2QG1A

Crystal structure of the 11th pdz domain of mpdz (mupp1)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
89
structure length
89
Chain Sequence
DTLTIGLQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRISTYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multiple PDZ domain protein
publication title Crystal structure of the 11th PDZ domain of MPDZ (MUPP1).
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2qg1A00
2M3MA 2LC6A 2OCSA 4OAJA 5E1YA 3I1EA 3BPUA 2DMZA 4NMOA 2RCZA 3TSWA 1GQ4A 3HPMA 3TSZA 4K72A 2OSGA 4Q2PA 2ZPLA 3QGLA 3DJ3A 1VAEA 5D13A 2CS5A 1N7FA 4K75A 1N6EA 4E34A 3GSLA 2YUYA 1RZXA 4JOHA 4NNLA 5GLJA 2G2LA 4EDJA 2K20A 1I92A 2KQFA 4JOJA 2F0AA 2M0ZA 2QKUA 2GZVA 5E11A 3RLEA 2Q9VA 2MHOA 3B76A 1UFXA 1W9EA 3DJ1A 4Q3HA 3STJA 2KBSA 3NGHA 1Q7XA 2KOHA 1OBYA 5GNDA 1KY9A 2H2CA 4Q2OA 3FY5A 1X6DA 1UF1A 3DORA 2H3LA 2PZDA 3DJAA 5DTHA 5F3XA 3KHFA 4PQWA 5F67A 2KJPA 2QBWA 2LUIA 2EDPA 3CBXA 1Q3OA 1X5QA 5HF4A 2EGNA 2L97A 1IU2A 4JOKA 3HVQC 4Q6SA 1R6JA 2IWPA 5HF1A 5E21A 2EDZA 5HFDA 3PV2A 2D90A 2FN5A 3VQGA 2EGOA 2L4SA 3SOEA 1U37A 3JXTA 3GCNA 1QAVA 2VWRA 1XZ9A 2DM8A 4P2AB 3R68A 4LMMA 4WYUA 3GCOA 2HE2A 4YDPA 3QJNA 5HJ1A 1WFGA 4NXRA 3QE1A 1RGRA 3ID4A 3K1RA 3GDVA 1P1DA 2FNEA 2QG1A 2VSVA 4F8KA 2LA8A 5H3JA 1T2MA 1QAVB 3LNXA 1IU0A 1FCFA 2OQSA 4JORA 5HFEA 1MFGA 4UU6A 5HDYA 1U3BA 3R0HA 2YUBA 3TSVA 1V5LA 3I4WA 1Z87A 1UHPA 1FC7A 1X5NA 4Q6HA 1P1EA 1UM7A 2I04A 2OPGA 1MFLA 4N6XA 1WHAA 3PS4A 3TMHA 5HEDA 5HFBA 1FC9A 1WI4A 2R4HA 2PA1A 1UEPA 1UEZA 5HETA 2OGPA 5E22A 4YYXA 1N7TA 2JXOA 1FC6A 4JOFA 1UJVA 1PDRA 2BYGA 1RY4A 3SHWA 2E7KA 2P3WA 2W4FA 2EV8A 1ZOKA 1SOTA 1WF8A 1OBXA 2D8IA 2DKRA 2KOJA 4JOGA 1NF3C 1QLCA 3EGHC 3MH6A 2YT8A 2V1WA 2I0IA 2H3MA 3L4FD 3E17A 3QIKA 1L6OA 2AWWA 3PDVA 1GM1A 1WG6A 3CYYA 3MH4A 2EEGA 2KV8A 4NMSA 3K82A 1D5GA 1N7EA 2CSSA 1VCWA 3ID2A 1Z86A 2UZCA 4NMQA 1GQ5A 3CH8A 4GVCA 4Q2QA 2IWNA 1WI2A 2D92A 1TP5A 2EEIA 3AXAA 3QO6A 3GJ9A 2L4TA 2PKTA 1N99A 5HEBA 1V62A 4NMRA 1IHJA 4H11A 2EEJA 2M0UA 4O06A 3DIWA 3RL7A 5EZ0A 1V1TA 3WKMA 2EHRA 2EJYA 4REYA 2DLSA 4MPAA 2I6VA 5FHTA 1BFEA 4OEOA 2DC2A 5FB8C 2I4SA 3OTPA 2X7ZA 2KPKA 5B6LA 2KA9A 3PV5A 2AWXA 2KL1A 4JL7A 1UJDA 2KOMA 3I18A 3KZDA 4HOPA 2KYLA 2M10A 2VPHA 4P0CA 1UEWA 1G9OA 1UITA 1RGWA 5G1DA 4Z33A 2W7RA 2G5MB 2DB5A 2ENOA 1TE0A 2HE4A 4JOEA 3NFLA 1U38A 2EXGA 1OBZA 1KEFA 1UM1A 1Y7NA 3ID3A 2KJKA 4HOPB 4UU5A 4KFVA 4NXQA 1X8SA 3ID1A 3SFJA 3RL8A 1LCYA 3EGGC 1VB7A 3WKLA 3NFKA 4AMHA 4L8NA 2CSJA 4IC6A 2YTWA 3CBZA 2MX6A 4NMVA 2KG2A 4NMTA 2K1ZA 1W9QA 2LOBA 3PV4A 2IWOA 4XHVA 2Q3GA 3MH7A 2EGKA 1V5QA 2VZ5A 3O5NA 2JREA 5I7ZA 2EAQA 1VA8A 2Z17A 1WHDA 1M5ZA 2AWUA 4K78A 2LC7A 1KWAA 1N6FA 3PDZA 2F5YA 2JOAA 2JIKA 3HPKA 1I16A 5A2PA 1OZIA 1X5RA 3CS0A 2Z9IA 1VJ6A 4R2ZA 2DJTA 1TQ3A 1YBOA 5EYZA 2M0TA 2EDVA 2REYA 3GDUA 1U39A 2ZPMA 1ZUBA 2R3YA 2O2TA 2QKVA 2M0VA 4RI0A 4E35A 1NTEA 3K50A 4Q2NA 1TP3A 1WH1A 2DLUA 3GGEA 4K76A 3R69A 1WF7A 1N6DA 3ZRTA 3QJMA 2JINA 4NXPA 4OEPA 1SOZA 2QT5A 1WJLA 3CBYA 3VQFA 3QDOA 2OZFA 1W9OA 5HEYA 3SHUA 2EEHA 2JWEA 4GVDA 3LNYA 1MC7A 1WIFA 3KZEA 4JOPA 2QKTA 1BE9A 4WYTA 2H2BA 2JILA 2VSPA 4Z8JA 2I0LA 2VRFA 2KPLA 5JXBA 2KAWA 2KJDA 2PNTA 2PDZA 2IWQA 1Q3PA 2FCFA 2OS6A 4K6YA 1QAUA 3CC0A 1K32A 2HGAA 2I1NA 4NMPA 2FE5A 2DAZA 3GDSA 5E6PB 1Y8TA 4KFWA 4G69A 5HFCA 2KRGA 4GHNA 3SUZA 5G1EA 4E3BA 2V90A 4NNMA 1UEQA 3OU0A 1WFVA 2OMJA 1X45A 1UJUA 1V6BA 4FGMA 2AINA 2WL7A 2YT7A 2PKUA 1B8QA 3O46A 5HFFA 2RRMA
chains in the Genus database with same CATH superfamily
2M3MA 2LC6A 2OCSA 4OAJA 2JSNA 5E1YA 3I1EA 3BPUA 2DMZA 4NMOA 2RCZA 3TSWA 1GQ4A 3HPMA 3TSZA 4K72A 2OSGA 4Q2PA 2ZPLA 3QGLA 3DJ3A 1VAEA 5D13A 2CS5A 1N7FA 4K75A 1N6EA 4E34A 3GSLA 2YUYA 1RZXA 4JOHA 4NNLA 5GLJA 2G2LA 4EDJA 2K20A 1I92A 2KQFA 4JOJA 2F0AA 2M0ZA 2QKUA 2GZVA 5E11A 3RLEA 2Q9VA 2MHOA 3B76A 1UFXA 1W9EA 3DJ1A 4Q3HA 3STJA 2KBSA 3NGHA 1Q7XA 2KOHA 1OBYA 5GNDA 1KY9A 2H2CA 4Q2OA 3FY5A 1X6DA 1UF1A 3DORA 2H3LA 2PZDA 3DJAA 5DTHA 5F3XA 3KHFA 4PQWA 5F67A 2KJPA 2QBWA 2LUIA 2EDPA 3CBXA 1Q3OA 1X5QA 5HF4A 2EGNA 2L97A 1IU2A 1X9ZA 4JOKA 4JJ0A 3HVQC 4Q6SA 1R6JA 2IWPA 5HF1A 5E21A 4FLNA 2EDZA 5HFDA 3PV2A 2D90A 2FN5A 3VQGA 2EGOA 2L4SA 3SOEA 1U37A 3JXTA 3NCVA 3GCNA 1QAVA 2VWRA 1XZ9A 2DM8A 4P2AB 3R68A 4LMMA 4WYUA 3GCOA 2HE2A 4YDPA 3QJNA 5HJ1A 1WFGA 4NXRA 3QE1A 1RGRA 3ID4A 3K1RA 3GDVA 1P1DA 2FNEA 2QG1A 2VSVA 4F8KA 2LA8A 5H3JA 1T2MA 1QAVB 3LNXA 1IU0A 1FCFA 2OQSA 4JORA 5HFEA 1MFGA 4UU6A 5HDYA 1U3BA 3R0HA 2YUBA 3TSVA 1V5LA 3I4WA 1Z87A 1UHPA 1FC7A 1X5NA 4Q6HA 1P1EA 1UM7A 2I04A 2OPGA 1MFLA 4N6XA 1WHAA 3PS4A 3TMHA 5HEDA 5HFBA 1FC9A 1WI4A 2R4HA 2PA1A 1UEPA 1UEZA 5HETA 2OGPA 5E22A 4YYXA 1N7TA 2JXOA 1FC6A 5ILBA 4JOFA 1UJVA 1PDRA 2BYGA 1RY4A 3SHWA 2E7KA 2P3WA 2W4FA 2EV8A 1ZOKA 1SOTA 1WF8A 1OBXA 2D8IA 2DKRA 2KOJA 4JOGA 1NF3C 3EGHC 1QLCA 3MH6A 2YT8A 2V1WA 2I0IA 2H3MA 4JJ3A 3L4FD 3E17A 3QIKA 1L6OA 2AWWA 3PDVA 1GM1A 3CYYA 1WG6A 3MH4A 2EEGA 2KV8A 2GEFA 4NMSA 3K82A 1D5GA 1N7EA 2CSSA 1VCWA 1Z86A 3ID2A 2UZCA 4NMQA 1GQ5A 3CH8A 4GVCA 4Q2QA 2IWNA 1WI2A 2D92A 1TP5A 2EEIA 3AXAA 3QO6A 3GJ9A 2L4TA 2PKTA 1N99A 5HEBA 1V62A 4NMRA 1IHJA 4H11A 3GABA 2EEJA 2M0UA 4O06A 3DIWA 3RL7A 5EZ0A 1V1TA 3WKMA 2EHRA 3KDKA 2EJYA 4REYA 2DLSA 4MPAA 2I6VA 5FHTA 5B42A 1BFEA 4OEOA 2DC2A 5FB8C 2I4SA 3OTPA 2X7ZA 2KPKA 5B6LA 2KA9A 3PV5A 2AWXA 2KL1A 4JL7A 1UJDA 2KOMA 3I18A 3KZDA 4HOPA 2KYLA 2M10A 2VPHA 4P0CA 1UEWA 1G9OA 1UITA 1RGWA 5G1DA 4Z33A 2W7RA 2G5MB 2DB5A 2ENOA 1TE0A 2HE4A 4JOEA 3NFLA 1U38A 2EXGA 1OBZA 1KEFA 1UM1A 1Y7NA 3ID3A 2KJKA 4HOPB 4UU5A 4KFVA 4NXQA 1X8SA 3ID1A 3SFJA 3RL8A 1LCYA 3EGGC 1VB7A 3WKLA 3NFKA 4AMHA 4L8NA 3KDGA 2CSJA 4IC6A 2YTWA 3CBZA 2MX6A 4NMVA 2KG2A 4NMTA 2K1ZA 1W9QA 2LOBA 3PV4A 2IWOA 4XHVA 2Q3GA 3MH7A 2EGKA 1V5QA 2VZ5A 3O5NA 2JREA 5I7ZA 2EAQA 1VA8A 2Z17A 1WHDA 1M5ZA 2AWUA 4K78A 2LC7A 1KWAA 1N6FA 3PDZA 2F5YA 2JOAA 2JIKA 3HPKA 1I16A 5A2PA 1OZIA 1X5RA 3CS0A 2Z9IA 1VJ6A 4R2ZA 2DJTA 1TQ3A 1YBOA 5EYZA 2M0TA 2EDVA 2REYA 3GDUA 1U39A 2ZPMA 1ZUBA 2R3YA 2O2TA 2QKVA 2M0VA 4RI0A 4E35A 1NTEA 3K50A 4Q2NA 1TP3A 1WH1A 2DLUA 3GGEA 4K76A 3R69A 1WF7A 1N6DA 3ZRTA 3QJMA 2JINA 4NXPA 4OEPA 1SOZA 2QT5A 1WJLA 3CBYA 3VQFA 3QDOA 2OZFA 1W9OA 5HEYA 3SHUA 2EEHA 2JWEA 4GVDA 3LNYA 1MC7A 1WIFA 3KZEA 4JOPA 2QKTA 1BE9A 4WYTA 2H2BA 2JILA 2VSPA 4Z8JA 2I0LA 2VRFA 2KPLA 5JXBA 2KAWA 2KJDA 2PNTA 2PDZA 2IWQA 1Q3PA 2FCFA 2OS6A 4K6YA 1QAUA 3CC0A 5IL9A 1K32A 2HGAA 2I1NA 4NMPA 2FE5A 2DAZA 3GDSA 5E6PB 1Y8TA 4KFWA 4G69A 5HFCA 2KRGA 4GHNA 3SUZA 5G1EA 4E3BA 2V90A 4NNMA 1UEQA 3OU0A 1WFVA 2OMJA 1X45A 1UJUA 1V6BA 4FGMA 2AINA 2WL7A 2YT7A 2PKUA 1B8QA 3O46A 5HFFA 2RRMA
chains in the Genus database with same CATH topology
2M3MA 2LC6A 2OCSA 4OAJA 2JSNA 5E1YA 3I1EA 3BPUA 2DMZA 4NMOA 2RCZA 3TSWA 1GQ4A 3HPMA 3TSZA 4K72A 2OSGA 4Q2PA 2ZPLA 3QGLA 3DJ3A 1VAEA 5D13A 2CS5A 1N7FA 4K75A 1N6EA 4E34A 3GSLA 2YUYA 1RZXA 4JOHA 4NNLA 5GLJA 2G2LA 4EDJA 2K20A 1I92A 2KQFA 4JOJA 2F0AA 2M0ZA 2QKUA 2GZVA 5E11A 3RLEA 2Q9VA 2MHOA 3B76A 1UFXA 1W9EA 3DJ1A 4Q3HA 3STJA 2KBSA 3NGHA 1Q7XA 2KOHA 1OBYA 5GNDA 1KY9A 2H2CA 4Q2OA 3FY5A 1X6DA 1UF1A 3DORA 2H3LA 2PZDA 3DJAA 5DTHA 5F3XA 3KHFA 4PQWA 5F67A 2KJPA 2QBWA 2LUIA 2EDPA 3CBXA 1Q3OA 1X5QA 5HF4A 2EGNA 2L97A 1IU2A 1X9ZA 4JOKA 4JJ0A 3HVQC 4Q6SA 1R6JA 2IWPA 5HF1A 5E21A 4FLNA 2EDZA 5HFDA 3PV2A 2D90A 2FN5A 3VQGA 2EGOA 2L4SA 3SOEA 1U37A 3JXTA 3NCVA 3GCNA 1QAVA 2VWRA 1XZ9A 2DM8A 4P2AB 3R68A 4LMMA 4WYUA 3GCOA 2HE2A 4YDPA 3QJNA 5HJ1A 1WFGA 4NXRA 3QE1A 1RGRA 3ID4A 3K1RA 3GDVA 1P1DA 2FNEA 2QG1A 2VSVA 4F8KA 2LA8A 5H3JA 1T2MA 1QAVB 3LNXA 1IU0A 1FCFA 2OQSA 4JORA 5HFEA 1MFGA 4UU6A 5HDYA 1U3BA 3R0HA 2YUBA 3TSVA 1V5LA 3I4WA 1Z87A 1UHPA 1FC7A 1X5NA 4Q6HA 1P1EA 1UM7A 2I04A 2OPGA 1MFLA 4N6XA 1WHAA 3PS4A 3TMHA 5HEDA 5HFBA 1FC9A 1WI4A 2R4HA 2PA1A 1UEPA 1UEZA 5HETA 2OGPA 5E22A 4YYXA 1N7TA 2JXOA 1FC6A 5ILBA 4JOFA 1UJVA 1PDRA 2BYGA 1RY4A 3SHWA 2E7KA 2P3WA 2W4FA 2EV8A 1ZOKA 1SOTA 1WF8A 1OBXA 2D8IA 2DKRA 2KOJA 4JOGA 1NF3C 3EGHC 1QLCA 3MH6A 2YT8A 2V1WA 2I0IA 2H3MA 4JJ3A 3L4FD 3E17A 3QIKA 1L6OA 2AWWA 3PDVA 1GM1A 3CYYA 1WG6A 3MH4A 2EEGA 2KV8A 2GEFA 4NMSA 3K82A 1D5GA 1N7EA 2CSSA 1VCWA 1Z86A 3ID2A 2UZCA 4NMQA 1GQ5A 3CH8A 4GVCA 4Q2QA 2IWNA 1WI2A 2D92A 1TP5A 2EEIA 3AXAA 3QO6A 3GJ9A 2L4TA 2PKTA 1N99A 5HEBA 1V62A 4NMRA 1IHJA 4H11A 3GABA 2EEJA 2M0UA 4O06A 3DIWA 3RL7A 5EZ0A 1V1TA 3WKMA 2EHRA 3KDKA 2EJYA 4REYA 2DLSA 4MPAA 2I6VA 5FHTA 5B42A 1BFEA 4OEOA 2DC2A 5FB8C 2I4SA 3OTPA 2X7ZA 2KPKA 5B6LA 2KA9A 3PV5A 2AWXA 2KL1A 4JL7A 1UJDA 2KOMA 3I18A 3KZDA 4HOPA 2KYLA 2M10A 2VPHA 4P0CA 1UEWA 1G9OA 1UITA 1RGWA 5G1DA 4Z33A 2W7RA 2G5MB 2DB5A 2ENOA 1TE0A 2HE4A 4JOEA 3NFLA 1U38A 2EXGA 1OBZA 1KEFA 1UM1A 1Y7NA 3ID3A 2KJKA 4HOPB 4UU5A 4KFVA 4NXQA 1X8SA 3ID1A 3SFJA 3RL8A 1LCYA 3EGGC 1VB7A 3WKLA 3NFKA 4AMHA 4L8NA 3KDGA 2CSJA 4IC6A 2YTWA 3CBZA 2MX6A 4NMVA 2KG2A 4NMTA 2K1ZA 1W9QA 2LOBA 3PV4A 2IWOA 4XHVA 2Q3GA 3MH7A 2EGKA 1V5QA 2VZ5A 3O5NA 2JREA 5I7ZA 2EAQA 1VA8A 2Z17A 1WHDA 1M5ZA 2AWUA 4K78A 2LC7A 1KWAA 1N6FA 3PDZA 2F5YA 2JOAA 2JIKA 3HPKA 1I16A 5A2PA 1OZIA 1X5RA 3CS0A 2Z9IA 1VJ6A 4R2ZA 2DJTA 1TQ3A 1YBOA 5EYZA 2M0TA 2EDVA 2REYA 3GDUA 1U39A 2ZPMA 1ZUBA 2R3YA 2O2TA 2QKVA 2M0VA 4RI0A 4E35A 1NTEA 3K50A 4Q2NA 1TP3A 1WH1A 2DLUA 3GGEA 4K76A 3R69A 1WF7A 1N6DA 3ZRTA 3QJMA 2JINA 4NXPA 4OEPA 1SOZA 2QT5A 1WJLA 3CBYA 3VQFA 3QDOA 2OZFA 1W9OA 5HEYA 3SHUA 2EEHA 2JWEA 4GVDA 3LNYA 1MC7A 1WIFA 3KZEA 4JOPA 2QKTA 1BE9A 4WYTA 2H2BA 2JILA 2VSPA 4Z8JA 2I0LA 2VRFA 2KPLA 5JXBA 2KAWA 2KJDA 2PNTA 2PDZA 2IWQA 1Q3PA 2FCFA 2OS6A 4K6YA 1QAUA 3CC0A 5IL9A 1K32A 2HGAA 2I1NA 4NMPA 2FE5A 2DAZA 3GDSA 5E6PB 1Y8TA 4KFWA 4G69A 5HFCA 2KRGA 4GHNA 3SUZA 5G1EA 4E3BA 2V90A 4NNMA 1UEQA 3OU0A 1WFVA 2OMJA 1X45A 1UJUA 1V6BA 4FGMA 2AINA 2WL7A 2YT7A 2PKUA 1B8QA 3O46A 5HFFA 2RRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3M A;  2LC6 A;  2OCS A;  4OAJ A;  5E1Y A;  3I1E A;  3BPU A;  2DMZ A;  4NMO A;  2RCZ A;  3TSW A;  1GQ4 A;  3HPM A;  3TSZ A;  4K72 A;  2OSG A;  4Q2P A;  2ZPL A;  3QGL A;  3DJ3 A;  1VAE A;  5D13 A;  2CS5 A;  1N7F A;  4K75 A;  1N6E A;  4E34 A;  3GSL A;  2YUY A;  1RZX A;  4JOH A;  4NNL A;  5GLJ A;  2G2L A;  4EDJ A;  2K20 A;  1I92 A;  2KQF A;  4JOJ A;  2F0A A;  2M0Z A;  2QKU A;  2GZV A;  5E11 A;  3RLE A;  2Q9V A;  2MHO A;  3B76 A;  1UFX A;  1W9E A;  3DJ1 A;  4Q3H A;  3STJ A;  2KBS A;  3NGH A;  1Q7X A;  2KOH A;  1OBY A;  5GND A;  1KY9 A;  2H2C A;  4Q2O A;  3FY5 A;  1X6D A;  1UF1 A;  3DOR A;  2H3L A;  2PZD A;  3DJA A;  5DTH A;  5F3X A;  3KHF A;  4PQW A;  5F67 A;  2KJP A;  2QBW A;  2LUI A;  2EDP A;  3CBX A;  1Q3O A;  1X5Q A;  5HF4 A;  2EGN A;  2L97 A;  1IU2 A;  4JOK A;  3HVQ C;  4Q6S A;  1R6J A;  2IWP A;  5HF1 A;  5E21 A;  2EDZ A;  5HFD A;  3PV2 A;  2D90 A;  2FN5 A;  3VQG A;  2EGO A;  2L4S A;  3SOE A;  1U37 A;  3JXT A;  3GCN A;  1QAV A;  2VWR A;  1XZ9 A;  2DM8 A;  4P2A B;  3R68 A;  4LMM A;  4WYU A;  3GCO A;  2HE2 A;  4YDP A;  3QJN A;  5HJ1 A;  1WFG A;  4NXR A;  3QE1 A;  1RGR A;  3ID4 A;  3K1R A;  3GDV A;  1P1D A;  2FNE A;  2QG1 A;  2VSV A;  4F8K A;  2LA8 A;  5H3J A;  1T2M A;  1QAV B;  3LNX A;  1IU0 A;  1FCF A;  2OQS A;  4JOR A;  5HFE A;  1MFG A;  4UU6 A;  5HDY A;  1U3B A;  3R0H A;  2YUB A;  3TSV A;  1V5L A;  3I4W A;  1Z87 A;  1UHP A;  1FC7 A;  1X5N A;  4Q6H A;  1P1E A;  1UM7 A;  2I04 A;  2OPG A;  1MFL A;  4N6X A;  1WHA A;  3PS4 A;  3TMH A;  5HED A;  5HFB A;  1FC9 A;  1WI4 A;  2R4H A;  2PA1 A;  1UEP A;  1UEZ A;  5HET A;  2OGP A;  5E22 A;  4YYX A;  1N7T A;  2JXO A;  1FC6 A;  4JOF A;  1UJV A;  1PDR A;  2BYG A;  1RY4 A;  3SHW A;  2E7K A;  2P3W A;  2W4F A;  2EV8 A;  1ZOK A;  1SOT A;  1WF8 A;  1OBX A;  2D8I A;  2DKR A;  2KOJ A;  4JOG A;  1NF3 C;  1QLC A;  3EGH C;  3MH6 A;  2YT8 A;  2V1W A;  2I0I A;  2H3M A;  3L4F D;  3E17 A;  3QIK A;  1L6O A;  2AWW A;  3PDV A;  1GM1 A;  1WG6 A;  3CYY A;  3MH4 A;  2EEG A;  2KV8 A;  4NMS A;  3K82 A;  1D5G A;  1N7E A;  2CSS A;  1VCW A;  3ID2 A;  1Z86 A;  2UZC A;  4NMQ A;  1GQ5 A;  3CH8 A;  4GVC A;  4Q2Q A;  2IWN A;  1WI2 A;  2D92 A;  1TP5 A;  2EEI A;  3AXA A;  3QO6 A;  3GJ9 A;  2L4T A;  2PKT A;  1N99 A;  5HEB A;  1V62 A;  4NMR A;  1IHJ A;  4H11 A;  2EEJ A;  2M0U A;  4O06 A;  3DIW A;  3RL7 A;  5EZ0 A;  1V1T A;  3WKM A;  2EHR A;  2EJY A;  4REY A;  2DLS A;  4MPA A;  2I6V A;  5FHT A;  1BFE A;  4OEO A;  2DC2 A;  5FB8 C;  2I4S A;  3OTP A;  2X7Z A;  2KPK A;  5B6L A;  2KA9 A;  3PV5 A;  2AWX A;  2KL1 A;  4JL7 A;  1UJD A;  2KOM A;  3I18 A;  3KZD A;  4HOP A;  2KYL A;  2M10 A;  2VPH A;  4P0C A;  1UEW A;  1G9O A;  1UIT A;  1RGW A;  5G1D A;  4Z33 A;  2W7R A;  2G5M B;  2DB5 A;  2ENO A;  1TE0 A;  2HE4 A;  4JOE A;  3NFL A;  1U38 A;  2EXG A;  1OBZ A;  1KEF A;  1UM1 A;  1Y7N A;  3ID3 A;  2KJK A;  4HOP B;  4UU5 A;  4KFV A;  4NXQ A;  1X8S A;  3ID1 A;  3SFJ A;  3RL8 A;  1LCY A;  3EGG C;  1VB7 A;  3WKL A;  3NFK A;  4AMH A;  4L8N A;  2CSJ A;  4IC6 A;  2YTW A;  3CBZ A;  2MX6 A;  4NMV A;  2KG2 A;  4NMT A;  2K1Z A;  1W9Q A;  2LOB A;  3PV4 A;  2IWO A;  4XHV A;  2Q3G A;  3MH7 A;  2EGK A;  1V5Q A;  2VZ5 A;  3O5N A;  2JRE A;  5I7Z A;  2EAQ A;  1VA8 A;  2Z17 A;  1WHD A;  1M5Z A;  2AWU A;  4K78 A;  2LC7 A;  1KWA A;  1N6F A;  3PDZ A;  2F5Y A;  2JOA A;  2JIK A;  3HPK A;  1I16 A;  5A2P A;  1OZI A;  1X5R A;  3CS0 A;  2Z9I A;  1VJ6 A;  4R2Z A;  2DJT A;  1TQ3 A;  1YBO A;  5EYZ A;  2M0T A;  2EDV A;  2REY A;  3GDU A;  1U39 A;  2ZPM A;  1ZUB A;  2R3Y A;  2O2T A;  2QKV A;  2M0V A;  4RI0 A;  4E35 A;  1NTE A;  3K50 A;  4Q2N A;  1TP3 A;  1WH1 A;  2DLU A;  3GGE A;  4K76 A;  3R69 A;  1WF7 A;  1N6D A;  3ZRT A;  3QJM A;  2JIN A;  4NXP A;  4OEP A;  1SOZ A;  2QT5 A;  1WJL A;  3CBY A;  3VQF A;  3QDO A;  2OZF A;  1W9O A;  5HEY A;  3SHU A;  2EEH A;  2JWE A;  4GVD A;  3LNY A;  1MC7 A;  1WIF A;  3KZE A;  4JOP A;  2QKT A;  1BE9 A;  4WYT A;  2H2B A;  2JIL A;  2VSP A;  4Z8J A;  2I0L A;  2VRF A;  2KPL A;  5JXB A;  2KAW A;  2KJD A;  2PNT A;  2PDZ A;  2IWQ A;  1Q3P A;  2FCF A;  2OS6 A;  4K6Y A;  1QAU A;  3CC0 A;  1K32 A;  2HGA A;  2I1N A;  4NMP A;  2FE5 A;  2DAZ A;  3GDS A;  5E6P B;  1Y8T A;  4KFW A;  4G69 A;  5HFC A;  2KRG A;  4GHN A;  3SUZ A;  5G1E A;  4E3B A;  2V90 A;  4NNM A;  1UEQ A;  3OU0 A;  1WFV A;  2OMJ A;  1X45 A;  1UJU A;  1V6B A;  4FGM A;  2AIN A;  2WL7 A;  2YT7 A;  2PKU A;  1B8Q A;  3O46 A;  5HFF A;  2RRM A; 
#chains in the Genus database with same CATH topology
 2M3M A;  2LC6 A;  2OCS A;  4OAJ A;  2JSN A;  5E1Y A;  3I1E A;  3BPU A;  2DMZ A;  4NMO A;  2RCZ A;  3TSW A;  1GQ4 A;  3HPM A;  3TSZ A;  4K72 A;  2OSG A;  4Q2P A;  2ZPL A;  3QGL A;  3DJ3 A;  1VAE A;  5D13 A;  2CS5 A;  1N7F A;  4K75 A;  1N6E A;  4E34 A;  3GSL A;  2YUY A;  1RZX A;  4JOH A;  4NNL A;  5GLJ A;  2G2L A;  4EDJ A;  2K20 A;  1I92 A;  2KQF A;  4JOJ A;  2F0A A;  2M0Z A;  2QKU A;  2GZV A;  5E11 A;  3RLE A;  2Q9V A;  2MHO A;  3B76 A;  1UFX A;  1W9E A;  3DJ1 A;  4Q3H A;  3STJ A;  2KBS A;  3NGH A;  1Q7X A;  2KOH A;  1OBY A;  5GND A;  1KY9 A;  2H2C A;  4Q2O A;  3FY5 A;  1X6D A;  1UF1 A;  3DOR A;  2H3L A;  2PZD A;  3DJA A;  5DTH A;  5F3X A;  3KHF A;  4PQW A;  5F67 A;  2KJP A;  2QBW A;  2LUI A;  2EDP A;  3CBX A;  1Q3O A;  1X5Q A;  5HF4 A;  2EGN A;  2L97 A;  1IU2 A;  1X9Z A;  4JOK A;  4JJ0 A;  3HVQ C;  4Q6S A;  1R6J A;  2IWP A;  5HF1 A;  5E21 A;  4FLN A;  2EDZ A;  5HFD A;  3PV2 A;  2D90 A;  2FN5 A;  3VQG A;  2EGO A;  2L4S A;  3SOE A;  1U37 A;  3JXT A;  3NCV A;  3GCN A;  1QAV A;  2VWR A;  1XZ9 A;  2DM8 A;  4P2A B;  3R68 A;  4LMM A;  4WYU A;  3GCO A;  2HE2 A;  4YDP A;  3QJN A;  5HJ1 A;  1WFG A;  4NXR A;  3QE1 A;  1RGR A;  3ID4 A;  3K1R A;  3GDV A;  1P1D A;  2FNE A;  2QG1 A;  2VSV A;  4F8K A;  2LA8 A;  5H3J A;  1T2M A;  1QAV B;  3LNX A;  1IU0 A;  1FCF A;  2OQS A;  4JOR A;  5HFE A;  1MFG A;  4UU6 A;  5HDY A;  1U3B A;  3R0H A;  2YUB A;  3TSV A;  1V5L A;  3I4W A;  1Z87 A;  1UHP A;  1FC7 A;  1X5N A;  4Q6H A;  1P1E A;  1UM7 A;  2I04 A;  2OPG A;  1MFL A;  4N6X A;  1WHA A;  3PS4 A;  3TMH A;  5HED A;  5HFB A;  1FC9 A;  1WI4 A;  2R4H A;  2PA1 A;  1UEP A;  1UEZ A;  5HET A;  2OGP A;  5E22 A;  4YYX A;  1N7T A;  2JXO A;  1FC6 A;  5ILB A;  4JOF A;  1UJV A;  1PDR A;  2BYG A;  1RY4 A;  3SHW A;  2E7K A;  2P3W A;  2W4F A;  2EV8 A;  1ZOK A;  1SOT A;  1WF8 A;  1OBX A;  2D8I A;  2DKR A;  2KOJ A;  4JOG A;  1NF3 C;  3EGH C;  1QLC A;  3MH6 A;  2YT8 A;  2V1W A;  2I0I A;  2H3M A;  4JJ3 A;  3L4F D;  3E17 A;  3QIK A;  1L6O A;  2AWW A;  3PDV A;  1GM1 A;  3CYY A;  1WG6 A;  3MH4 A;  2EEG A;  2KV8 A;  2GEF A;  4NMS A;  3K82 A;  1D5G A;  1N7E A;  2CSS A;  1VCW A;  1Z86 A;  3ID2 A;  2UZC A;  4NMQ A;  1GQ5 A;  3CH8 A;  4GVC A;  4Q2Q A;  2IWN A;  1WI2 A;  2D92 A;  1TP5 A;  2EEI A;  3AXA A;  3QO6 A;  3GJ9 A;  2L4T A;  2PKT A;  1N99 A;  5HEB A;  1V62 A;  4NMR A;  1IHJ A;  4H11 A;  3GAB A;  2EEJ A;  2M0U A;  4O06 A;  3DIW A;  3RL7 A;  5EZ0 A;  1V1T A;  3WKM A;  2EHR A;  3KDK A;  2EJY A;  4REY A;  2DLS A;  4MPA A;  2I6V A;  5FHT A;  5B42 A;  1BFE A;  4OEO A;  2DC2 A;  5FB8 C;  2I4S A;  3OTP A;  2X7Z A;  2KPK A;  5B6L A;  2KA9 A;  3PV5 A;  2AWX A;  2KL1 A;  4JL7 A;  1UJD A;  2KOM A;  3I18 A;  3KZD A;  4HOP A;  2KYL A;  2M10 A;  2VPH A;  4P0C A;  1UEW A;  1G9O A;  1UIT A;  1RGW A;  5G1D A;  4Z33 A;  2W7R A;  2G5M B;  2DB5 A;  2ENO A;  1TE0 A;  2HE4 A;  4JOE A;  3NFL A;  1U38 A;  2EXG A;  1OBZ A;  1KEF A;  1UM1 A;  1Y7N A;  3ID3 A;  2KJK A;  4HOP B;  4UU5 A;  4KFV A;  4NXQ A;  1X8S A;  3ID1 A;  3SFJ A;  3RL8 A;  1LCY A;  3EGG C;  1VB7 A;  3WKL A;  3NFK A;  4AMH A;  4L8N A;  3KDG A;  2CSJ A;  4IC6 A;  2YTW A;  3CBZ A;  2MX6 A;  4NMV A;  2KG2 A;  4NMT A;  2K1Z A;  1W9Q A;  2LOB A;  3PV4 A;  2IWO A;  4XHV A;  2Q3G A;  3MH7 A;  2EGK A;  1V5Q A;  2VZ5 A;  3O5N A;  2JRE A;  5I7Z A;  2EAQ A;  1VA8 A;  2Z17 A;  1WHD A;  1M5Z A;  2AWU A;  4K78 A;  2LC7 A;  1KWA A;  1N6F A;  3PDZ A;  2F5Y A;  2JOA A;  2JIK A;  3HPK A;  1I16 A;  5A2P A;  1OZI A;  1X5R A;  3CS0 A;  2Z9I A;  1VJ6 A;  4R2Z A;  2DJT A;  1TQ3 A;  1YBO A;  5EYZ A;  2M0T A;  2EDV A;  2REY A;  3GDU A;  1U39 A;  2ZPM A;  1ZUB A;  2R3Y A;  2O2T A;  2QKV A;  2M0V A;  4RI0 A;  4E35 A;  1NTE A;  3K50 A;  4Q2N A;  1TP3 A;  1WH1 A;  2DLU A;  3GGE A;  4K76 A;  3R69 A;  1WF7 A;  1N6D A;  3ZRT A;  3QJM A;  2JIN A;  4NXP A;  4OEP A;  1SOZ A;  2QT5 A;  1WJL A;  3CBY A;  3VQF A;  3QDO A;  2OZF A;  1W9O A;  5HEY A;  3SHU A;  2EEH A;  2JWE A;  4GVD A;  3LNY A;  1MC7 A;  1WIF A;  3KZE A;  4JOP A;  2QKT A;  1BE9 A;  4WYT A;  2H2B A;  2JIL A;  2VSP A;  4Z8J A;  2I0L A;  2VRF A;  2KPL A;  5JXB A;  2KAW A;  2KJD A;  2PNT A;  2PDZ A;  2IWQ A;  1Q3P A;  2FCF A;  2OS6 A;  4K6Y A;  1QAU A;  3CC0 A;  5IL9 A;  1K32 A;  2HGA A;  2I1N A;  4NMP A;  2FE5 A;  2DAZ A;  3GDS A;  5E6P B;  1Y8T A;  4KFW A;  4G69 A;  5HFC A;  2KRG A;  4GHN A;  3SUZ A;  5G1E A;  4E3B A;  2V90 A;  4NNM A;  1UEQ A;  3OU0 A;  1WFV A;  2OMJ A;  1X45 A;  1UJU A;  1V6B A;  4FGM A;  2AIN A;  2WL7 A;  2YT7 A;  2PKU A;  1B8Q A;  3O46 A;  5HFF A;  2RRM A; 
#chains in the Genus database with same CATH homology
 2M3M A;  2LC6 A;  2OCS A;  4OAJ A;  2JSN A;  5E1Y A;  3I1E A;  3BPU A;  2DMZ A;  4NMO A;  2RCZ A;  3TSW A;  1GQ4 A;  3HPM A;  3TSZ A;  4K72 A;  2OSG A;  4Q2P A;  2ZPL A;  3QGL A;  3DJ3 A;  1VAE A;  5D13 A;  2CS5 A;  1N7F A;  4K75 A;  1N6E A;  4E34 A;  3GSL A;  2YUY A;  1RZX A;  4JOH A;  4NNL A;  5GLJ A;  2G2L A;  4EDJ A;  2K20 A;  1I92 A;  2KQF A;  4JOJ A;  2F0A A;  2M0Z A;  2QKU A;  2GZV A;  5E11 A;  3RLE A;  2Q9V A;  2MHO A;  3B76 A;  1UFX A;  1W9E A;  3DJ1 A;  4Q3H A;  3STJ A;  2KBS A;  3NGH A;  1Q7X A;  2KOH A;  1OBY A;  5GND A;  1KY9 A;  2H2C A;  4Q2O A;  3FY5 A;  1X6D A;  1UF1 A;  3DOR A;  2H3L A;  2PZD A;  3DJA A;  5DTH A;  5F3X A;  3KHF A;  4PQW A;  5F67 A;  2KJP A;  2QBW A;  2LUI A;  2EDP A;  3CBX A;  1Q3O A;  1X5Q A;  5HF4 A;  2EGN A;  2L97 A;  1IU2 A;  1X9Z A;  4JOK A;  4JJ0 A;  3HVQ C;  4Q6S A;  1R6J A;  2IWP A;  5HF1 A;  5E21 A;  4FLN A;  2EDZ A;  5HFD A;  3PV2 A;  2D90 A;  2FN5 A;  3VQG A;  2EGO A;  2L4S A;  3SOE A;  1U37 A;  3JXT A;  3NCV A;  3GCN A;  1QAV A;  2VWR A;  1XZ9 A;  2DM8 A;  4P2A B;  3R68 A;  4LMM A;  4WYU A;  3GCO A;  2HE2 A;  4YDP A;  3QJN A;  5HJ1 A;  1WFG A;  4NXR A;  3QE1 A;  1RGR A;  3ID4 A;  3K1R A;  3GDV A;  1P1D A;  2FNE A;  2QG1 A;  2VSV A;  4F8K A;  2LA8 A;  5H3J A;  1T2M A;  1QAV B;  3LNX A;  1IU0 A;  1FCF A;  2OQS A;  4JOR A;  5HFE A;  1MFG A;  4UU6 A;  5HDY A;  1U3B A;  3R0H A;  2YUB A;  3TSV A;  1V5L A;  3I4W A;  1Z87 A;  1UHP A;  1FC7 A;  1X5N A;  4Q6H A;  1P1E A;  1UM7 A;  2I04 A;  2OPG A;  1MFL A;  4N6X A;  1WHA A;  3PS4 A;  3TMH A;  5HED A;  5HFB A;  1FC9 A;  1WI4 A;  2R4H A;  2PA1 A;  1UEP A;  1UEZ A;  5HET A;  2OGP A;  5E22 A;  4YYX A;  1N7T A;  2JXO A;  1FC6 A;  5ILB A;  4JOF A;  1UJV A;  1PDR A;  2BYG A;  1RY4 A;  3SHW A;  2E7K A;  2P3W A;  2W4F A;  2EV8 A;  1ZOK A;  1SOT A;  1WF8 A;  1OBX A;  2D8I A;  2DKR A;  2KOJ A;  4JOG A;  1NF3 C;  3EGH C;  1QLC A;  3MH6 A;  2YT8 A;  2V1W A;  2I0I A;  2H3M A;  4JJ3 A;  3L4F D;  3E17 A;  3QIK A;  1L6O A;  2AWW A;  3PDV A;  1GM1 A;  3CYY A;  1WG6 A;  3MH4 A;  2EEG A;  2KV8 A;  2GEF A;  4NMS A;  3K82 A;  1D5G A;  1N7E A;  2CSS A;  1VCW A;  1Z86 A;  3ID2 A;  2UZC A;  4NMQ A;  1GQ5 A;  3CH8 A;  4GVC A;  4Q2Q A;  2IWN A;  1WI2 A;  2D92 A;  1TP5 A;  2EEI A;  3AXA A;  3QO6 A;  3GJ9 A;  2L4T A;  2PKT A;  1N99 A;  5HEB A;  1V62 A;  4NMR A;  1IHJ A;  4H11 A;  3GAB A;  2EEJ A;  2M0U A;  4O06 A;  3DIW A;  3RL7 A;  5EZ0 A;  1V1T A;  3WKM A;  2EHR A;  3KDK A;  2EJY A;  4REY A;  2DLS A;  4MPA A;  2I6V A;  5FHT A;  5B42 A;  1BFE A;  4OEO A;  2DC2 A;  5FB8 C;  2I4S A;  3OTP A;  2X7Z A;  2KPK A;  5B6L A;  2KA9 A;  3PV5 A;  2AWX A;  2KL1 A;  4JL7 A;  1UJD A;  2KOM A;  3I18 A;  3KZD A;  4HOP A;  2KYL A;  2M10 A;  2VPH A;  4P0C A;  1UEW A;  1G9O A;  1UIT A;  1RGW A;  5G1D A;  4Z33 A;  2W7R A;  2G5M B;  2DB5 A;  2ENO A;  1TE0 A;  2HE4 A;  4JOE A;  3NFL A;  1U38 A;  2EXG A;  1OBZ A;  1KEF A;  1UM1 A;  1Y7N A;  3ID3 A;  2KJK A;  4HOP B;  4UU5 A;  4KFV A;  4NXQ A;  1X8S A;  3ID1 A;  3SFJ A;  3RL8 A;  1LCY A;  3EGG C;  1VB7 A;  3WKL A;  3NFK A;  4AMH A;  4L8N A;  3KDG A;  2CSJ A;  4IC6 A;  2YTW A;  3CBZ A;  2MX6 A;  4NMV A;  2KG2 A;  4NMT A;  2K1Z A;  1W9Q A;  2LOB A;  3PV4 A;  2IWO A;  4XHV A;  2Q3G A;  3MH7 A;  2EGK A;  1V5Q A;  2VZ5 A;  3O5N A;  2JRE A;  5I7Z A;  2EAQ A;  1VA8 A;  2Z17 A;  1WHD A;  1M5Z A;  2AWU A;  4K78 A;  2LC7 A;  1KWA A;  1N6F A;  3PDZ A;  2F5Y A;  2JOA A;  2JIK A;  3HPK A;  1I16 A;  5A2P A;  1OZI A;  1X5R A;  3CS0 A;  2Z9I A;  1VJ6 A;  4R2Z A;  2DJT A;  1TQ3 A;  1YBO A;  5EYZ A;  2M0T A;  2EDV A;  2REY A;  3GDU A;  1U39 A;  2ZPM A;  1ZUB A;  2R3Y A;  2O2T A;  2QKV A;  2M0V A;  4RI0 A;  4E35 A;  1NTE A;  3K50 A;  4Q2N A;  1TP3 A;  1WH1 A;  2DLU A;  3GGE A;  4K76 A;  3R69 A;  1WF7 A;  1N6D A;  3ZRT A;  3QJM A;  2JIN A;  4NXP A;  4OEP A;  1SOZ A;  2QT5 A;  1WJL A;  3CBY A;  3VQF A;  3QDO A;  2OZF A;  1W9O A;  5HEY A;  3SHU A;  2EEH A;  2JWE A;  4GVD A;  3LNY A;  1MC7 A;  1WIF A;  3KZE A;  4JOP A;  2QKT A;  1BE9 A;  4WYT A;  2H2B A;  2JIL A;  2VSP A;  4Z8J A;  2I0L A;  2VRF A;  2KPL A;  5JXB A;  2KAW A;  2KJD A;  2PNT A;  2PDZ A;  2IWQ A;  1Q3P A;  2FCF A;  2OS6 A;  4K6Y A;  1QAU A;  3CC0 A;  5IL9 A;  1K32 A;  2HGA A;  2I1N A;  4NMP A;  2FE5 A;  2DAZ A;  3GDS A;  5E6P B;  1Y8T A;  4KFW A;  4G69 A;  5HFC A;  2KRG A;  4GHN A;  3SUZ A;  5G1E A;  4E3B A;  2V90 A;  4NNM A;  1UEQ A;  3OU0 A;  1WFV A;  2OMJ A;  1X45 A;  1UJU A;  1V6B A;  4FGM A;  2AIN A;  2WL7 A;  2YT7 A;  2PKU A;  1B8Q A;  3O46 A;  5HFF A;  2RRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...