8 A;  1TP3 A;  1WFV A;  2OGP A;  1Z86 A;  1UIT A;  2RRM A;  1UHP A;  2L4T A;  1IU2 A;  2IWP A;  4NNM A;  2IWO A;  1Y7N A;  1TP5 A;  2DMZ A;  3HPM A;  1MC7 A;  2O2T A;  2LOB A;  1UFX A;  2L97 A;  2HGA A;  1X6D A;  2K1Z A;  1X5R A;  4NMQ A;  3PV4 A;  1U3B A;  1BFE A;  2IWQ A;  4JOK A;  1QAV A;  3EGH C;  2Q9V A;  4KFW A;  4K75 A;  2YTW A;  1BE9 A;  4Q2O A;  4K76 A;  1N7E A;  3TSW A;  3DOR A;  3O46 A;  1X45 A;  4XHV A;  5HEB A;  1UJV A;  2YT7 A;  2G5M B;  1PDR A;  2DJT A;  3CBY A;  1Z87 A;  2GEF A;  4NMO A;  2H2C A;  2KOM A;  4Q6S A;  1K32 A;  1WI2 A;  2EDZ A;  4HOP A;  4RI0 A;  3OU0 A;  2W7R A;  2F0A A;  2JWE A;  4UU5 A;  1P1E A;  3R0H A;  2EGK A;  1VCW A;  2V90 A;  5B6L A;  2KBS A;  1P1D A;  3ID4 A;  1V6B A;  3CC0 A;  2QKT A;  4O06 A;  2M0T A;  1L6O A;  1WFG A;  3GSL A;  3K50 A;  1WF7 A;  1R6J A;  1WI4 A;  3LNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...