1YBOA

Crystal structure of the pdz tandem of human syntenin with syndecan peptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
163
structure length
163
Chain Sequence
DPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntenin 1
publication title The binding of the PDZ tandem of syntenin to target proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 38
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1yboA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1yboA01
3CH8A 2Z9IA 3BPUA 3NFLA 2EGOA 1KWAA 1WHDA 2M10A 5HF1A 2L4SA 2WL7A 5I7ZA 1X8SA 1UJDA 4OEPA 2I0IA 4NMTA 2D90A 2OQSA 1NF3C 3GDVA 2H3MA 2VSPA 2JXOA 2EDPA 4YDPA 3QDOA 2Z17A 4K76A 1V1TA 2EEJA 5HEBA 2OCSA 1RZXA 3NFKA 1D5GA 2RRMA 3QE1A 5HFEA 3GDUA 3R0HA 4Q2OA 3R69A 2JILA 4G69A 1X5RA 1QAUA 3PV2A 2KPLA 2EJYA 2OPGA 3SFJA 5E6PB 1WF7A 1X5QA 3AXAA 1UHPA 3JXTA 2KBSA 3TSZA 1TE0A 3SUZA 5G1DA 1FC6A 4Q3HA 3ID1A 1V62A 3PS4A 2IWPA 4Q2PA 5HFFA 3RLEA 3ZRTA 1YBOA 1P1DA 3SHUA 4NXRA 2FE5A 3PDZA 4KFWA 5HF4A 3DORA 1OZIA 3SOEA 5HJ1A 4OAJA 5F3XA 5E22A 3QO6A 4GHNA 1W9EA 2EXGA 3I4WA 2EEIA 2KG2A 4E3BA 2VRFA 4GVCA 5GLJA 1LCYA 5HFBA 4HOPB 5HDYA 5E21A 1FCFA 3CBZA 3B76A 1SOTA 2KYLA 2KL1A 1Q7XA 4LMMA 4WYTA 2PKUA 2JREA 3FY5A 3E17A 5FHTA 2JINA 1TQ3A 3QJNA 2KA9A 2Q3GA 2VZ5A 3GCOA 4NXQA 2P3WA 4H11A 4UU5A 3TSWA 1QAVB 4YYXA 4P0CA 2I6VA 3EGGC 1T2MA 1UJUA 3K50A 5EZ0A 2EV8A 5B6LA 3GSLA 1K32A 2AWUA 2FN5A 3CS0A 2G5MB 2ZPMA 1WIFA 2R3YA 2OGPA 2I1NA 5FB8C 3RL8A 1B8QA 1Y7NA 2H3LA 2KOHA 4JOFA 2KJPA 1WJLA 1VB7A 1SOZA 4NNMA 2AWWA 3O5NA 5D13A 1RGWA 4Z33A 3CBYA 4R2ZA 2H2BA 4JOHA 5E1YA 3DJ3A 3CBXA 3PDVA 4NMOA 2YTWA 2LC6A 4NNLA 2PA1A 2L4TA 1I16A 1VCWA 1RY4A 4WYUA 4Z8JA 2QG1A 3QGLA 1WFGA 2EGNA 2QKTA 1UITA 2LUIA 2IWQA 1RGRA 2VSVA 1M5ZA 2UZCA 2QT5A 1OBYA 4K72A 2H2CA 2AINA 4L8NA 3VQFA 2F0AA 1OBZA 4K78A 1MC7A 2OSGA 5HFDA 3I18A 3MH7A 2I04A 5G1EA 1UF1A 1VAEA 2YUBA 1MFGA 2ZPLA 4O06A 1I92A 2KQFA 1Q3PA 1W9QA 1UEWA 1VJ6A 1Z87A 3ID4A 2DKRA 1WI2A 2IWOA 3GCNA 4OEOA 2I4SA 1G9OA 2JIKA 3KZDA 3SHWA 3MH4A 3GGEA 3LNXA 2ENOA 4Q2NA 3OU0A 1FC7A 5DTHA 3ID3A 4NMSA 2M0TA 3WKMA 1R6JA 2JWEA 2VPHA 1V5QA 2HGAA 2KJKA 1UJVA 5GNDA 2OZFA 1ZUBA 1N99A 3ID2A 5F67A 2QKVA 2MHOA 4Q6SA 1N6EA 3HVQC 2D8IA 2G2LA 2K20A 1X45A 2PDZA 1WI4A 4Q2QA 4JOPA 3HPKA 2M0ZA 2CSJA 3K1RA 1IHJA 1WF8A 3QJMA 4MPAA 2F5YA 2KJDA 4E35A 3STJA 2REYA 2PKTA 2LC7A 2DMZA 2V1WA 2E7KA 4NMRA 4NMQA 4IC6A 2DLUA 5H3JA 1WHAA 1QLCA 2V90A 2I0LA 2QKUA 4NXPA 2YT8A 1UEZA 1BE9A 1N6DA 1N7EA 2QBWA 4K75A 2DM8A 2DLSA 1U37A 2DC2A 1OBXA 4REYA 4FGMA 1UEQA 3NGHA 2EEHA 3R68A 1KY9A 3O46A 3HPMA 2DB5A 4HOPA 1W9OA 1BFEA 2PNTA 3MH6A 1GQ4A 1MFLA 1KEFA 2OS6A 2D92A 2KAWA 3EGHC 2RCZA 3KHFA 4Q6HA 3I1EA 2HE4A 1TP5A 2L97A 4JOKA 1P1EA 4JL7A 5HEYA 1WFVA 1N6FA 4JOGA 1IU0A 2AWXA 2Q9VA 1X5NA 2LOBA 3TMHA 1QAVA 4JOJA 4UU6A 1N7TA 2KRGA 4N6XA 1IU2A 2KOJA 2PZDA 2CSSA 2DJTA 1U3BA 5HETA 2GZVA 5HFCA 1UM7A 3TSVA 2EDVA 2DAZA 3L4FD 4JOEA 2YT7A 2M0UA 2K1ZA 2FCFA 3GJ9A 2EEGA 1V5LA 4XHVA 3GDSA 3DJ1A 1GM1A 1FC9A 1N7FA 2M0VA 4K6YA 1GQ5A 1VA8A 4JORA 2KPKA 3CC0A 3WKLA 1U39A 2EGKA 2EDZA 3KZEA 1NTEA 1UFXA 1XZ9A 4PQWA 1TP3A 1ZOKA 1X6DA 2JOAA 2KV8A 2YUYA 1U38A 2X7ZA 2EAQA 2FNEA 2O2TA 2W4FA 2MX6A 3K82A 4KFVA 3RL7A 1WG6A 2EHRA 3CYYA 3QIKA 4E34A 2M3MA 4EDJA 1Q3OA 1Y8TA 2VWRA 4NMPA 2LA8A 4GVDA 4NMVA 1UM1A 3PV5A 4RI0A 3DIWA 2OMJA 1Z86A 3VQGA 5A2PA 2HE2A 1WH1A 2IWNA 4P2AB 5E11A 5JXBA 1V6BA 3OTPA 4F8KA 5HEDA 2BYGA 2R4HA 3DJAA 2W7RA 5EYZA 2CS5A 2KOMA 1UEPA 3LNYA 1L6OA 1PDRA 3PV4A 4AMHA
chains in the Genus database with same CATH superfamily
3CH8A 2Z9IA 3BPUA 3NFLA 2EGOA 1KWAA 1WHDA 2M10A 5HF1A 2L4SA 2WL7A 5I7ZA 1X8SA 1UJDA 4OEPA 2I0IA 4NMTA 2D90A 2OQSA 1NF3C 3GDVA 2H3MA 2VSPA 2JXOA 2EDPA 4YDPA 3QDOA 2Z17A 4K76A 1V1TA 2EEJA 5HEBA 2OCSA 1RZXA 3NFKA 1D5GA 2RRMA 3QE1A 5HFEA 3GDUA 3R0HA 4Q2OA 3R69A 2JILA 4G69A 1X5RA 1QAUA 3PV2A 2KPLA 2EJYA 2OPGA 3SFJA 5E6PB 1WF7A 1X5QA 3AXAA 1UHPA 3JXTA 2KBSA 3TSZA 1TE0A 3SUZA 5G1DA 1FC6A 4Q3HA 3ID1A 1V62A 3PS4A 2IWPA 4Q2PA 5HFFA 3RLEA 1X9ZA 3ZRTA 1YBOA 1P1DA 3SHUA 4NXRA 2FE5A 3PDZA 4KFWA 5HF4A 3DORA 1OZIA 3SOEA 5HJ1A 4OAJA 5F3XA 5E22A 3QO6A 4GHNA 1W9EA 2EXGA 3I4WA 2EEIA 2KG2A 4E3BA 2VRFA 4GVCA 5GLJA 1LCYA 5HFBA 4HOPB 5HDYA 3GABA 5E21A 1FCFA 3CBZA 3B76A 1SOTA 2KYLA 2KL1A 1Q7XA 4LMMA 4WYTA 2PKUA 2JREA 3FY5A 3E17A 5FHTA 2JINA 1TQ3A 3QJNA 2KA9A 2Q3GA 2VZ5A 3GCOA 4NXQA 2P3WA 4H11A 4UU5A 3TSWA 1QAVB 4YYXA 4P0CA 2I6VA 3EGGC 1T2MA 1UJUA 3K50A 5EZ0A 4JJ3A 2EV8A 5B6LA 3GSLA 1K32A 2AWUA 2FN5A 3CS0A 2G5MB 2ZPMA 1WIFA 2R3YA 2OGPA 2I1NA 5FB8C 3RL8A 1B8QA 1Y7NA 2H3LA 2KOHA 4JOFA 2KJPA 1WJLA 1VB7A 1SOZA 4NNMA 2AWWA 3O5NA 5D13A 1RGWA 4Z33A 3NCVA 3CBYA 4R2ZA 2H2BA 4JOHA 5E1YA 3DJ3A 3CBXA 3PDVA 4NMOA 2YTWA 2LC6A 4NNLA 2PA1A 2L4TA 1I16A 1VCWA 1RY4A 4WYUA 4Z8JA 2QG1A 3QGLA 1WFGA 2EGNA 2QKTA 1UITA 2LUIA 2IWQA 1RGRA 2VSVA 1M5ZA 2UZCA 2QT5A 1OBYA 4K72A 2H2CA 2AINA 4L8NA 3VQFA 2F0AA 1OBZA 4K78A 1MC7A 2OSGA 5HFDA 3I18A 3MH7A 2I04A 5G1EA 1UF1A 1VAEA 2YUBA 1MFGA 2ZPLA 4O06A 1I92A 2KQFA 1Q3PA 1W9QA 1UEWA 1VJ6A 1Z87A 4JJ0A 3ID4A 2DKRA 1WI2A 2IWOA 3GCNA 4OEOA 2I4SA 1G9OA 2JIKA 3KZDA 3SHWA 3MH4A 4FLNA 3GGEA 3LNXA 2ENOA 4Q2NA 3OU0A 1FC7A 5DTHA 3ID3A 4NMSA 2M0TA 3WKMA 1R6JA 2JWEA 2VPHA 1V5QA 2HGAA 2KJKA 1UJVA 5GNDA 2OZFA 1ZUBA 1N99A 3ID2A 5F67A 2QKVA 2MHOA 4Q6SA 1N6EA 3HVQC 2D8IA 2G2LA 3KDKA 2K20A 1X45A 2PDZA 1WI4A 4Q2QA 4JOPA 3HPKA 2M0ZA 2CSJA 3K1RA 1IHJA 1WF8A 3QJMA 4MPAA 2F5YA 2KJDA 4E35A 3STJA 2REYA 2PKTA 2LC7A 2DMZA 2V1WA 2E7KA 4NMRA 4NMQA 4IC6A 2DLUA 5H3JA 1WHAA 1QLCA 2V90A 2I0LA 2QKUA 4NXPA 2GEFA 2YT8A 1UEZA 1BE9A 1N6DA 1N7EA 2QBWA 4K75A 2DM8A 2DLSA 3KDGA 1U37A 2DC2A 1OBXA 4REYA 4FGMA 1UEQA 3NGHA 2EEHA 3R68A 1KY9A 3O46A 3HPMA 2DB5A 4HOPA 1W9OA 1BFEA 2PNTA 3MH6A 1GQ4A 1MFLA 1KEFA 2OS6A 2D92A 2KAWA 3EGHC 2RCZA 3KHFA 4Q6HA 3I1EA 2HE4A 1TP5A 2L97A 4JOKA 1P1EA 4JL7A 5HEYA 1WFVA 1N6FA 4JOGA 1IU0A 2AWXA 2Q9VA 1X5NA 2LOBA 3TMHA 1QAVA 4JOJA 4UU6A 1N7TA 2KRGA 4N6XA 1IU2A 2KOJA 2PZDA 2CSSA 2DJTA 1U3BA 5HETA 2GZVA 5HFCA 1UM7A 3TSVA 2EDVA 2DAZA 3L4FD 4JOEA 2YT7A 2M0UA 2K1ZA 2FCFA 3GJ9A 2EEGA 1V5LA 4XHVA 3GDSA 3DJ1A 1GM1A 1FC9A 1N7FA 2M0VA 4K6YA 5IL9A 1GQ5A 1VA8A 4JORA 2KPKA 3CC0A 3WKLA 1U39A 2EGKA 2EDZA 3KZEA 1NTEA 1UFXA 1XZ9A 4PQWA 1TP3A 1ZOKA 1X6DA 2JOAA 2KV8A 2YUYA 1U38A 2X7ZA 2EAQA 2FNEA 2O2TA 2W4FA 2MX6A 3K82A 4KFVA 3RL7A 2JSNA 1WG6A 2EHRA 3CYYA 3QIKA 4E34A 2M3MA 4EDJA 1Q3OA 5B42A 1Y8TA 2VWRA 4NMPA 2LA8A 4GVDA 4NMVA 1UM1A 3PV5A 4RI0A 3DIWA 2OMJA 1Z86A 3VQGA 5A2PA 2HE2A 1WH1A 2IWNA 4P2AB 5E11A 5JXBA 1V6BA 3OTPA 4F8KA 5HEDA 2BYGA 2R4HA 3DJAA 2W7RA 5EYZA 2CS5A 2KOMA 1UEPA 5ILBA 3LNYA 1L6OA 1PDRA 3PV4A 4AMHA
chains in the Genus database with same CATH topology
3CH8A 2Z9IA 3BPUA 3NFLA 2EGOA 1KWAA 1WHDA 2M10A 5HF1A 2L4SA 2WL7A 5I7ZA 1X8SA 1UJDA 4OEPA 2I0IA 4NMTA 2D90A 2OQSA 1NF3C 3GDVA 2H3MA 2VSPA 2JXOA 2EDPA 4YDPA 3QDOA 2Z17A 4K76A 1V1TA 2EEJA 5HEBA 2OCSA 1RZXA 3NFKA 1D5GA 2RRMA 3QE1A 5HFEA 3GDUA 3R0HA 4Q2OA 3R69A 2JILA 4G69A 1X5RA 1QAUA 3PV2A 2KPLA 2EJYA 2OPGA 3SFJA 5E6PB 1WF7A 1X5QA 3AXAA 1UHPA 3JXTA 2KBSA 3TSZA 1TE0A 3SUZA 5G1DA 1FC6A 4Q3HA 3ID1A 1V62A 3PS4A 2IWPA 4Q2PA 5HFFA 3RLEA 1X9ZA 3ZRTA 1YBOA 1P1DA 3SHUA 4NXRA 2FE5A 3PDZA 4KFWA 5HF4A 3DORA 1OZIA 3SOEA 5HJ1A 4OAJA 5F3XA 5E22A 3QO6A 4GHNA 1W9EA 2EXGA 3I4WA 2EEIA 2KG2A 4E3BA 2VRFA 4GVCA 5GLJA 1LCYA 5HFBA 4HOPB 5HDYA 3GABA 5E21A 1FCFA 3CBZA 3B76A 1SOTA 2KYLA 2KL1A 1Q7XA 4LMMA 4WYTA 2PKUA 2JREA 3FY5A 3E17A 5FHTA 2JINA 1TQ3A 3QJNA 2KA9A 2Q3GA 2VZ5A 3GCOA 4NXQA 2P3WA 4H11A 4UU5A 3TSWA 1QAVB 4YYXA 4P0CA 2I6VA 3EGGC 1T2MA 1UJUA 3K50A 5EZ0A 4JJ3A 2EV8A 5B6LA 3GSLA 1K32A 2AWUA 2FN5A 3CS0A 2G5MB 2ZPMA 1WIFA 2R3YA 2OGPA 2I1NA 5FB8C 3RL8A 1B8QA 1Y7NA 2H3LA 2KOHA 4JOFA 2KJPA 1WJLA 1VB7A 1SOZA 4NNMA 2AWWA 3O5NA 5D13A 1RGWA 4Z33A 3NCVA 3CBYA 4R2ZA 2H2BA 4JOHA 5E1YA 3DJ3A 3CBXA 3PDVA 4NMOA 2YTWA 2LC6A 4NNLA 2PA1A 2L4TA 1I16A 1VCWA 1RY4A 4WYUA 4Z8JA 2QG1A 3QGLA 1WFGA 2EGNA 2QKTA 1UITA 2LUIA 2IWQA 1RGRA 2VSVA 1M5ZA 2UZCA 2QT5A 1OBYA 4K72A 2H2CA 2AINA 4L8NA 3VQFA 2F0AA 1OBZA 4K78A 1MC7A 2OSGA 5HFDA 3I18A 3MH7A 2I04A 5G1EA 1UF1A 1VAEA 2YUBA 1MFGA 2ZPLA 4O06A 1I92A 2KQFA 1Q3PA 1W9QA 1UEWA 1VJ6A 1Z87A 4JJ0A 3ID4A 2DKRA 1WI2A 2IWOA 3GCNA 4OEOA 2I4SA 1G9OA 2JIKA 3KZDA 3SHWA 3MH4A 4FLNA 3GGEA 3LNXA 2ENOA 4Q2NA 3OU0A 1FC7A 5DTHA 3ID3A 4NMSA 2M0TA 3WKMA 1R6JA 2JWEA 2VPHA 1V5QA 2HGAA 2KJKA 1UJVA 5GNDA 2OZFA 1ZUBA 1N99A 3ID2A 5F67A 2QKVA 2MHOA 4Q6SA 1N6EA 3HVQC 2D8IA 2G2LA 3KDKA 2K20A 1X45A 2PDZA 1WI4A 4Q2QA 4JOPA 3HPKA 2M0ZA 2CSJA 3K1RA 1IHJA 1WF8A 3QJMA 4MPAA 2F5YA 2KJDA 4E35A 3STJA 2REYA 2PKTA 2LC7A 2DMZA 2V1WA 2E7KA 4NMRA 4NMQA 4IC6A 2DLUA 5H3JA 1WHAA 1QLCA 2V90A 2I0LA 2QKUA 4NXPA 2GEFA 2YT8A 1UEZA 1BE9A 1N6DA 1N7EA 2QBWA 4K75A 2DM8A 2DLSA 3KDGA 1U37A 2DC2A 1OBXA 4REYA 4FGMA 1UEQA 3NGHA 2EEHA 3R68A 1KY9A 3O46A 3HPMA 2DB5A 4HOPA 1W9OA 1BFEA 2PNTA 3MH6A 1GQ4A 1MFLA 1KEFA 2OS6A 2D92A 2KAWA 3EGHC 2RCZA 3KHFA 4Q6HA 3I1EA 2HE4A 1TP5A 2L97A 4JOKA 1P1EA 4JL7A 5HEYA 1WFVA 1N6FA 4JOGA 1IU0A 2AWXA 2Q9VA 1X5NA 2LOBA 3TMHA 1QAVA 4JOJA 4UU6A 1N7TA 2KRGA 4N6XA 1IU2A 2KOJA 2PZDA 2CSSA 2DJTA 1U3BA 5HETA 2GZVA 5HFCA 1UM7A 3TSVA 2EDVA 2DAZA 3L4FD 4JOEA 2YT7A 2M0UA 2K1ZA 2FCFA 3GJ9A 2EEGA 1V5LA 4XHVA 3GDSA 3DJ1A 1GM1A 1FC9A 1N7FA 2M0VA 4K6YA 5IL9A 1GQ5A 1VA8A 4JORA 2KPKA 3CC0A 3WKLA 1U39A 2EGKA 2EDZA 3KZEA 1NTEA 1UFXA 1XZ9A 4PQWA 1TP3A 1ZOKA 1X6DA 2JOAA 2KV8A 2YUYA 1U38A 2X7ZA 2EAQA 2FNEA 2O2TA 2W4FA 2MX6A 3K82A 4KFVA 3RL7A 2JSNA 1WG6A 2EHRA 3CYYA 3QIKA 4E34A 2M3MA 4EDJA 1Q3OA 5B42A 1Y8TA 2VWRA 4NMPA 2LA8A 4GVDA 4NMVA 1UM1A 3PV5A 4RI0A 3DIWA 2OMJA 1Z86A 3VQGA 5A2PA 2HE2A 1WH1A 2IWNA 4P2AB 5E11A 5JXBA 1V6BA 3OTPA 4F8KA 5HEDA 2BYGA 2R4HA 3DJAA 2W7RA 5EYZA 2CS5A 2KOMA 1UEPA 5ILBA 3LNYA 1L6OA 1PDRA 3PV4A 4AMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CH8 A;  2Z9I A;  3BPU A;  3NFL A;  2EGO A;  1KWA A;  1WHD A;  2M10 A;  5HF1 A;  2L4S A;  2WL7 A;  5I7Z A;  1X8S A;  1UJD A;  4OEP A;  2I0I A;  4NMT A;  2D90 A;  2OQS A;  1NF3 C;  3GDV A;  2H3M A;  2VSP A;  2JXO A;  2EDP A;  4YDP A;  3QDO A;  2Z17 A;  4K76 A;  1V1T A;  2EEJ A;  5HEB A;  2OCS A;  1RZX A;  3NFK A;  1D5G A;  2RRM A;  3QE1 A;  5HFE A;  3GDU A;  3R0H A;  4Q2O A;  3R69 A;  2JIL A;  4G69 A;  1X5R A;  1QAU A;  3PV2 A;  2KPL A;  2EJY A;  2OPG A;  3SFJ A;  5E6P B;  1WF7 A;  1X5Q A;  3AXA A;  1UHP A;  3JXT A;  2KBS A;  3TSZ A;  1TE0 A;  3SUZ A;  5G1D A;  1FC6 A;  4Q3H A;  3ID1 A;  1V62 A;  3PS4 A;  2IWP A;  4Q2P A;  5HFF A;  3RLE A;  3ZRT A;  1YBO A;  1P1D A;  3SHU A;  4NXR A;  2FE5 A;  3PDZ A;  4KFW A;  5HF4 A;  3DOR A;  1OZI A;  3SOE A;  5HJ1 A;  4OAJ A;  5F3X A;  5E22 A;  3QO6 A;  4GHN A;  1W9E A;  2EXG A;  3I4W A;  2EEI A;  2KG2 A;  4E3B A;  2VRF A;  4GVC A;  5GLJ A;  1LCY A;  5HFB A;  4HOP B;  5HDY A;  5E21 A;  1FCF A;  3CBZ A;  3B76 A;  1SOT A;  2KYL A;  2KL1 A;  1Q7X A;  4LMM A;  4WYT A;  2PKU A;  2JRE A;  3FY5 A;  3E17 A;  5FHT A;  2JIN A;  1TQ3 A;  3QJN A;  2KA9 A;  2Q3G A;  2VZ5 A;  3GCO A;  4NXQ A;  2P3W A;  4H11 A;  4UU5 A;  3TSW A;  1QAV B;  4YYX A;  4P0C A;  2I6V A;  3EGG C;  1T2M A;  1UJU A;  3K50 A;  5EZ0 A;  2EV8 A;  5B6L A;  3GSL A;  1K32 A;  2AWU A;  2FN5 A;  3CS0 A;  2G5M B;  2ZPM A;  1WIF A;  2R3Y A;  2OGP A;  2I1N A;  5FB8 C;  3RL8 A;  1B8Q A;  1Y7N A;  2H3L A;  2KOH A;  4JOF A;  2KJP A;  1WJL A;  1VB7 A;  1SOZ A;  4NNM A;  2AWW A;  3O5N A;  5D13 A;  1RGW A;  4Z33 A;  3CBY A;  4R2Z A;  2H2B A;  4JOH A;  5E1Y A;  3DJ3 A;  3CBX A;  3PDV A;  4NMO A;  2YTW A;  2LC6 A;  4NNL A;  2PA1 A;  2L4T A;  1I16 A;  1VCW A;  1RY4 A;  4WYU A;  4Z8J A;  2QG1 A;  3QGL A;  1WFG A;  2EGN A;  2QKT A;  1UIT A;  2LUI A;  2IWQ A;  1RGR A;  2VSV A;  1M5Z A;  2UZC A;  2QT5 A;  1OBY A;  4K72 A;  2H2C A;  2AIN A;  4L8N A;  3VQF A;  2F0A A;  1OBZ A;  4K78 A;  1MC7 A;  2OSG A;  5HFD A;  3I18 A;  3MH7 A;  2I04 A;  5G1E A;  1UF1 A;  1VAE A;  2YUB A;  1MFG A;  2ZPL A;  4O06 A;  1I92 A;  2KQF A;  1Q3P A;  1W9Q A;  1UEW A;  1VJ6 A;  1Z87 A;  3ID4 A;  2DKR A;  1WI2 A;  2IWO A;  3GCN A;  4OEO A;  2I4S A;  1G9O A;  2JIK A;  3KZD A;  3SHW A;  3MH4 A;  3GGE A;  3LNX A;  2ENO A;  4Q2N A;  3OU0 A;  1FC7 A;  5DTH A;  3ID3 A;  4NMS A;  2M0T A;  3WKM A;  1R6J A;  2JWE A;  2VPH A;  1V5Q A;  2HGA A;  2KJK A;  1UJV A;  5GND A;  2OZF A;  1ZUB A;  1N99 A;  3ID2 A;  5F67 A;  2QKV A;  2MHO A;  4Q6S A;  1N6E A;  3HVQ C;  2D8I A;  2G2L A;  2K20 A;  1X45 A;  2PDZ A;  1WI4 A;  4Q2Q A;  4JOP A;  3HPK A;  2M0Z A;  2CSJ A;  3K1R A;  1IHJ A;  1WF8 A;  3QJM A;  4MPA A;  2F5Y A;  2KJD A;  4E35 A;  3STJ A;  2REY A;  2PKT A;  2LC7 A;  2DMZ A;  2V1W A;  2E7K A;  4NMR A;  4NMQ A;  4IC6 A;  2DLU A;  5H3J A;  1WHA A;  1QLC A;  2V90 A;  2I0L A;  2QKU A;  4NXP A;  2YT8 A;  1UEZ A;  1BE9 A;  1N6D A;  1N7E A;  2QBW A;  4K75 A;  2DM8 A;  2DLS A;  1U37 A;  2DC2 A;  1OBX A;  4REY A;  4FGM A;  1UEQ A;  3NGH A;  2EEH A;  3R68 A;  1KY9 A;  3O46 A;  3HPM A;  2DB5 A;  4HOP A;  1W9O A;  1BFE A;  2PNT A;  3MH6 A;  1GQ4 A;  1MFL A;  1KEF A;  2OS6 A;  2D92 A;  2KAW A;  3EGH C;  2RCZ A;  3KHF A;  4Q6H A;  3I1E A;  2HE4 A;  1TP5 A;  2L97 A;  4JOK A;  1P1E A;  4JL7 A;  5HEY A;  1WFV A;  1N6F A;  4JOG A;  1IU0 A;  2AWX A;  2Q9V A;  1X5N A;  2LOB A;  3TMH A;  1QAV A;  4JOJ A;  4UU6 A;  1N7T A;  2KRG A;  4N6X A;  1IU2 A;  2KOJ A;  2PZD A;  2CSS A;  2DJT A;  1U3B A;  5HET A;  2GZV A;  5HFC A;  1UM7 A;  3TSV A;  2EDV A;  2DAZ A;  3L4F D;  4JOE A;  2YT7 A;  2M0U A;  2K1Z A;  2FCF A;  3GJ9 A;  2EEG A;  1V5L A;  4XHV A;  3GDS A;  3DJ1 A;  1GM1 A;  1FC9 A;  1N7F A;  2M0V A;  4K6Y A;  1GQ5 A;  1VA8 A;  4JOR A;  2KPK A;  3CC0 A;  3WKL A;  1U39 A;  2EGK A;  2EDZ A;  3KZE A;  1NTE A;  1UFX A;  1XZ9 A;  4PQW A;  1TP3 A;  1ZOK A;  1X6D A;  2JOA A;  2KV8 A;  2YUY A;  1U38 A;  2X7Z A;  2EAQ A;  2FNE A;  2O2T A;  2W4F A;  2MX6 A;  3K82 A;  4KFV A;  3RL7 A;  1WG6 A;  2EHR A;  3CYY A;  3QIK A;  4E34 A;  2M3M A;  4EDJ A;  1Q3O A;  1Y8T A;  2VWR A;  4NMP A;  2LA8 A;  4GVD A;  4NMV A;  1UM1 A;  3PV5 A;  4RI0 A;  3DIW A;  2OMJ A;  1Z86 A;  3VQG A;  5A2P A;  2HE2 A;  1WH1 A;  2IWN A;  4P2A B;  5E11 A;  5JXB A;  1V6B A;  3OTP A;  4F8K A;  5HED A;  2BYG A;  2R4H A;  3DJA A;  2W7R A;  5EYZ A;  2CS5 A;  2KOM A;  1UEP A;  3LNY A;  1L6O A;  1PDR A;  3PV4 A;  4AMH A; 
#chains in the Genus database with same CATH topology
 3CH8 A;  2Z9I A;  3BPU A;  3NFL A;  2EGO A;  1KWA A;  1WHD A;  2M10 A;  5HF1 A;  2L4S A;  2WL7 A;  5I7Z A;  1X8S A;  1UJD A;  4OEP A;  2I0I A;  4NMT A;  2D90 A;  2OQS A;  1NF3 C;  3GDV A;  2H3M A;  2VSP A;  2JXO A;  2EDP A;  4YDP A;  3QDO A;  2Z17 A;  4K76 A;  1V1T A;  2EEJ A;  5HEB A;  2OCS A;  1RZX A;  3NFK A;  1D5G A;  2RRM A;  3QE1 A;  5HFE A;  3GDU A;  3R0H A;  4Q2O A;  3R69 A;  2JIL A;  4G69 A;  1X5R A;  1QAU A;  3PV2 A;  2KPL A;  2EJY A;  2OPG A;  3SFJ A;  5E6P B;  1WF7 A;  1X5Q A;  3AXA A;  1UHP A;  3JXT A;  2KBS A;  3TSZ A;  1TE0 A;  3SUZ A;  5G1D A;  1FC6 A;  4Q3H A;  3ID1 A;  1V62 A;  3PS4 A;  2IWP A;  4Q2P A;  5HFF A;  3RLE A;  1X9Z A;  3ZRT A;  1YBO A;  1P1D A;  3SHU A;  4NXR A;  2FE5 A;  3PDZ A;  4KFW A;  5HF4 A;  3DOR A;  1OZI A;  3SOE A;  5HJ1 A;  4OAJ A;  5F3X A;  5E22 A;  3QO6 A;  4GHN A;  1W9E A;  2EXG A;  3I4W A;  2EEI A;  2KG2 A;  4E3B A;  2VRF A;  4GVC A;  5GLJ A;  1LCY A;  5HFB A;  4HOP B;  5HDY A;  3GAB A;  5E21 A;  1FCF A;  3CBZ A;  3B76 A;  1SOT A;  2KYL A;  2KL1 A;  1Q7X A;  4LMM A;  4WYT A;  2PKU A;  2JRE A;  3FY5 A;  3E17 A;  5FHT A;  2JIN A;  1TQ3 A;  3QJN A;  2KA9 A;  2Q3G A;  2VZ5 A;  3GCO A;  4NXQ A;  2P3W A;  4H11 A;  4UU5 A;  3TSW A;  1QAV B;  4YYX A;  4P0C A;  2I6V A;  3EGG C;  1T2M A;  1UJU A;  3K50 A;  5EZ0 A;  4JJ3 A;  2EV8 A;  5B6L A;  3GSL A;  1K32 A;  2AWU A;  2FN5 A;  3CS0 A;  2G5M B;  2ZPM A;  1WIF A;  2R3Y A;  2OGP A;  2I1N A;  5FB8 C;  3RL8 A;  1B8Q A;  1Y7N A;  2H3L A;  2KOH A;  4JOF A;  2KJP A;  1WJL A;  1VB7 A;  1SOZ A;  4NNM A;  2AWW A;  3O5N A;  5D13 A;  1RGW A;  4Z33 A;  3NCV A;  3CBY A;  4R2Z A;  2H2B A;  4JOH A;  5E1Y A;  3DJ3 A;  3CBX A;  3PDV A;  4NMO A;  2YTW A;  2LC6 A;  4NNL A;  2PA1 A;  2L4T A;  1I16 A;  1VCW A;  1RY4 A;  4WYU A;  4Z8J A;  2QG1 A;  3QGL A;  1WFG A;  2EGN A;  2QKT A;  1UIT A;  2LUI A;  2IWQ A;  1RGR A;  2VSV A;  1M5Z A;  2UZC A;  2QT5 A;  1OBY A;  4K72 A;  2H2C A;  2AIN A;  4L8N A;  3VQF A;  2F0A A;  1OBZ A;  4K78 A;  1MC7 A;  2OSG A;  5HFD A;  3I18 A;  3MH7 A;  2I04 A;  5G1E A;  1UF1 A;  1VAE A;  2YUB A;  1MFG A;  2ZPL A;  4O06 A;  1I92 A;  2KQF A;  1Q3P A;  1W9Q A;  1UEW A;  1VJ6 A;  1Z87 A;  4JJ0 A;  3ID4 A;  2DKR A;  1WI2 A;  2IWO A;  3GCN A;  4OEO A;  2I4S A;  1G9O A;  2JIK A;  3KZD A;  3SHW A;  3MH4 A;  4FLN A;  3GGE A;  3LNX A;  2ENO A;  4Q2N A;  3OU0 A;  1FC7 A;  5DTH A;  3ID3 A;  4NMS A;  2M0T A;  3WKM A;  1R6J A;  2JWE A;  2VPH A;  1V5Q A;  2HGA A;  2KJK A;  1UJV A;  5GND A;  2OZF A;  1ZUB A;  1N99 A;  3ID2 A;  5F67 A;  2QKV A;  2MHO A;  4Q6S A;  1N6E A;  3HVQ C;  2D8I A;  2G2L A;  3KDK A;  2K20 A;  1X45 A;  2PDZ A;  1WI4 A;  4Q2Q A;  4JOP A;  3HPK A;  2M0Z A;  2CSJ A;  3K1R A;  1IHJ A;  1WF8 A;  3QJM A;  4MPA A;  2F5Y A;  2KJD A;  4E35 A;  3STJ A;  2REY A;  2PKT A;  2LC7 A;  2DMZ A;  2V1W A;  2E7K A;  4NMR A;  4NMQ A;  4IC6 A;  2DLU A;  5H3J A;  1WHA A;  1QLC A;  2V90 A;  2I0L A;  2QKU A;  4NXP A;  2GEF A;  2YT8 A;  1UEZ A;  1BE9 A;  1N6D A;  1N7E A;  2QBW A;  4K75 A;  2DM8 A;  2DLS A;  3KDG A;  1U37 A;  2DC2 A;  1OBX A;  4REY A;  4FGM A;  1UEQ A;  3NGH A;  2EEH A;  3R68 A;  1KY9 A;  3O46 A;  3HPM A;  2DB5 A;  4HOP A;  1W9O A;  1BFE A;  2PNT A;  3MH6 A;  1GQ4 A;  1MFL A;  1KEF A;  2OS6 A;  2D92 A;  2KAW A;  3EGH C;  2RCZ A;  3KHF A;  4Q6H A;  3I1E A;  2HE4 A;  1TP5 A;  2L97 A;  4JOK A;  1P1E A;  4JL7 A;  5HEY A;  1WFV A;  1N6F A;  4JOG A;  1IU0 A;  2AWX A;  2Q9V A;  1X5N A;  2LOB A;  3TMH A;  1QAV A;  4JOJ A;  4UU6 A;  1N7T A;  2KRG A;  4N6X A;  1IU2 A;  2KOJ A;  2PZD A;  2CSS A;  2DJT A;  1U3B A;  5HET A;  2GZV A;  5HFC A;  1UM7 A;  3TSV A;  2EDV A;  2DAZ A;  3L4F D;  4JOE A;  2YT7 A;  2M0U A;  2K1Z A;  2FCF A;  3GJ9 A;  2EEG A;  1V5L A;  4XHV A;  3GDS A;  3DJ1 A;  1GM1 A;  1FC9 A;  1N7F A;  2M0V A;  4K6Y A;  5IL9 A;  1GQ5 A;  1VA8 A;  4JOR A;  2KPK A;  3CC0 A;  3WKL A;  1U39 A;  2EGK A;  2EDZ A;  3KZE A;  1NTE A;  1UFX A;  1XZ9 A;  4PQW A;  1TP3 A;  1ZOK A;  1X6D A;  2JOA A;  2KV8 A;  2YUY A;  1U38 A;  2X7Z A;  2EAQ A;  2FNE A;  2O2T A;  2W4F A;  2MX6 A;  3K82 A;  4KFV A;  3RL7 A;  2JSN A;  1WG6 A;  2EHR A;  3CYY A;  3QIK A;  4E34 A;  2M3M A;  4EDJ A;  1Q3O A;  5B42 A;  1Y8T A;  2VWR A;  4NMP A;  2LA8 A;  4GVD A;  4NMV A;  1UM1 A;  3PV5 A;  4RI0 A;  3DIW A;  2OMJ A;  1Z86 A;  3VQG A;  5A2P A;  2HE2 A;  1WH1 A;  2IWN A;  4P2A B;  5E11 A;  5JXB A;  1V6B A;  3OTP A;  4F8K A;  5HED A;  2BYG A;  2R4H A;  3DJA A;  2W7R A;  5EYZ A;  2CS5 A;  2KOM A;  1UEP A;  5ILB A;  3LNY A;  1L6O A;  1PDR A;  3PV4 A;  4AMH A; 
#chains in the Genus database with same CATH homology
 3CH8 A;  2Z9I A;  3BPU A;  3NFL A;  2EGO A;  1KWA A;  1WHD A;  2M10 A;  5HF1 A;  2L4S A;  2WL7 A;  5I7Z A;  1X8S A;  1UJD A;  4OEP A;  2I0I A;  4NMT A;  2D90 A;  2OQS A;  1NF3 C;  3GDV A;  2H3M A;  2VSP A;  2JXO A;  2EDP A;  4YDP A;  3QDO A;  2Z17 A;  4K76 A;  1V1T A;  2EEJ A;  5HEB A;  2OCS A;  1RZX A;  3NFK A;  1D5G A;  2RRM A;  3QE1 A;  5HFE A;  3GDU A;  3R0H A;  4Q2O A;  3R69 A;  2JIL A;  4G69 A;  1X5R A;  1QAU A;  3PV2 A;  2KPL A;  2EJY A;  2OPG A;  3SFJ A;  5E6P B;  1WF7 A;  1X5Q A;  3AXA A;  1UHP A;  3JXT A;  2KBS A;  3TSZ A;  1TE0 A;  3SUZ A;  5G1D A;  1FC6 A;  4Q3H A;  3ID1 A;  1V62 A;  3PS4 A;  2IWP A;  4Q2P A;  5HFF A;  3RLE A;  1X9Z A;  3ZRT A;  1YBO A;  1P1D A;  3SHU A;  4NXR A;  2FE5 A;  3PDZ A;  4KFW A;  5HF4 A;  3DOR A;  1OZI A;  3SOE A;  5HJ1 A;  4OAJ A;  5F3X A;  5E22 A;  3QO6 A;  4GHN A;  1W9E A;  2EXG A;  3I4W A;  2EEI A;  2KG2 A;  4E3B A;  2VRF A;  4GVC A;  5GLJ A;  1LCY A;  5HFB A;  4HOP B;  5HDY A;  3GAB A;  5E21 A;  1FCF A;  3CBZ A;  3B76 A;  1SOT A;  2KYL A;  2KL1 A;  1Q7X A;  4LMM A;  4WYT A;  2PKU A;  2JRE A;  3FY5 A;  3E17 A;  5FHT A;  2JIN A;  1TQ3 A;  3QJN A;  2KA9 A;  2Q3G A;  2VZ5 A;  3GCO A;  4NXQ A;  2P3W A;  4H11 A;  4UU5 A;  3TSW A;  1QAV B;  4YYX A;  4P0C A;  2I6V A;  3EGG C;  1T2M A;  1UJU A;  3K50 A;  5EZ0 A;  4JJ3 A;  2EV8 A;  5B6L A;  3GSL A;  1K32 A;  2AWU A;  2FN5 A;  3CS0 A;  2G5M B;  2ZPM A;  1WIF A;  2R3Y A;  2OGP A;  2I1N A;  5FB8 C;  3RL8 A;  1B8Q A;  1Y7N A;  2H3L A;  2KOH A;  4JOF A;  2KJP A;  1WJL A;  1VB7 A;  1SOZ A;  4NNM A;  2AWW A;  3O5N A;  5D13 A;  1RGW A;  4Z33 A;  3NCV A;  3CBY A;  4R2Z A;  2H2B A;  4JOH A;  5E1Y A;  3DJ3 A;  3CBX A;  3PDV A;  4NMO A;  2YTW A;  2LC6 A;  4NNL A;  2PA1 A;  2L4T A;  1I16 A;  1VCW A;  1RY4 A;  4WYU A;  4Z8J A;  2QG1 A;  3QGL A;  1WFG A;  2EGN A;  2QKT A;  1UIT A;  2LUI A;  2IWQ A;  1RGR A;  2VSV A;  1M5Z A;  2UZC A;  2QT5 A;  1OBY A;  4K72 A;  2H2C A;  2AIN A;  4L8N A;  3VQF A;  2F0A A;  1OBZ A;  4K78 A;  1MC7 A;  2OSG A;  5HFD A;  3I18 A;  3MH7 A;  2I04 A;  5G1E A;  1UF1 A;  1VAE A;  2YUB A;  1MFG A;  2ZPL A;  4O06 A;  1I92 A;  2KQF A;  1Q3P A;  1W9Q A;  1UEW A;  1VJ6 A;  1Z87 A;  4JJ0 A;  3ID4 A;  2DKR A;  1WI2 A;  2IWO A;  3GCN A;  4OEO A;  2I4S A;  1G9O A;  2JIK A;  3KZD A;  3SHW A;  3MH4 A;  4FLN A;  3GGE A;  3LNX A;  2ENO A;  4Q2N A;  3OU0 A;  1FC7 A;  5DTH A;  3ID3 A;  4NMS A;  2M0T A;  3WKM A;  1R6J A;  2JWE A;  2VPH A;  1V5Q A;  2HGA A;  2KJK A;  1UJV A;  5GND A;  2OZF A;  1ZUB A;  1N99 A;  3ID2 A;  5F67 A;  2QKV A;  2MHO A;  4Q6S A;  1N6E A;  3HVQ C;  2D8I A;  2G2L A;  3KDK A;  2K20 A;  1X45 A;  2PDZ A;  1WI4 A;  4Q2Q A;  4JOP A;  3HPK A;  2M0Z A;  2CSJ A;  3K1R A;  1IHJ A;  1WF8 A;  3QJM A;  4MPA A;  2F5Y A;  2KJD A;  4E35 A;  3STJ A;  2REY A;  2PKT A;  2LC7 A;  2DMZ A;  2V1W A;  2E7K A;  4NMR A;  4NMQ A;  4IC6 A;  2DLU A;  5H3J A;  1WHA A;  1QLC A;  2V90 A;  2I0L A;  2QKU A;  4NXP A;  2GEF A;  2YT8 A;  1UEZ A;  1BE9 A;  1N6D A;  1N7E A;  2QBW A;  4K75 A;  2DM8 A;  2DLS A;  3KDG A;  1U37 A;  2DC2 A;  1OBX A;  4REY A;  4FGM A;  1UEQ A;  3NGH A;  2EEH A;  3R68 A;  1KY9 A;  3O46 A;  3HPM A;  2DB5 A;  4HOP A;  1W9O A;  1BFE A;  2PNT A;  3MH6 A;  1GQ4 A;  1MFL A;  1KEF A;  2OS6 A;  2D92 A;  2KAW A;  3EGH C;  2RCZ A;  3KHF A;  4Q6H A;  3I1E A;  2HE4 A;  1TP5 A;  2L97 A;  4JOK A;  1P1E A;  4JL7 A;  5HEY A;  1WFV A;  1N6F A;  4JOG A;  1IU0 A;  2AWX A;  2Q9V A;  1X5N A;  2LOB A;  3TMH A;  1QAV A;  4JOJ A;  4UU6 A;  1N7T A;  2KRG A;  4N6X A;  1IU2 A;  2KOJ A;  2PZD A;  2CSS A;  2DJT A;  1U3B A;  5HET A;  2GZV A;  5HFC A;  1UM7 A;  3TSV A;  2EDV A;  2DAZ A;  3L4F D;  4JOE A;  2YT7 A;  2M0U A;  2K1Z A;  2FCF A;  3GJ9 A;  2EEG A;  1V5L A;  4XHV A;  3GDS A;  3DJ1 A;  1GM1 A;  1FC9 A;  1N7F A;  2M0V A;  4K6Y A;  5IL9 A;  1GQ5 A;  1VA8 A;  4JOR A;  2KPK A;  3CC0 A;  3WKL A;  1U39 A;  2EGK A;  2EDZ A;  3KZE A;  1NTE A;  1UFX A;  1XZ9 A;  4PQW A;  1TP3 A;  1ZOK A;  1X6D A;  2JOA A;  2KV8 A;  2YUY A;  1U38 A;  2X7Z A;  2EAQ A;  2FNE A;  2O2T A;  2W4F A;  2MX6 A;  3K82 A;  4KFV A;  3RL7 A;  2JSN A;  1WG6 A;  2EHR A;  3CYY A;  3QIK A;  4E34 A;  2M3M A;  4EDJ A;  1Q3O A;  5B42 A;  1Y8T A;  2VWR A;  4NMP A;  2LA8 A;  4GVD A;  4NMV A;  1UM1 A;  3PV5 A;  4RI0 A;  3DIW A;  2OMJ A;  1Z86 A;  3VQG A;  5A2P A;  2HE2 A;  1WH1 A;  2IWN A;  4P2A B;  5E11 A;  5JXB A;  1V6B A;  3OTP A;  4F8K A;  5HED A;  2BYG A;  2R4H A;  3DJA A;  2W7R A;  5EYZ A;  2CS5 A;  2KOM A;  1UEP A;  5ILB A;  3LNY A;  1L6O A;  1PDR A;  3PV4 A;  4AMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...