1I92A

Structural basis of the nherf pdz1-cftr interaction
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'GMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPEQDTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NA+/H+ EXCHANGE REGULATORY CO-FACTOR
publication title Structural basis of the Na+/H+ exchanger regulatory factor PDZ1 interaction with the carboxyl-terminal region of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2001-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1i92A00
1UJDA 1T2MA 2PZDA 1U37A 1UEQA 2K1ZA 5E1YA 2DB5A 1WF8A 5HFDA 1Q3OA 1MC7A 1U38A 1TP5A 4RI0A 1YBOA 1LCYA 4FGMA 1UM1A 1U39A 2AWUA 3E17A 5HFBA 2I04A 4L8NA 2W7RA 2H3MA 2RCZA 5JXBA 2BYGA 2PA1A 2P3WA 3GDVA 2EJYA 1VA8A 3NGHA 2REYA 3PV5A 3HPKA 2KOHA 4K72A 2DJTA 3FY5A 2EEGA 3SFJA 1V62A 1V5LA 1FCFA 4WYTA 2JOAA 2KV8A 1IU2A 1VCWA 1W9OA 1TQ3A 3R69A 1Z87A 1N99A 3EGHC 2KOJA 4E3BA 1GM1A 1XZ9A 2JREA 4NMSA 1B8QA 2I4SA 2CS5A 3B76A 3ID2A 3LNYA 2IWOA 4GHNA 2W4FA 1Q3PA 4H11A 1MFLA 3GCNA 4JOHA 3NFKA 4REYA 2DLUA 4NXRA 4Q6HA 5E11A 2YT8A 3PV2A 3TSVA 3WKMA 2AWWA 1P1EA 3CC0A 4YDPA 2AWXA 4OAJA 2OGPA 1N6EA 1MFGA 3HPMA 2KA9A 4OEPA 5HFFA 2OQSA 1QAUA 2VSPA 1FC6A 2ZPLA 3SUZA 2GZVA 5I7ZA 2LA8A 1D5GA 2KQFA 3DORA 2DLSA 3TSWA 4NMPA 3K50A 4Q2PA 4GVDA 2HE4A 2LC7A 3DJAA 1KWAA 4IC6A 3I18A 1WI4A 4OEOA 2KYLA 4UU6A 4Z8JA 2KOMA 2MHOA 4P2AB 1X6DA 2ZPMA 2M0UA 5E21A 1I92A 2EHRA 4F8KA 1WG6A 2EV8A 2DMZA 4WYUA 5EZ0A 1KY9A 1UEPA 3CS0A 1WFVA 2QKTA 2L97A 2R3YA 1QAVB 1WF7A 3SHUA 2QG1A 2Q3GA 5D13A 2EEIA 1UFXA 4NNMA 3HVQC 4LMMA 1WH1A 4JOGA 1RZXA 3GGEA 4JL7A 4NXQA 4MPAA 4NMOA 5HFCA 3DIWA 3TMHA 3K82A 3SHWA 4AMHA 3KZDA 1W9EA 1FC9A 1RGRA 3OTPA 5H3JA 4Q6SA 2JIKA 2H3LA 4XHVA 2EGNA 4JOKA 3CYYA 4KFVA 2KAWA 5HF4A 3PV4A 5G1DA 2D8IA 2H2CA 1V6BA 3EGGC 1SOTA 3PDZA 2L4TA 3JXTA 2M0ZA 4E35A 1UITA 2H2BA 5HDYA 1UEWA 1NTEA 3R0HA 5HETA 1L6OA 2IWNA 2LC6A 2O2TA 2X7ZA 2M0TA 4Q2NA 4K78A 1Z86A 2CSSA 5EYZA 3CH8A 2JWEA 1U3BA 4K6YA 1X45A 4HOPB 1WIFA 3KHFA 1Q7XA 3QJNA 3MH4A 1FC7A 2JINA 3GDSA 3GCOA 2K20A 1BE9A 3I4WA 2DAZA 2KJDA 3O46A 4NMRA 1R6JA 2IWPA 3CBXA 4JORA 1KEFA 2OZFA 2FE5A 2G2LA 1VJ6A 3QE1A 4EDJA 3CBYA 4N6XA 1P1DA 5F3XA 2VRFA 2OS6A 1V1TA 1N7EA 3K1RA 1G9OA 4E34A 4JOFA 1OBXA 1GQ4A 2I0IA 2YUYA 3ZRTA 2DKRA 1N6FA 4NNLA 1W9QA 4K75A 4JOJA 1X5NA 5HF1A 2V90A 2M3MA 2L4SA 2EDVA 2EDZA 2VPHA 2Z9IA 2LOBA 2HE2A 3OU0A 1UM7A 3QO6A 2KPKA 2G5MB 4NMTA 4O06A 1TE0A 5HEYA 1NF3C 1WJLA 3QJMA 2EAQA 5G1EA 2YTWA 3MH6A 4NXPA 5HEDA 3LNXA 1QLCA 3ID1A 4GVCA 2OPGA 1SOZA 2YUBA 3GDUA 1PDRA 1GQ5A 2PNTA 2IWQA 2QKVA 2MX6A 2KL1A 2KG2A 4KFWA 4JOPA 3PS4A 1N7TA 2M0VA 3DJ1A 1VB7A 1ZOKA 1OZIA 1IHJA 2KJKA 3BPUA 3O5NA 5B6LA 4Z33A 3STJA 5GNDA 1QAVA 2D92A 5HFEA 5E6PB 2Q9VA 4YYXA 2KBSA 2F0AA 1VAEA 3NFLA 1ZUBA 1Y8TA 1OBZA 2HGAA 3ID3A 1BFEA 2FCFA 5A2PA 4R2ZA 2KRGA 3L4FD 5DTHA 2I6VA 3RLEA 2EEJA 4Q2OA 1N6DA 3DJ3A 5HEBA 2OCSA 2EDPA 2EXGA 2YT7A 2PDZA 1IU0A 3RL7A 3AXAA 4UU5A 1UHPA 3CBZA 3VQGA 5GLJA 2UZCA 2VZ5A 2PKTA 2R4HA 2Z17A 2V1WA 5FHTA 1WFGA 2EEHA 1X5QA 3QIKA 2JXOA 1V5QA 3GJ9A 1WHAA 1M5ZA 2PKUA 3QGLA 1K32A 1X8SA 5FB8C 2I1NA 2I0LA 1UJVA 3KZEA 4G69A 2KJPA 1WHDA 2QBWA 5E22A 2D90A 2VSVA 1RY4A 2QKUA 2WL7A 3I1EA 3GSLA 4HOPA 3TSZA 2OSGA 2VWRA 2CSJA 2KPLA 5F67A 1Y7NA 2F5YA 3ID4A 3R68A 2QT5A 2EGOA 3MH7A 2OMJA 4NMVA 2LUIA 4JOEA 4PQWA 1I16A 1N7FA 2DC2A 1X5RA 1OBYA 5HJ1A 2ENOA 3QDOA 2EGKA 2E7KA 2AINA 1RGWA 1UEZA 1UF1A 3WKLA 1UJUA 3VQFA 2M10A 2FNEA 2DM8A 2JILA 3PDVA 1WI2A 3SOEA 4NMQA 4K76A 2RRMA 2FN5A 3RL8A 1TP3A 4Q2QA 4P0CA 4Q3HA
chains in the Genus database with same CATH superfamily
1UJDA 1T2MA 2PZDA 1U37A 1UEQA 2K1ZA 5E1YA 2DB5A 1WF8A 5HFDA 1Q3OA 1MC7A 1U38A 1TP5A 4RI0A 1YBOA 1LCYA 4FGMA 1UM1A 1U39A 2AWUA 3E17A 5HFBA 2I04A 4L8NA 2W7RA 2H3MA 2RCZA 5JXBA 5B42A 2BYGA 2PA1A 2P3WA 3GDVA 2EJYA 1VA8A 3NGHA 2REYA 3PV5A 3HPKA 2KOHA 4K72A 2DJTA 3FY5A 2EEGA 3SFJA 1V62A 1V5LA 1FCFA 4WYTA 2JOAA 2KV8A 1IU2A 1VCWA 1W9OA 1TQ3A 3R69A 1Z87A 1N99A 3EGHC 2KOJA 4E3BA 1GM1A 1XZ9A 2JREA 4NMSA 1B8QA 2I4SA 2CS5A 3B76A 3ID2A 3LNYA 2IWOA 4GHNA 2W4FA 1Q3PA 4H11A 1MFLA 3GCNA 4JOHA 3NFKA 4REYA 2DLUA 4NXRA 4Q6HA 5E11A 2YT8A 3PV2A 3TSVA 3WKMA 2AWWA 1P1EA 3CC0A 4YDPA 2AWXA 4OAJA 2OGPA 1N6EA 1MFGA 3HPMA 2KA9A 4OEPA 5HFFA 2OQSA 1QAUA 2VSPA 1FC6A 2ZPLA 3SUZA 2GZVA 2JSNA 5I7ZA 2LA8A 1D5GA 2KQFA 3DORA 2DLSA 3TSWA 4NMPA 3K50A 4Q2PA 4GVDA 2HE4A 2LC7A 3DJAA 1KWAA 4IC6A 3I18A 1WI4A 4OEOA 2KYLA 4UU6A 4Z8JA 2KOMA 2MHOA 4P2AB 1X6DA 2ZPMA 2M0UA 5E21A 5IL9A 1I92A 2EHRA 4FLNA 4F8KA 1WG6A 2EV8A 2DMZA 4WYUA 5EZ0A 1KY9A 1UEPA 3CS0A 1WFVA 2QKTA 2L97A 2R3YA 1QAVB 1WF7A 3SHUA 2QG1A 2Q3GA 5D13A 2EEIA 1UFXA 4NNMA 3HVQC 4LMMA 1WH1A 4JOGA 1RZXA 3KDKA 3GGEA 4JL7A 4NXQA 4MPAA 4NMOA 5HFCA 3DIWA 3TMHA 3K82A 3SHWA 4AMHA 3KZDA 1W9EA 1FC9A 1RGRA 3OTPA 5H3JA 4Q6SA 2JIKA 2H3LA 4XHVA 2EGNA 4JOKA 3CYYA 4KFVA 2KAWA 5HF4A 3PV4A 5G1DA 2D8IA 2H2CA 1V6BA 3EGGC 1SOTA 3PDZA 2L4TA 3JXTA 2M0ZA 4E35A 1UITA 2H2BA 5HDYA 1UEWA 1NTEA 3R0HA 5HETA 1L6OA 2IWNA 2LC6A 2O2TA 2X7ZA 2M0TA 4Q2NA 4K78A 1Z86A 2CSSA 5EYZA 3CH8A 2JWEA 1U3BA 4K6YA 1X45A 4HOPB 1WIFA 3KHFA 1Q7XA 3QJNA 3MH4A 1FC7A 2JINA 3GDSA 5ILBA 3GCOA 2K20A 1BE9A 3I4WA 2DAZA 2KJDA 3O46A 4NMRA 1R6JA 2IWPA 3CBXA 4JORA 1KEFA 2OZFA 2FE5A 2G2LA 1VJ6A 3QE1A 4EDJA 3CBYA 4N6XA 1P1DA 5F3XA 2VRFA 2OS6A 1V1TA 1N7EA 3K1RA 1G9OA 4E34A 4JOFA 1OBXA 4JJ0A 1GQ4A 2I0IA 2YUYA 3ZRTA 2DKRA 1N6FA 4NNLA 1W9QA 4JJ3A 4K75A 4JOJA 1X5NA 5HF1A 2V90A 2M3MA 2L4SA 2EDVA 2EDZA 2VPHA 2Z9IA 2LOBA 2HE2A 3OU0A 1UM7A 3QO6A 2KPKA 2G5MB 4NMTA 4O06A 1TE0A 5HEYA 1NF3C 1WJLA 3QJMA 2EAQA 5G1EA 2YTWA 3MH6A 4NXPA 5HEDA 3LNXA 1QLCA 3ID1A 4GVCA 2OPGA 1SOZA 2YUBA 3GDUA 1PDRA 1GQ5A 2PNTA 2IWQA 2QKVA 2MX6A 2KL1A 2KG2A 4KFWA 4JOPA 3PS4A 1N7TA 2M0VA 3DJ1A 1VB7A 1ZOKA 1OZIA 1IHJA 2KJKA 3BPUA 3O5NA 5B6LA 4Z33A 3STJA 5GNDA 1QAVA 2D92A 5HFEA 5E6PB 2Q9VA 4YYXA 2KBSA 3KDGA 2F0AA 1VAEA 3NFLA 1ZUBA 1Y8TA 1OBZA 2HGAA 3ID3A 1BFEA 2FCFA 5A2PA 4R2ZA 2KRGA 3L4FD 5DTHA 2I6VA 3RLEA 2EEJA 4Q2OA 1N6DA 3DJ3A 5HEBA 2OCSA 2EDPA 2EXGA 2YT7A 2PDZA 1IU0A 3RL7A 3AXAA 4UU5A 3NCVA 1UHPA 3CBZA 3VQGA 5GLJA 2UZCA 2VZ5A 2PKTA 2R4HA 2Z17A 2V1WA 5FHTA 1WFGA 2EEHA 1X5QA 3QIKA 2JXOA 1V5QA 3GJ9A 1WHAA 2GEFA 1M5ZA 2PKUA 3QGLA 1K32A 1X8SA 5FB8C 2I1NA 2I0LA 1UJVA 3KZEA 4G69A 2KJPA 1WHDA 2QBWA 5E22A 2D90A 2VSVA 1RY4A 2QKUA 2WL7A 3I1EA 3GSLA 4HOPA 3TSZA 2OSGA 2VWRA 2CSJA 2KPLA 5F67A 1Y7NA 2F5YA 1X9ZA 3ID4A 3R68A 2QT5A 2EGOA 3MH7A 2OMJA 4NMVA 2LUIA 4JOEA 4PQWA 1I16A 1N7FA 2DC2A 1X5RA 1OBYA 5HJ1A 2ENOA 3QDOA 2EGKA 2E7KA 3GABA 2AINA 1RGWA 1UEZA 1UF1A 3WKLA 1UJUA 3VQFA 2M10A 2FNEA 2DM8A 2JILA 3PDVA 1WI2A 3SOEA 4NMQA 4K76A 2RRMA 2FN5A 3RL8A 1TP3A 4Q2QA 4P0CA 4Q3HA
chains in the Genus database with same CATH topology
1UJDA 1T2MA 2PZDA 1U37A 1UEQA 2K1ZA 5E1YA 2DB5A 1WF8A 5HFDA 1Q3OA 1MC7A 1U38A 1TP5A 4RI0A 1YBOA 1LCYA 4FGMA 1UM1A 1U39A 2AWUA 3E17A 5HFBA 2I04A 4L8NA 2W7RA 2H3MA 2RCZA 5JXBA 5B42A 2BYGA 2PA1A 2P3WA 3GDVA 2EJYA 1VA8A 3NGHA 2REYA 3PV5A 3HPKA 2KOHA 4K72A 2DJTA 3FY5A 2EEGA 3SFJA 1V62A 1V5LA 1FCFA 4WYTA 2JOAA 2KV8A 1IU2A 1VCWA 1W9OA 1TQ3A 3R69A 1Z87A 1N99A 3EGHC 2KOJA 4E3BA 1GM1A 1XZ9A 2JREA 4NMSA 1B8QA 2I4SA 2CS5A 3B76A 3ID2A 3LNYA 2IWOA 4GHNA 2W4FA 1Q3PA 4H11A 1MFLA 3GCNA 4JOHA 3NFKA 4REYA 2DLUA 4NXRA 4Q6HA 5E11A 2YT8A 3PV2A 3TSVA 3WKMA 2AWWA 1P1EA 3CC0A 4YDPA 2AWXA 4OAJA 2OGPA 1N6EA 1MFGA 3HPMA 2KA9A 4OEPA 5HFFA 2OQSA 1QAUA 2VSPA 1FC6A 2ZPLA 3SUZA 2GZVA 2JSNA 5I7ZA 2LA8A 1D5GA 2KQFA 3DORA 2DLSA 3TSWA 4NMPA 3K50A 4Q2PA 4GVDA 2HE4A 2LC7A 3DJAA 1KWAA 4IC6A 3I18A 1WI4A 4OEOA 2KYLA 4UU6A 4Z8JA 2KOMA 2MHOA 4P2AB 1X6DA 2ZPMA 2M0UA 5E21A 5IL9A 1I92A 2EHRA 4FLNA 4F8KA 1WG6A 2EV8A 2DMZA 4WYUA 5EZ0A 1KY9A 1UEPA 3CS0A 1WFVA 2QKTA 2L97A 2R3YA 1QAVB 1WF7A 3SHUA 2QG1A 2Q3GA 5D13A 2EEIA 1UFXA 4NNMA 3HVQC 4LMMA 1WH1A 4JOGA 1RZXA 3KDKA 3GGEA 4JL7A 4NXQA 4MPAA 4NMOA 5HFCA 3DIWA 3TMHA 3K82A 3SHWA 4AMHA 3KZDA 1W9EA 1FC9A 1RGRA 3OTPA 5H3JA 4Q6SA 2JIKA 2H3LA 4XHVA 2EGNA 4JOKA 3CYYA 4KFVA 2KAWA 5HF4A 3PV4A 5G1DA 2D8IA 2H2CA 1V6BA 3EGGC 1SOTA 3PDZA 2L4TA 3JXTA 2M0ZA 4E35A 1UITA 2H2BA 5HDYA 1UEWA 1NTEA 3R0HA 5HETA 1L6OA 2IWNA 2LC6A 2O2TA 2X7ZA 2M0TA 4Q2NA 4K78A 1Z86A 2CSSA 5EYZA 3CH8A 2JWEA 1U3BA 4K6YA 1X45A 4HOPB 1WIFA 3KHFA 1Q7XA 3QJNA 3MH4A 1FC7A 2JINA 3GDSA 5ILBA 3GCOA 2K20A 1BE9A 3I4WA 2DAZA 2KJDA 3O46A 4NMRA 1R6JA 2IWPA 3CBXA 4JORA 1KEFA 2OZFA 2FE5A 2G2LA 1VJ6A 3QE1A 4EDJA 3CBYA 4N6XA 1P1DA 5F3XA 2VRFA 2OS6A 1V1TA 1N7EA 3K1RA 1G9OA 4E34A 4JOFA 1OBXA 4JJ0A 1GQ4A 2I0IA 2YUYA 3ZRTA 2DKRA 1N6FA 4NNLA 1W9QA 4JJ3A 4K75A 4JOJA 1X5NA 5HF1A 2V90A 2M3MA 2L4SA 2EDVA 2EDZA 2VPHA 2Z9IA 2LOBA 2HE2A 3OU0A 1UM7A 3QO6A 2KPKA 2G5MB 4NMTA 4O06A 1TE0A 5HEYA 1NF3C 1WJLA 3QJMA 2EAQA 5G1EA 2YTWA 3MH6A 4NXPA 5HEDA 3LNXA 1QLCA 3ID1A 4GVCA 2OPGA 1SOZA 2YUBA 3GDUA 1PDRA 1GQ5A 2PNTA 2IWQA 2QKVA 2MX6A 2KL1A 2KG2A 4KFWA 4JOPA 3PS4A 1N7TA 2M0VA 3DJ1A 1VB7A 1ZOKA 1OZIA 1IHJA 2KJKA 3BPUA 3O5NA 5B6LA 4Z33A 3STJA 5GNDA 1QAVA 2D92A 5HFEA 5E6PB 2Q9VA 4YYXA 2KBSA 3KDGA 2F0AA 1VAEA 3NFLA 1ZUBA 1Y8TA 1OBZA 2HGAA 3ID3A 1BFEA 2FCFA 5A2PA 4R2ZA 2KRGA 3L4FD 5DTHA 2I6VA 3RLEA 2EEJA 4Q2OA 1N6DA 3DJ3A 5HEBA 2OCSA 2EDPA 2EXGA 2YT7A 2PDZA 1IU0A 3RL7A 3AXAA 4UU5A 3NCVA 1UHPA 3CBZA 3VQGA 5GLJA 2UZCA 2VZ5A 2PKTA 2R4HA 2Z17A 2V1WA 5FHTA 1WFGA 2EEHA 1X5QA 3QIKA 2JXOA 1V5QA 3GJ9A 1WHAA 2GEFA 1M5ZA 2PKUA 3QGLA 1K32A 1X8SA 5FB8C 2I1NA 2I0LA 1UJVA 3KZEA 4G69A 2KJPA 1WHDA 2QBWA 5E22A 2D90A 2VSVA 1RY4A 2QKUA 2WL7A 3I1EA 3GSLA 4HOPA 3TSZA 2OSGA 2VWRA 2CSJA 2KPLA 5F67A 1Y7NA 2F5YA 1X9ZA 3ID4A 3R68A 2QT5A 2EGOA 3MH7A 2OMJA 4NMVA 2LUIA 4JOEA 4PQWA 1I16A 1N7FA 2DC2A 1X5RA 1OBYA 5HJ1A 2ENOA 3QDOA 2EGKA 2E7KA 3GABA 2AINA 1RGWA 1UEZA 1UF1A 3WKLA 1UJUA 3VQFA 2M10A 2FNEA 2DM8A 2JILA 3PDVA 1WI2A 3SOEA 4NMQA 4K76A 2RRMA 2FN5A 3RL8A 1TP3A 4Q2QA 4P0CA 4Q3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJD A;  1T2M A;  2PZD A;  1U37 A;  1UEQ A;  2K1Z A;  5E1Y A;  2DB5 A;  1WF8 A;  5HFD A;  1Q3O A;  1MC7 A;  1U38 A;  1TP5 A;  4RI0 A;  1YBO A;  1LCY A;  4FGM A;  1UM1 A;  1U39 A;  2AWU A;  3E17 A;  5HFB A;  2I04 A;  4L8N A;  2W7R A;  2H3M A;  2RCZ A;  5JXB A;  2BYG A;  2PA1 A;  2P3W A;  3GDV A;  2EJY A;  1VA8 A;  3NGH A;  2REY A;  3PV5 A;  3HPK A;  2KOH A;  4K72 A;  2DJT A;  3FY5 A;  2EEG A;  3SFJ A;  1V62 A;  1V5L A;  1FCF A;  4WYT A;  2JOA A;  2KV8 A;  1IU2 A;  1VCW A;  1W9O A;  1TQ3 A;  3R69 A;  1Z87 A;  1N99 A;  3EGH C;  2KOJ A;  4E3B A;  1GM1 A;  1XZ9 A;  2JRE A;  4NMS A;  1B8Q A;  2I4S A;  2CS5 A;  3B76 A;  3ID2 A;  3LNY A;  2IWO A;  4GHN A;  2W4F A;  1Q3P A;  4H11 A;  1MFL A;  3GCN A;  4JOH A;  3NFK A;  4REY A;  2DLU A;  4NXR A;  4Q6H A;  5E11 A;  2YT8 A;  3PV2 A;  3TSV A;  3WKM A;  2AWW A;  1P1E A;  3CC0 A;  4YDP A;  2AWX A;  4OAJ A;  2OGP A;  1N6E A;  1MFG A;  3HPM A;  2KA9 A;  4OEP A;  5HFF A;  2OQS A;  1QAU A;  2VSP A;  1FC6 A;  2ZPL A;  3SUZ A;  2GZV A;  5I7Z A;  2LA8 A;  1D5G A;  2KQF A;  3DOR A;  2DLS A;  3TSW A;  4NMP A;  3K50 A;  4Q2P A;  4GVD A;  2HE4 A;  2LC7 A;  3DJA A;  1KWA A;  4IC6 A;  3I18 A;  1WI4 A;  4OEO A;  2KYL A;  4UU6 A;  4Z8J A;  2KOM A;  2MHO A;  4P2A B;  1X6D A;  2ZPM A;  2M0U A;  5E21 A;  1I92 A;  2EHR A;  4F8K A;  1WG6 A;  2EV8 A;  2DMZ A;  4WYU A;  5EZ0 A;  1KY9 A;  1UEP A;  3CS0 A;  1WFV A;  2QKT A;  2L97 A;  2R3Y A;  1QAV B;  1WF7 A;  3SHU A;  2QG1 A;  2Q3G A;  5D13 A;  2EEI A;  1UFX A;  4NNM A;  3HVQ C;  4LMM A;  1WH1 A;  4JOG A;  1RZX A;  3GGE A;  4JL7 A;  4NXQ A;  4MPA A;  4NMO A;  5HFC A;  3DIW A;  3TMH A;  3K82 A;  3SHW A;  4AMH A;  3KZD A;  1W9E A;  1FC9 A;  1RGR A;  3OTP A;  5H3J A;  4Q6S A;  2JIK A;  2H3L A;  4XHV A;  2EGN A;  4JOK A;  3CYY A;  4KFV A;  2KAW A;  5HF4 A;  3PV4 A;  5G1D A;  2D8I A;  2H2C A;  1V6B A;  3EGG C;  1SOT A;  3PDZ A;  2L4T A;  3JXT A;  2M0Z A;  4E35 A;  1UIT A;  2H2B A;  5HDY A;  1UEW A;  1NTE A;  3R0H A;  5HET A;  1L6O A;  2IWN A;  2LC6 A;  2O2T A;  2X7Z A;  2M0T A;  4Q2N A;  4K78 A;  1Z86 A;  2CSS A;  5EYZ A;  3CH8 A;  2JWE A;  1U3B A;  4K6Y A;  1X45 A;  4HOP B;  1WIF A;  3KHF A;  1Q7X A;  3QJN A;  3MH4 A;  1FC7 A;  2JIN A;  3GDS A;  3GCO A;  2K20 A;  1BE9 A;  3I4W A;  2DAZ A;  2KJD A;  3O46 A;  4NMR A;  1R6J A;  2IWP A;  3CBX A;  4JOR A;  1KEF A;  2OZF A;  2FE5 A;  2G2L A;  1VJ6 A;  3QE1 A;  4EDJ A;  3CBY A;  4N6X A;  1P1D A;  5F3X A;  2VRF A;  2OS6 A;  1V1T A;  1N7E A;  3K1R A;  1G9O A;  4E34 A;  4JOF A;  1OBX A;  1GQ4 A;  2I0I A;  2YUY A;  3ZRT A;  2DKR A;  1N6F A;  4NNL A;  1W9Q A;  4K75 A;  4JOJ A;  1X5N A;  5HF1 A;  2V90 A;  2M3M A;  2L4S A;  2EDV A;  2EDZ A;  2VPH A;  2Z9I A;  2LOB A;  2HE2 A;  3OU0 A;  1UM7 A;  3QO6 A;  2KPK A;  2G5M B;  4NMT A;  4O06 A;  1TE0 A;  5HEY A;  1NF3 C;  1WJL A;  3QJM A;  2EAQ A;  5G1E A;  2YTW A;  3MH6 A;  4NXP A;  5HED A;  3LNX A;  1QLC A;  3ID1 A;  4GVC A;  2OPG A;  1SOZ A;  2YUB A;  3GDU A;  1PDR A;  1GQ5 A;  2PNT A;  2IWQ A;  2QKV A;  2MX6 A;  2KL1 A;  2KG2 A;  4KFW A;  4JOP A;  3PS4 A;  1N7T A;  2M0V A;  3DJ1 A;  1VB7 A;  1ZOK A;  1OZI A;  1IHJ A;  2KJK A;  3BPU A;  3O5N A;  5B6L A;  4Z33 A;  3STJ A;  5GND A;  1QAV A;  2D92 A;  5HFE A;  5E6P B;  2Q9V A;  4YYX A;  2KBS A;  2F0A A;  1VAE A;  3NFL A;  1ZUB A;  1Y8T A;  1OBZ A;  2HGA A;  3ID3 A;  1BFE A;  2FCF A;  5A2P A;  4R2Z A;  2KRG A;  3L4F D;  5DTH A;  2I6V A;  3RLE A;  2EEJ A;  4Q2O A;  1N6D A;  3DJ3 A;  5HEB A;  2OCS A;  2EDP A;  2EXG A;  2YT7 A;  2PDZ A;  1IU0 A;  3RL7 A;  3AXA A;  4UU5 A;  1UHP A;  3CBZ A;  3VQG A;  5GLJ A;  2UZC A;  2VZ5 A;  2PKT A;  2R4H A;  2Z17 A;  2V1W A;  5FHT A;  1WFG A;  2EEH A;  1X5Q A;  3QIK A;  2JXO A;  1V5Q A;  3GJ9 A;  1WHA A;  1M5Z A;  2PKU A;  3QGL A;  1K32 A;  1X8S A;  5FB8 C;  2I1N A;  2I0L A;  1UJV A;  3KZE A;  4G69 A;  2KJP A;  1WHD A;  2QBW A;  5E22 A;  2D90 A;  2VSV A;  1RY4 A;  2QKU A;  2WL7 A;  3I1E A;  3GSL A;  4HOP A;  3TSZ A;  2OSG A;  2VWR A;  2CSJ A;  2KPL A;  5F67 A;  1Y7N A;  2F5Y A;  3ID4 A;  3R68 A;  2QT5 A;  2EGO A;  3MH7 A;  2OMJ A;  4NMV A;  2LUI A;  4JOE A;  4PQW A;  1I16 A;  1N7F A;  2DC2 A;  1X5R A;  1OBY A;  5HJ1 A;  2ENO A;  3QDO A;  2EGK A;  2E7K A;  2AIN A;  1RGW A;  1UEZ A;  1UF1 A;  3WKL A;  1UJU A;  3VQF A;  2M10 A;  2FNE A;  2DM8 A;  2JIL A;  3PDV A;  1WI2 A;  3SOE A;  4NMQ A;  4K76 A;  2RRM A;  2FN5 A;  3RL8 A;  1TP3 A;  4Q2Q A;  4P0C A;  4Q3H A; 
#chains in the Genus database with same CATH topology
 1UJD A;  1T2M A;  2PZD A;  1U37 A;  1UEQ A;  2K1Z A;  5E1Y A;  2DB5 A;  1WF8 A;  5HFD A;  1Q3O A;  1MC7 A;  1U38 A;  1TP5 A;  4RI0 A;  1YBO A;  1LCY A;  4FGM A;  1UM1 A;  1U39 A;  2AWU A;  3E17 A;  5HFB A;  2I04 A;  4L8N A;  2W7R A;  2H3M A;  2RCZ A;  5JXB A;  5B42 A;  2BYG A;  2PA1 A;  2P3W A;  3GDV A;  2EJY A;  1VA8 A;  3NGH A;  2REY A;  3PV5 A;  3HPK A;  2KOH A;  4K72 A;  2DJT A;  3FY5 A;  2EEG A;  3SFJ A;  1V62 A;  1V5L A;  1FCF A;  4WYT A;  2JOA A;  2KV8 A;  1IU2 A;  1VCW A;  1W9O A;  1TQ3 A;  3R69 A;  1Z87 A;  1N99 A;  3EGH C;  2KOJ A;  4E3B A;  1GM1 A;  1XZ9 A;  2JRE A;  4NMS A;  1B8Q A;  2I4S A;  2CS5 A;  3B76 A;  3ID2 A;  3LNY A;  2IWO A;  4GHN A;  2W4F A;  1Q3P A;  4H11 A;  1MFL A;  3GCN A;  4JOH A;  3NFK A;  4REY A;  2DLU A;  4NXR A;  4Q6H A;  5E11 A;  2YT8 A;  3PV2 A;  3TSV A;  3WKM A;  2AWW A;  1P1E A;  3CC0 A;  4YDP A;  2AWX A;  4OAJ A;  2OGP A;  1N6E A;  1MFG A;  3HPM A;  2KA9 A;  4OEP A;  5HFF A;  2OQS A;  1QAU A;  2VSP A;  1FC6 A;  2ZPL A;  3SUZ A;  2GZV A;  2JSN A;  5I7Z A;  2LA8 A;  1D5G A;  2KQF A;  3DOR A;  2DLS A;  3TSW A;  4NMP A;  3K50 A;  4Q2P A;  4GVD A;  2HE4 A;  2LC7 A;  3DJA A;  1KWA A;  4IC6 A;  3I18 A;  1WI4 A;  4OEO A;  2KYL A;  4UU6 A;  4Z8J A;  2KOM A;  2MHO A;  4P2A B;  1X6D A;  2ZPM A;  2M0U A;  5E21 A;  5IL9 A;  1I92 A;  2EHR A;  4FLN A;  4F8K A;  1WG6 A;  2EV8 A;  2DMZ A;  4WYU A;  5EZ0 A;  1KY9 A;  1UEP A;  3CS0 A;  1WFV A;  2QKT A;  2L97 A;  2R3Y A;  1QAV B;  1WF7 A;  3SHU A;  2QG1 A;  2Q3G A;  5D13 A;  2EEI A;  1UFX A;  4NNM A;  3HVQ C;  4LMM A;  1WH1 A;  4JOG A;  1RZX A;  3KDK A;  3GGE A;  4JL7 A;  4NXQ A;  4MPA A;  4NMO A;  5HFC A;  3DIW A;  3TMH A;  3K82 A;  3SHW A;  4AMH A;  3KZD A;  1W9E A;  1FC9 A;  1RGR A;  3OTP A;  5H3J A;  4Q6S A;  2JIK A;  2H3L A;  4XHV A;  2EGN A;  4JOK A;  3CYY A;  4KFV A;  2KAW A;  5HF4 A;  3PV4 A;  5G1D A;  2D8I A;  2H2C A;  1V6B A;  3EGG C;  1SOT A;  3PDZ A;  2L4T A;  3JXT A;  2M0Z A;  4E35 A;  1UIT A;  2H2B A;  5HDY A;  1UEW A;  1NTE A;  3R0H A;  5HET A;  1L6O A;  2IWN A;  2LC6 A;  2O2T A;  2X7Z A;  2M0T A;  4Q2N A;  4K78 A;  1Z86 A;  2CSS A;  5EYZ A;  3CH8 A;  2JWE A;  1U3B A;  4K6Y A;  1X45 A;  4HOP B;  1WIF A;  3KHF A;  1Q7X A;  3QJN A;  3MH4 A;  1FC7 A;  2JIN A;  3GDS A;  5ILB A;  3GCO A;  2K20 A;  1BE9 A;  3I4W A;  2DAZ A;  2KJD A;  3O46 A;  4NMR A;  1R6J A;  2IWP A;  3CBX A;  4JOR A;  1KEF A;  2OZF A;  2FE5 A;  2G2L A;  1VJ6 A;  3QE1 A;  4EDJ A;  3CBY A;  4N6X A;  1P1D A;  5F3X A;  2VRF A;  2OS6 A;  1V1T A;  1N7E A;  3K1R A;  1G9O A;  4E34 A;  4JOF A;  1OBX A;  4JJ0 A;  1GQ4 A;  2I0I A;  2YUY A;  3ZRT A;  2DKR A;  1N6F A;  4NNL A;  1W9Q A;  4JJ3 A;  4K75 A;  4JOJ A;  1X5N A;  5HF1 A;  2V90 A;  2M3M A;  2L4S A;  2EDV A;  2EDZ A;  2VPH A;  2Z9I A;  2LOB A;  2HE2 A;  3OU0 A;  1UM7 A;  3QO6 A;  2KPK A;  2G5M B;  4NMT A;  4O06 A;  1TE0 A;  5HEY A;  1NF3 C;  1WJL A;  3QJM A;  2EAQ A;  5G1E A;  2YTW A;  3MH6 A;  4NXP A;  5HED A;  3LNX A;  1QLC A;  3ID1 A;  4GVC A;  2OPG A;  1SOZ A;  2YUB A;  3GDU A;  1PDR A;  1GQ5 A;  2PNT A;  2IWQ A;  2QKV A;  2MX6 A;  2KL1 A;  2KG2 A;  4KFW A;  4JOP A;  3PS4 A;  1N7T A;  2M0V A;  3DJ1 A;  1VB7 A;  1ZOK A;  1OZI A;  1IHJ A;  2KJK A;  3BPU A;  3O5N A;  5B6L A;  4Z33 A;  3STJ A;  5GND A;  1QAV A;  2D92 A;  5HFE A;  5E6P B;  2Q9V A;  4YYX A;  2KBS A;  3KDG A;  2F0A A;  1VAE A;  3NFL A;  1ZUB A;  1Y8T A;  1OBZ A;  2HGA A;  3ID3 A;  1BFE A;  2FCF A;  5A2P A;  4R2Z A;  2KRG A;  3L4F D;  5DTH A;  2I6V A;  3RLE A;  2EEJ A;  4Q2O A;  1N6D A;  3DJ3 A;  5HEB A;  2OCS A;  2EDP A;  2EXG A;  2YT7 A;  2PDZ A;  1IU0 A;  3RL7 A;  3AXA A;  4UU5 A;  3NCV A;  1UHP A;  3CBZ A;  3VQG A;  5GLJ A;  2UZC A;  2VZ5 A;  2PKT A;  2R4H A;  2Z17 A;  2V1W A;  5FHT A;  1WFG A;  2EEH A;  1X5Q A;  3QIK A;  2JXO A;  1V5Q A;  3GJ9 A;  1WHA A;  2GEF A;  1M5Z A;  2PKU A;  3QGL A;  1K32 A;  1X8S A;  5FB8 C;  2I1N A;  2I0L A;  1UJV A;  3KZE A;  4G69 A;  2KJP A;  1WHD A;  2QBW A;  5E22 A;  2D90 A;  2VSV A;  1RY4 A;  2QKU A;  2WL7 A;  3I1E A;  3GSL A;  4HOP A;  3TSZ A;  2OSG A;  2VWR A;  2CSJ A;  2KPL A;  5F67 A;  1Y7N A;  2F5Y A;  1X9Z A;  3ID4 A;  3R68 A;  2QT5 A;  2EGO A;  3MH7 A;  2OMJ A;  4NMV A;  2LUI A;  4JOE A;  4PQW A;  1I16 A;  1N7F A;  2DC2 A;  1X5R A;  1OBY A;  5HJ1 A;  2ENO A;  3QDO A;  2EGK A;  2E7K A;  3GAB A;  2AIN A;  1RGW A;  1UEZ A;  1UF1 A;  3WKL A;  1UJU A;  3VQF A;  2M10 A;  2FNE A;  2DM8 A;  2JIL A;  3PDV A;  1WI2 A;  3SOE A;  4NMQ A;  4K76 A;  2RRM A;  2FN5 A;  3RL8 A;  1TP3 A;  4Q2Q A;  4P0C A;  4Q3H A; 
#chains in the Genus database with same CATH homology
 1UJD A;  1T2M A;  2PZD A;  1U37 A;  1UEQ A;  2K1Z A;  5E1Y A;  2DB5 A;  1WF8 A;  5HFD A;  1Q3O A;  1MC7 A;  1U38 A;  1TP5 A;  4RI0 A;  1YBO A;  1LCY A;  4FGM A;  1UM1 A;  1U39 A;  2AWU A;  3E17 A;  5HFB A;  2I04 A;  4L8N A;  2W7R A;  2H3M A;  2RCZ A;  5JXB A;  5B42 A;  2BYG A;  2PA1 A;  2P3W A;  3GDV A;  2EJY A;  1VA8 A;  3NGH A;  2REY A;  3PV5 A;  3HPK A;  2KOH A;  4K72 A;  2DJT A;  3FY5 A;  2EEG A;  3SFJ A;  1V62 A;  1V5L A;  1FCF A;  4WYT A;  2JOA A;  2KV8 A;  1IU2 A;  1VCW A;  1W9O A;  1TQ3 A;  3R69 A;  1Z87 A;  1N99 A;  3EGH C;  2KOJ A;  4E3B A;  1GM1 A;  1XZ9 A;  2JRE A;  4NMS A;  1B8Q A;  2I4S A;  2CS5 A;  3B76 A;  3ID2 A;  3LNY A;  2IWO A;  4GHN A;  2W4F A;  1Q3P A;  4H11 A;  1MFL A;  3GCN A;  4JOH A;  3NFK A;  4REY A;  2DLU A;  4NXR A;  4Q6H A;  5E11 A;  2YT8 A;  3PV2 A;  3TSV A;  3WKM A;  2AWW A;  1P1E A;  3CC0 A;  4YDP A;  2AWX A;  4OAJ A;  2OGP A;  1N6E A;  1MFG A;  3HPM A;  2KA9 A;  4OEP A;  5HFF A;  2OQS A;  1QAU A;  2VSP A;  1FC6 A;  2ZPL A;  3SUZ A;  2GZV A;  2JSN A;  5I7Z A;  2LA8 A;  1D5G A;  2KQF A;  3DOR A;  2DLS A;  3TSW A;  4NMP A;  3K50 A;  4Q2P A;  4GVD A;  2HE4 A;  2LC7 A;  3DJA A;  1KWA A;  4IC6 A;  3I18 A;  1WI4 A;  4OEO A;  2KYL A;  4UU6 A;  4Z8J A;  2KOM A;  2MHO A;  4P2A B;  1X6D A;  2ZPM A;  2M0U A;  5E21 A;  5IL9 A;  1I92 A;  2EHR A;  4FLN A;  4F8K A;  1WG6 A;  2EV8 A;  2DMZ A;  4WYU A;  5EZ0 A;  1KY9 A;  1UEP A;  3CS0 A;  1WFV A;  2QKT A;  2L97 A;  2R3Y A;  1QAV B;  1WF7 A;  3SHU A;  2QG1 A;  2Q3G A;  5D13 A;  2EEI A;  1UFX A;  4NNM A;  3HVQ C;  4LMM A;  1WH1 A;  4JOG A;  1RZX A;  3KDK A;  3GGE A;  4JL7 A;  4NXQ A;  4MPA A;  4NMO A;  5HFC A;  3DIW A;  3TMH A;  3K82 A;  3SHW A;  4AMH A;  3KZD A;  1W9E A;  1FC9 A;  1RGR A;  3OTP A;  5H3J A;  4Q6S A;  2JIK A;  2H3L A;  4XHV A;  2EGN A;  4JOK A;  3CYY A;  4KFV A;  2KAW A;  5HF4 A;  3PV4 A;  5G1D A;  2D8I A;  2H2C A;  1V6B A;  3EGG C;  1SOT A;  3PDZ A;  2L4T A;  3JXT A;  2M0Z A;  4E35 A;  1UIT A;  2H2B A;  5HDY A;  1UEW A;  1NTE A;  3R0H A;  5HET A;  1L6O A;  2IWN A;  2LC6 A;  2O2T A;  2X7Z A;  2M0T A;  4Q2N A;  4K78 A;  1Z86 A;  2CSS A;  5EYZ A;  3CH8 A;  2JWE A;  1U3B A;  4K6Y A;  1X45 A;  4HOP B;  1WIF A;  3KHF A;  1Q7X A;  3QJN A;  3MH4 A;  1FC7 A;  2JIN A;  3GDS A;  5ILB A;  3GCO A;  2K20 A;  1BE9 A;  3I4W A;  2DAZ A;  2KJD A;  3O46 A;  4NMR A;  1R6J A;  2IWP A;  3CBX A;  4JOR A;  1KEF A;  2OZF A;  2FE5 A;  2G2L A;  1VJ6 A;  3QE1 A;  4EDJ A;  3CBY A;  4N6X A;  1P1D A;  5F3X A;  2VRF A;  2OS6 A;  1V1T A;  1N7E A;  3K1R A;  1G9O A;  4E34 A;  4JOF A;  1OBX A;  4JJ0 A;  1GQ4 A;  2I0I A;  2YUY A;  3ZRT A;  2DKR A;  1N6F A;  4NNL A;  1W9Q A;  4JJ3 A;  4K75 A;  4JOJ A;  1X5N A;  5HF1 A;  2V90 A;  2M3M A;  2L4S A;  2EDV A;  2EDZ A;  2VPH A;  2Z9I A;  2LOB A;  2HE2 A;  3OU0 A;  1UM7 A;  3QO6 A;  2KPK A;  2G5M B;  4NMT A;  4O06 A;  1TE0 A;  5HEY A;  1NF3 C;  1WJL A;  3QJM A;  2EAQ A;  5G1E A;  2YTW A;  3MH6 A;  4NXP A;  5HED A;  3LNX A;  1QLC A;  3ID1 A;  4GVC A;  2OPG A;  1SOZ A;  2YUB A;  3GDU A;  1PDR A;  1GQ5 A;  2PNT A;  2IWQ A;  2QKV A;  2MX6 A;  2KL1 A;  2KG2 A;  4KFW A;  4JOP A;  3PS4 A;  1N7T A;  2M0V A;  3DJ1 A;  1VB7 A;  1ZOK A;  1OZI A;  1IHJ A;  2KJK A;  3BPU A;  3O5N A;  5B6L A;  4Z33 A;  3STJ A;  5GND A;  1QAV A;  2D92 A;  5HFE A;  5E6P B;  2Q9V A;  4YYX A;  2KBS A;  3KDG A;  2F0A A;  1VAE A;  3NFL A;  1ZUB A;  1Y8T A;  1OBZ A;  2HGA A;  3ID3 A;  1BFE A;  2FCF A;  5A2P A;  4R2Z A;  2KRG A;  3L4F D;  5DTH A;  2I6V A;  3RLE A;  2EEJ A;  4Q2O A;  1N6D A;  3DJ3 A;  5HEB A;  2OCS A;  2EDP A;  2EXG A;  2YT7 A;  2PDZ A;  1IU0 A;  3RL7 A;  3AXA A;  4UU5 A;  3NCV A;  1UHP A;  3CBZ A;  3VQG A;  5GLJ A;  2UZC A;  2VZ5 A;  2PKT A;  2R4H A;  2Z17 A;  2V1W A;  5FHT A;  1WFG A;  2EEH A;  1X5Q A;  3QIK A;  2JXO A;  1V5Q A;  3GJ9 A;  1WHA A;  2GEF A;  1M5Z A;  2PKU A;  3QGL A;  1K32 A;  1X8S A;  5FB8 C;  2I1N A;  2I0L A;  1UJV A;  3KZE A;  4G69 A;  2KJP A;  1WHD A;  2QBW A;  5E22 A;  2D90 A;  2VSV A;  1RY4 A;  2QKU A;  2WL7 A;  3I1E A;  3GSL A;  4HOP A;  3TSZ A;  2OSG A;  2VWR A;  2CSJ A;  2KPL A;  5F67 A;  1Y7N A;  2F5Y A;  1X9Z A;  3ID4 A;  3R68 A;  2QT5 A;  2EGO A;  3MH7 A;  2OMJ A;  4NMV A;  2LUI A;  4JOE A;  4PQW A;  1I16 A;  1N7F A;  2DC2 A;  1X5R A;  1OBY A;  5HJ1 A;  2ENO A;  3QDO A;  2EGK A;  2E7K A;  3GAB A;  2AIN A;  1RGW A;  1UEZ A;  1UF1 A;  3WKL A;  1UJU A;  3VQF A;  2M10 A;  2FNE A;  2DM8 A;  2JIL A;  3PDV A;  1WI2 A;  3SOE A;  4NMQ A;  4K76 A;  2RRM A;  2FN5 A;  3RL8 A;  1TP3 A;  4Q2Q A;  4P0C A;  4Q3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...