1YBOA

Crystal structure of the pdz tandem of human syntenin with syndecan peptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
163
structure length
163
Chain Sequence
DPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Syntenin 1
publication title The binding of the PDZ tandem of syntenin to target proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 38
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1yboA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1yboA01
3CYYA 2M0TA 1TP3A 2EEJA 1UFXA 2REYA 5E1YA 4XHVA 4P0CA 4P2AB 2R4HA 2W4FA 2E7KA 1VAEA 1UJUA 4NNLA 3L4FD 1QAVB 4LMMA 2D90A 2DC2A 2PKUA 2KYLA 1D5GA 2QKVA 2K1ZA 1N7EA 2EHRA 3I18A 4NMVA 2L97A 1FCFA 2MHOA 2KJDA 2G5MB 1TQ3A 1N7TA 2G2LA 1X8SA 1WF8A 4OEOA 1RGWA 1KWAA 1U39A 4Q3HA 1LCYA 5HFFA 3VQFA 4WYTA 2AWUA 5H3JA 3AXAA 4UU6A 3QDOA 2EGKA 2EDPA 1PDRA 4Q2PA 2L4TA 2PNTA 5HEYA 4NMQA 2KPLA 2LC7A 3CBYA 4HOPA 2HE2A 5E21A 1OBXA 1N6EA 1UEPA 2I6VA 1L6OA 1UM7A 1VJ6A 3E17A 1M5ZA 3OU0A 4WYUA 1KEFA 3TMHA 3QJNA 1VA8A 3R69A 2X7ZA 2YUBA 2JWEA 4K76A 1IU2A 5EZ0A 1B8QA 1U38A 2D92A 2KA9A 1BE9A 2KG2A 4AMHA 1V62A 4JOGA 2V90A 5GNDA 5JXBA 1YBOA 1SOTA 1U3BA 1X6DA 2YUYA 5HJ1A 2PDZA 3CC0A 2KRGA 3GDUA 2DAZA 2V1WA 1N6FA 1ZUBA 2OPGA 2KOMA 3I1EA 3PV4A 2YTWA 1RY4A 2EEGA 4EDJA 4GVDA 1ZOKA 2H2CA 4KFVA 3PDZA 2F5YA 3CBXA 3PV5A 2Q3GA 4E34A 2UZCA 3VQGA 2QT5A 2VPHA 1V6BA 3O46A 5HFCA 1TP5A 2FNEA 1UM1A 1W9OA 2LUIA 4JOFA 5G1DA 1VCWA 3RL7A 1N99A 2I1NA 5HFDA 4NMRA 3RL8A 1K32A 1MC7A 1QAUA 2FCFA 3DJAA 2FN5A 2K20A 5GLJA 3WKMA 2KOJA 2EAQA 1QAVA 2KL1A 1U37A 2RRMA 2DB5A 2H3LA 2Z9IA 3OTPA 1G9OA 3ID3A 5G1EA 4Z8JA 1Z87A 1OBYA 5B6LA 2KPKA 1V5QA 2GZVA 1V5LA 2LOBA 2M0ZA 2OSGA 1GM1A 3PS4A 3MH7A 3NFLA 5HEDA 5E11A 1N7FA 1TE0A 1R6JA 1UEQA 2WL7A 2IWNA 2I0LA 3NGHA 5E6PB 3FY5A 2I0IA 2VSPA 2R3YA 1Z86A 2KQFA 5HFEA 1MFLA 1KY9A 3KZDA 4K78A 2VRFA 2P3WA 2AWWA 5FB8C 3DJ3A 4IC6A 1MFGA 4UU5A 4JOJA 3SFJA 2QKUA 2HE4A 4GHNA 3KHFA 3LNXA 2YT8A 4JOHA 5A2PA 5HFBA 4K6YA 1Y7NA 1QLCA 5HF1A 1X5RA 3O5NA 5F67A 2OS6A 2H2BA 3TSZA 4OAJA 1Q3PA 3B76A 3NFKA 3SOEA 2IWPA 3I4WA 4GVCA 1RZXA 2KV8A 2EXGA 2O2TA 4JOKA 2OQSA 1WI2A 1BFEA 2Z17A 2CSSA 3QJMA 2BYGA 2YT7A 3EGHC 4E35A 2M10A 1X5NA 4Q6SA 1I16A 1WG6A 3GDSA 4NXQA 1SOZA 2EDZA 2F0AA 2OCSA 3ID2A 2PKTA 1OBZA 1WH1A 2I04A 5E22A 1WF7A 2VZ5A 3WKLA 4NXPA 3MH6A 4REYA 1WFVA 3RLEA 1WFGA 2M3MA 2M0UA 1FC6A 4NMPA 1W9QA 4YYXA 1T2MA 5HEBA 3DJ1A 3PDVA 3CBZA 3PV2A 1UITA 5FHTA 3K82A 3DORA 5HF4A 2ENOA 2LC6A 2D8IA 2Q9VA 2VWRA 2QKTA 4L8NA 2JIKA 2EJYA 3TSVA 1NTEA 4OEPA 3HVQC 2EEIA 1NF3C 1Q7XA 1UF1A 3ID1A 1GQ4A 2JOAA 1UEZA 3CS0A 4JORA 3STJA 2IWOA 3JXTA 5D13A 4PQWA 2CS5A 2KBSA 3QE1A 2W7RA 4F8KA 1P1DA 2VSVA 4NMTA 1P1EA 2DKRA 3QIKA 4KFWA 4NMOA 2KOHA 1UJDA 2H3MA 4FGMA 4Q2OA 1WIFA 1WHAA 2LA8A 2JILA 3ID4A 2HGAA 3SUZA 3CH8A 2JREA 2DLUA 4NNMA 2EDVA 2PZDA 3GJ9A 3QGLA 2OGPA 1RGRA 3DIWA 3K1RA 5F3XA 1UEWA 5DTHA 2QBWA 1X45A 4G69A 3BPUA 1VB7A 2DLSA 1UJVA 3K50A 2MX6A 4NXRA 4JL7A 2IWQA 1W9EA 2KJKA 3MH4A 4K75A 4JOEA 2DJTA 2EGNA 1XZ9A 1IU0A 1N6DA 5I7ZA 1IHJA 2OMJA 1FC7A 5HETA 1I92A 1Y8TA 2AINA 4HOPB 2KJPA 1V1TA 4H11A 2I4SA 4JOPA 3GCNA 2RCZA 4YDPA 2ZPMA 4K72A 3SHWA 2EV8A 2DMZA 3SHUA 2DM8A 1WHDA 3ZRTA 4Q2QA 2JXOA 3HPKA 2CSJA 4NMSA 2OZFA 4E3BA 3GGEA 3GDVA 3TSWA 2EGOA 1FC9A 3R68A 2PA1A 2L4SA 3R0HA 3GCOA 4R2ZA 2ZPLA 3HPMA 2EEHA 5EYZA 1WJLA 3QO6A 4Q6HA 4Q2NA 1UHPA 3GSLA 3LNYA 2JINA 2KAWA 1OZIA 4N6XA 2QG1A 3EGGC 2FE5A 2M0VA 1Q3OA 2AWXA 1WI4A 3KZEA 5HDYA 4MPAA 1GQ5A 1X5QA 4Z33A 4O06A 4RI0A
chains in the Genus database with same CATH superfamily
3CYYA 2M0TA 1TP3A 2EEJA 1UFXA 2REYA 5E1YA 4XHVA 4P0CA 4P2AB 2R4HA 2W4FA 2E7KA 1VAEA 1UJUA 4NNLA 3L4FD 1QAVB 4LMMA 2D90A 2DC2A 2PKUA 2KYLA 1D5GA 2QKVA 2K1ZA 1N7EA 2EHRA 3I18A 4NMVA 2L97A 1FCFA 2MHOA 2KJDA 2G5MB 1TQ3A 1N7TA 2G2LA 1X8SA 1WF8A 4OEOA 1RGWA 1KWAA 1U39A 4Q3HA 1LCYA 5HFFA 3VQFA 4WYTA 2AWUA 5H3JA 3AXAA 4UU6A 3QDOA 2EGKA 2EDPA 1PDRA 4Q2PA 2L4TA 2PNTA 5HEYA 4NMQA 2KPLA 2LC7A 3CBYA 4HOPA 2HE2A 5E21A 1OBXA 1N6EA 1UEPA 2I6VA 1L6OA 1UM7A 1VJ6A 2GEFA 3E17A 1M5ZA 3OU0A 4WYUA 1KEFA 3TMHA 3QJNA 1VA8A 3R69A 2X7ZA 2YUBA 4JJ3A 2JWEA 4K76A 1IU2A 5EZ0A 1B8QA 1U38A 2D92A 2KA9A 1BE9A 2KG2A 4AMHA 1V62A 4JOGA 2V90A 5GNDA 5JXBA 1YBOA 1SOTA 1U3BA 1X6DA 2YUYA 5HJ1A 2PDZA 3CC0A 2KRGA 3GDUA 2DAZA 2V1WA 1N6FA 1ZUBA 2OPGA 2KOMA 3I1EA 3PV4A 2YTWA 1RY4A 2EEGA 4EDJA 4GVDA 1ZOKA 2H2CA 4KFVA 3PDZA 2F5YA 3CBXA 3PV5A 2Q3GA 4E34A 2UZCA 3VQGA 2QT5A 2VPHA 1V6BA 3O46A 5HFCA 1TP5A 2FNEA 1UM1A 1W9OA 2LUIA 4JOFA 5G1DA 5IL9A 1VCWA 3RL7A 1N99A 2I1NA 5HFDA 4NMRA 3RL8A 1K32A 1MC7A 1QAUA 2FCFA 3DJAA 2FN5A 2K20A 5GLJA 3WKMA 2KOJA 2EAQA 1QAVA 2KL1A 1U37A 2RRMA 2DB5A 2H3LA 2Z9IA 3OTPA 1G9OA 3ID3A 5G1EA 4Z8JA 1Z87A 1OBYA 5B6LA 2KPKA 1V5QA 2GZVA 1V5LA 2LOBA 2M0ZA 2OSGA 1GM1A 3PS4A 3MH7A 3NFLA 5HEDA 5E11A 1N7FA 1TE0A 1R6JA 1UEQA 2WL7A 2IWNA 2I0LA 3NGHA 5E6PB 1X9ZA 3FY5A 2I0IA 2VSPA 2R3YA 1Z86A 2KQFA 5HFEA 1MFLA 1KY9A 3KZDA 4K78A 2VRFA 2P3WA 2AWWA 5FB8C 3DJ3A 4IC6A 1MFGA 4UU5A 4JOJA 3SFJA 2QKUA 2HE4A 4GHNA 3KHFA 3LNXA 2YT8A 4JOHA 5A2PA 5HFBA 4K6YA 1Y7NA 1QLCA 5HF1A 1X5RA 3O5NA 5F67A 2OS6A 2H2BA 3TSZA 4OAJA 1Q3PA 3B76A 3NFKA 3SOEA 2IWPA 3I4WA 4GVCA 1RZXA 2KV8A 2EXGA 2O2TA 4JOKA 2OQSA 1WI2A 1BFEA 2Z17A 2CSSA 3QJMA 2BYGA 2YT7A 3EGHC 4E35A 2M10A 1X5NA 4Q6SA 1I16A 1WG6A 3GDSA 4FLNA 4NXQA 1SOZA 2EDZA 2F0AA 2OCSA 3ID2A 5ILBA 2PKTA 1OBZA 1WH1A 2I04A 5E22A 1WF7A 3NCVA 2VZ5A 3WKLA 4NXPA 3MH6A 4REYA 1WFVA 3RLEA 4JJ0A 1WFGA 2M3MA 2M0UA 1FC6A 4NMPA 1W9QA 4YYXA 1T2MA 5HEBA 3DJ1A 3PDVA 3CBZA 3PV2A 1UITA 5FHTA 3K82A 3DORA 5HF4A 2ENOA 2LC6A 2D8IA 2Q9VA 2VWRA 2QKTA 4L8NA 2JIKA 2EJYA 3TSVA 1NTEA 4OEPA 3HVQC 2EEIA 1NF3C 1Q7XA 1UF1A 3ID1A 1GQ4A 2JOAA 1UEZA 3CS0A 4JORA 3STJA 2IWOA 3JXTA 5D13A 4PQWA 2CS5A 2KBSA 3KDGA 3QE1A 2W7RA 4F8KA 1P1DA 2VSVA 4NMTA 1P1EA 2DKRA 3QIKA 4KFWA 4NMOA 2KOHA 1UJDA 2H3MA 5B42A 4FGMA 4Q2OA 1WIFA 1WHAA 2LA8A 2JILA 3ID4A 2HGAA 3SUZA 3CH8A 2JREA 2DLUA 4NNMA 2EDVA 2PZDA 3GJ9A 3QGLA 2OGPA 1RGRA 3DIWA 3K1RA 5F3XA 1UEWA 5DTHA 2QBWA 1X45A 4G69A 3BPUA 1VB7A 2DLSA 3GABA 1UJVA 3K50A 2MX6A 4NXRA 4JL7A 2IWQA 1W9EA 2KJKA 3MH4A 4K75A 4JOEA 2DJTA 2EGNA 1XZ9A 1IU0A 1N6DA 5I7ZA 1IHJA 2OMJA 1FC7A 5HETA 1I92A 1Y8TA 2AINA 4HOPB 2KJPA 1V1TA 4H11A 2I4SA 4JOPA 3GCNA 2RCZA 4YDPA 2ZPMA 4K72A 3SHWA 2EV8A 2DMZA 3SHUA 2DM8A 1WHDA 3KDKA 3ZRTA 4Q2QA 2JXOA 3HPKA 2CSJA 4NMSA 2OZFA 4E3BA 3GGEA 3GDVA 3TSWA 2EGOA 1FC9A 3R68A 2PA1A 2L4SA 3R0HA 3GCOA 4R2ZA 2ZPLA 3HPMA 2EEHA 5EYZA 1WJLA 3QO6A 2JSNA 4Q6HA 4Q2NA 1UHPA 3GSLA 3LNYA 2JINA 2KAWA 1OZIA 4N6XA 2QG1A 3EGGC 2FE5A 2M0VA 1Q3OA 2AWXA 1WI4A 3KZEA 5HDYA 4MPAA 1GQ5A 1X5QA 4Z33A 4O06A 4RI0A
chains in the Genus database with same CATH topology
3CYYA 2M0TA 1TP3A 2EEJA 1UFXA 2REYA 5E1YA 4XHVA 4P0CA 4P2AB 2R4HA 2W4FA 2E7KA 1VAEA 1UJUA 4NNLA 3L4FD 1QAVB 4LMMA 2D90A 2DC2A 2PKUA 2KYLA 1D5GA 2QKVA 2K1ZA 1N7EA 2EHRA 3I18A 4NMVA 2L97A 1FCFA 2MHOA 2KJDA 2G5MB 1TQ3A 1N7TA 2G2LA 1X8SA 1WF8A 4OEOA 1RGWA 1KWAA 1U39A 4Q3HA 1LCYA 5HFFA 3VQFA 4WYTA 2AWUA 5H3JA 3AXAA 4UU6A 3QDOA 2EGKA 2EDPA 1PDRA 4Q2PA 2L4TA 2PNTA 5HEYA 4NMQA 2KPLA 2LC7A 3CBYA 4HOPA 2HE2A 5E21A 1OBXA 1N6EA 1UEPA 2I6VA 1L6OA 1UM7A 1VJ6A 2GEFA 3E17A 1M5ZA 3OU0A 4WYUA 1KEFA 3TMHA 3QJNA 1VA8A 3R69A 2X7ZA 2YUBA 4JJ3A 2JWEA 4K76A 1IU2A 5EZ0A 1B8QA 1U38A 2D92A 2KA9A 1BE9A 2KG2A 4AMHA 1V62A 4JOGA 2V90A 5GNDA 5JXBA 1YBOA 1SOTA 1U3BA 1X6DA 2YUYA 5HJ1A 2PDZA 3CC0A 2KRGA 3GDUA 2DAZA 2V1WA 1N6FA 1ZUBA 2OPGA 2KOMA 3I1EA 3PV4A 2YTWA 1RY4A 2EEGA 4EDJA 4GVDA 1ZOKA 2H2CA 4KFVA 3PDZA 2F5YA 3CBXA 3PV5A 2Q3GA 4E34A 2UZCA 3VQGA 2QT5A 2VPHA 1V6BA 3O46A 5HFCA 1TP5A 2FNEA 1UM1A 1W9OA 2LUIA 4JOFA 5G1DA 5IL9A 1VCWA 3RL7A 1N99A 2I1NA 5HFDA 4NMRA 3RL8A 1K32A 1MC7A 1QAUA 2FCFA 3DJAA 2FN5A 2K20A 5GLJA 3WKMA 2KOJA 2EAQA 1QAVA 2KL1A 1U37A 2RRMA 2DB5A 2H3LA 2Z9IA 3OTPA 1G9OA 3ID3A 5G1EA 4Z8JA 1Z87A 1OBYA 5B6LA 2KPKA 1V5QA 2GZVA 1V5LA 2LOBA 2M0ZA 2OSGA 1GM1A 3PS4A 3MH7A 3NFLA 5HEDA 5E11A 1N7FA 1TE0A 1R6JA 1UEQA 2WL7A 2IWNA 2I0LA 3NGHA 5E6PB 1X9ZA 3FY5A 2I0IA 2VSPA 2R3YA 1Z86A 2KQFA 5HFEA 1MFLA 1KY9A 3KZDA 4K78A 2VRFA 2P3WA 2AWWA 5FB8C 3DJ3A 4IC6A 1MFGA 4UU5A 4JOJA 3SFJA 2QKUA 2HE4A 4GHNA 3KHFA 3LNXA 2YT8A 4JOHA 5A2PA 5HFBA 4K6YA 1Y7NA 1QLCA 5HF1A 1X5RA 3O5NA 5F67A 2OS6A 2H2BA 3TSZA 4OAJA 1Q3PA 3B76A 3NFKA 3SOEA 2IWPA 3I4WA 4GVCA 1RZXA 2KV8A 2EXGA 2O2TA 4JOKA 2OQSA 1WI2A 1BFEA 2Z17A 2CSSA 3QJMA 2BYGA 2YT7A 3EGHC 4E35A 2M10A 1X5NA 4Q6SA 1I16A 1WG6A 3GDSA 4FLNA 4NXQA 1SOZA 2EDZA 2F0AA 2OCSA 3ID2A 5ILBA 2PKTA 1OBZA 1WH1A 2I04A 5E22A 1WF7A 3NCVA 2VZ5A 3WKLA 4NXPA 3MH6A 4REYA 1WFVA 3RLEA 4JJ0A 1WFGA 2M3MA 2M0UA 1FC6A 4NMPA 1W9QA 4YYXA 1T2MA 5HEBA 3DJ1A 3PDVA 3CBZA 3PV2A 1UITA 5FHTA 3K82A 3DORA 5HF4A 2ENOA 2LC6A 2D8IA 2Q9VA 2VWRA 2QKTA 4L8NA 2JIKA 2EJYA 3TSVA 1NTEA 4OEPA 3HVQC 2EEIA 1NF3C 1Q7XA 1UF1A 3ID1A 1GQ4A 2JOAA 1UEZA 3CS0A 4JORA 3STJA 2IWOA 3JXTA 5D13A 4PQWA 2CS5A 2KBSA 3KDGA 3QE1A 2W7RA 4F8KA 1P1DA 2VSVA 4NMTA 1P1EA 2DKRA 3QIKA 4KFWA 4NMOA 2KOHA 1UJDA 2H3MA 5B42A 4FGMA 4Q2OA 1WIFA 1WHAA 2LA8A 2JILA 3ID4A 2HGAA 3SUZA 3CH8A 2JREA 2DLUA 4NNMA 2EDVA 2PZDA 3GJ9A 3QGLA 2OGPA 1RGRA 3DIWA 3K1RA 5F3XA 1UEWA 5DTHA 2QBWA 1X45A 4G69A 3BPUA 1VB7A 2DLSA 3GABA 1UJVA 3K50A 2MX6A 4NXRA 4JL7A 2IWQA 1W9EA 2KJKA 3MH4A 4K75A 4JOEA 2DJTA 2EGNA 1XZ9A 1IU0A 1N6DA 5I7ZA 1IHJA 2OMJA 1FC7A 5HETA 1I92A 1Y8TA 2AINA 4HOPB 2KJPA 1V1TA 4H11A 2I4SA 4JOPA 3GCNA 2RCZA 4YDPA 2ZPMA 4K72A 3SHWA 2EV8A 2DMZA 3SHUA 2DM8A 1WHDA 3KDKA 3ZRTA 4Q2QA 2JXOA 3HPKA 2CSJA 4NMSA 2OZFA 4E3BA 3GGEA 3GDVA 3TSWA 2EGOA 1FC9A 3R68A 2PA1A 2L4SA 3R0HA 3GCOA 4R2ZA 2ZPLA 3HPMA 2EEHA 5EYZA 1WJLA 3QO6A 2JSNA 4Q6HA 4Q2NA 1UHPA 3GSLA 3LNYA 2JINA 2KAWA 1OZIA 4N6XA 2QG1A 3EGGC 2FE5A 2M0VA 1Q3OA 2AWXA 1WI4A 3KZEA 5HDYA 4MPAA 1GQ5A 1X5QA 4Z33A 4O06A 4RI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYY A;  2M0T A;  1TP3 A;  2EEJ A;  1UFX A;  2REY A;  5E1Y A;  4XHV A;  4P0C A;  4P2A B;  2R4H A;  2W4F A;  2E7K A;  1VAE A;  1UJU A;  4NNL A;  3L4F D;  1QAV B;  4LMM A;  2D90 A;  2DC2 A;  2PKU A;  2KYL A;  1D5G A;  2QKV A;  2K1Z A;  1N7E A;  2EHR A;  3I18 A;  4NMV A;  2L97 A;  1FCF A;  2MHO A;  2KJD A;  2G5M B;  1TQ3 A;  1N7T A;  2G2L A;  1X8S A;  1WF8 A;  4OEO A;  1RGW A;  1KWA A;  1U39 A;  4Q3H A;  1LCY A;  5HFF A;  3VQF A;  4WYT A;  2AWU A;  5H3J A;  3AXA A;  4UU6 A;  3QDO A;  2EGK A;  2EDP A;  1PDR A;  4Q2P A;  2L4T A;  2PNT A;  5HEY A;  4NMQ A;  2KPL A;  2LC7 A;  3CBY A;  4HOP A;  2HE2 A;  5E21 A;  1OBX A;  1N6E A;  1UEP A;  2I6V A;  1L6O A;  1UM7 A;  1VJ6 A;  3E17 A;  1M5Z A;  3OU0 A;  4WYU A;  1KEF A;  3TMH A;  3QJN A;  1VA8 A;  3R69 A;  2X7Z A;  2YUB A;  2JWE A;  4K76 A;  1IU2 A;  5EZ0 A;  1B8Q A;  1U38 A;  2D92 A;  2KA9 A;  1BE9 A;  2KG2 A;  4AMH A;  1V62 A;  4JOG A;  2V90 A;  5GND A;  5JXB A;  1YBO A;  1SOT A;  1U3B A;  1X6D A;  2YUY A;  5HJ1 A;  2PDZ A;  3CC0 A;  2KRG A;  3GDU A;  2DAZ A;  2V1W A;  1N6F A;  1ZUB A;  2OPG A;  2KOM A;  3I1E A;  3PV4 A;  2YTW A;  1RY4 A;  2EEG A;  4EDJ A;  4GVD A;  1ZOK A;  2H2C A;  4KFV A;  3PDZ A;  2F5Y A;  3CBX A;  3PV5 A;  2Q3G A;  4E34 A;  2UZC A;  3VQG A;  2QT5 A;  2VPH A;  1V6B A;  3O46 A;  5HFC A;  1TP5 A;  2FNE A;  1UM1 A;  1W9O A;  2LUI A;  4JOF A;  5G1D A;  1VCW A;  3RL7 A;  1N99 A;  2I1N A;  5HFD A;  4NMR A;  3RL8 A;  1K32 A;  1MC7 A;  1QAU A;  2FCF A;  3DJA A;  2FN5 A;  2K20 A;  5GLJ A;  3WKM A;  2KOJ A;  2EAQ A;  1QAV A;  2KL1 A;  1U37 A;  2RRM A;  2DB5 A;  2H3L A;  2Z9I A;  3OTP A;  1G9O A;  3ID3 A;  5G1E A;  4Z8J A;  1Z87 A;  1OBY A;  5B6L A;  2KPK A;  1V5Q A;  2GZV A;  1V5L A;  2LOB A;  2M0Z A;  2OSG A;  1GM1 A;  3PS4 A;  3MH7 A;  3NFL A;  5HED A;  5E11 A;  1N7F A;  1TE0 A;  1R6J A;  1UEQ A;  2WL7 A;  2IWN A;  2I0L A;  3NGH A;  5E6P B;  3FY5 A;  2I0I A;  2VSP A;  2R3Y A;  1Z86 A;  2KQF A;  5HFE A;  1MFL A;  1KY9 A;  3KZD A;  4K78 A;  2VRF A;  2P3W A;  2AWW A;  5FB8 C;  3DJ3 A;  4IC6 A;  1MFG A;  4UU5 A;  4JOJ A;  3SFJ A;  2QKU A;  2HE4 A;  4GHN A;  3KHF A;  3LNX A;  2YT8 A;  4JOH A;  5A2P A;  5HFB A;  4K6Y A;  1Y7N A;  1QLC A;  5HF1 A;  1X5R A;  3O5N A;  5F67 A;  2OS6 A;  2H2B A;  3TSZ A;  4OAJ A;  1Q3P A;  3B76 A;  3NFK A;  3SOE A;  2IWP A;  3I4W A;  4GVC A;  1RZX A;  2KV8 A;  2EXG A;  2O2T A;  4JOK A;  2OQS A;  1WI2 A;  1BFE A;  2Z17 A;  2CSS A;  3QJM A;  2BYG A;  2YT7 A;  3EGH C;  4E35 A;  2M10 A;  1X5N A;  4Q6S A;  1I16 A;  1WG6 A;  3GDS A;  4NXQ A;  1SOZ A;  2EDZ A;  2F0A A;  2OCS A;  3ID2 A;  2PKT A;  1OBZ A;  1WH1 A;  2I04 A;  5E22 A;  1WF7 A;  2VZ5 A;  3WKL A;  4NXP A;  3MH6 A;  4REY A;  1WFV A;  3RLE A;  1WFG A;  2M3M A;  2M0U A;  1FC6 A;  4NMP A;  1W9Q A;  4YYX A;  1T2M A;  5HEB A;  3DJ1 A;  3PDV A;  3CBZ A;  3PV2 A;  1UIT A;  5FHT A;  3K82 A;  3DOR A;  5HF4 A;  2ENO A;  2LC6 A;  2D8I A;  2Q9V A;  2VWR A;  2QKT A;  4L8N A;  2JIK A;  2EJY A;  3TSV A;  1NTE A;  4OEP A;  3HVQ C;  2EEI A;  1NF3 C;  1Q7X A;  1UF1 A;  3ID1 A;  1GQ4 A;  2JOA A;  1UEZ A;  3CS0 A;  4JOR A;  3STJ A;  2IWO A;  3JXT A;  5D13 A;  4PQW A;  2CS5 A;  2KBS A;  3QE1 A;  2W7R A;  4F8K A;  1P1D A;  2VSV A;  4NMT A;  1P1E A;  2DKR A;  3QIK A;  4KFW A;  4NMO A;  2KOH A;  1UJD A;  2H3M A;  4FGM A;  4Q2O A;  1WIF A;  1WHA A;  2LA8 A;  2JIL A;  3ID4 A;  2HGA A;  3SUZ A;  3CH8 A;  2JRE A;  2DLU A;  4NNM A;  2EDV A;  2PZD A;  3GJ9 A;  3QGL A;  2OGP A;  1RGR A;  3DIW A;  3K1R A;  5F3X A;  1UEW A;  5DTH A;  2QBW A;  1X45 A;  4G69 A;  3BPU A;  1VB7 A;  2DLS A;  1UJV A;  3K50 A;  2MX6 A;  4NXR A;  4JL7 A;  2IWQ A;  1W9E A;  2KJK A;  3MH4 A;  4K75 A;  4JOE A;  2DJT A;  2EGN A;  1XZ9 A;  1IU0 A;  1N6D A;  5I7Z A;  1IHJ A;  2OMJ A;  1FC7 A;  5HET A;  1I92 A;  1Y8T A;  2AIN A;  4HOP B;  2KJP A;  1V1T A;  4H11 A;  2I4S A;  4JOP A;  3GCN A;  2RCZ A;  4YDP A;  2ZPM A;  4K72 A;  3SHW A;  2EV8 A;  2DMZ A;  3SHU A;  2DM8 A;  1WHD A;  3ZRT A;  4Q2Q A;  2JXO A;  3HPK A;  2CSJ A;  4NMS A;  2OZF A;  4E3B A;  3GGE A;  3GDV A;  3TSW A;  2EGO A;  1FC9 A;  3R68 A;  2PA1 A;  2L4S A;  3R0H A;  3GCO A;  4R2Z A;  2ZPL A;  3HPM A;  2EEH A;  5EYZ A;  1WJL A;  3QO6 A;  4Q6H A;  4Q2N A;  1UHP A;  3GSL A;  3LNY A;  2JIN A;  2KAW A;  1OZI A;  4N6X A;  2QG1 A;  3EGG C;  2FE5 A;  2M0V A;  1Q3O A;  2AWX A;  1WI4 A;  3KZE A;  5HDY A;  4MPA A;  1GQ5 A;  1X5Q A;  4Z33 A;  4O06 A;  4RI0 A; 
#chains in the Genus database with same CATH topology
 3CYY A;  2M0T A;  1TP3 A;  2EEJ A;  1UFX A;  2REY A;  5E1Y A;  4XHV A;  4P0C A;  4P2A B;  2R4H A;  2W4F A;  2E7K A;  1VAE A;  1UJU A;  4NNL A;  3L4F D;  1QAV B;  4LMM A;  2D90 A;  2DC2 A;  2PKU A;  2KYL A;  1D5G A;  2QKV A;  2K1Z A;  1N7E A;  2EHR A;  3I18 A;  4NMV A;  2L97 A;  1FCF A;  2MHO A;  2KJD A;  2G5M B;  1TQ3 A;  1N7T A;  2G2L A;  1X8S A;  1WF8 A;  4OEO A;  1RGW A;  1KWA A;  1U39 A;  4Q3H A;  1LCY A;  5HFF A;  3VQF A;  4WYT A;  2AWU A;  5H3J A;  3AXA A;  4UU6 A;  3QDO A;  2EGK A;  2EDP A;  1PDR A;  4Q2P A;  2L4T A;  2PNT A;  5HEY A;  4NMQ A;  2KPL A;  2LC7 A;  3CBY A;  4HOP A;  2HE2 A;  5E21 A;  1OBX A;  1N6E A;  1UEP A;  2I6V A;  1L6O A;  1UM7 A;  1VJ6 A;  2GEF A;  3E17 A;  1M5Z A;  3OU0 A;  4WYU A;  1KEF A;  3TMH A;  3QJN A;  1VA8 A;  3R69 A;  2X7Z A;  2YUB A;  4JJ3 A;  2JWE A;  4K76 A;  1IU2 A;  5EZ0 A;  1B8Q A;  1U38 A;  2D92 A;  2KA9 A;  1BE9 A;  2KG2 A;  4AMH A;  1V62 A;  4JOG A;  2V90 A;  5GND A;  5JXB A;  1YBO A;  1SOT A;  1U3B A;  1X6D A;  2YUY A;  5HJ1 A;  2PDZ A;  3CC0 A;  2KRG A;  3GDU A;  2DAZ A;  2V1W A;  1N6F A;  1ZUB A;  2OPG A;  2KOM A;  3I1E A;  3PV4 A;  2YTW A;  1RY4 A;  2EEG A;  4EDJ A;  4GVD A;  1ZOK A;  2H2C A;  4KFV A;  3PDZ A;  2F5Y A;  3CBX A;  3PV5 A;  2Q3G A;  4E34 A;  2UZC A;  3VQG A;  2QT5 A;  2VPH A;  1V6B A;  3O46 A;  5HFC A;  1TP5 A;  2FNE A;  1UM1 A;  1W9O A;  2LUI A;  4JOF A;  5G1D A;  5IL9 A;  1VCW A;  3RL7 A;  1N99 A;  2I1N A;  5HFD A;  4NMR A;  3RL8 A;  1K32 A;  1MC7 A;  1QAU A;  2FCF A;  3DJA A;  2FN5 A;  2K20 A;  5GLJ A;  3WKM A;  2KOJ A;  2EAQ A;  1QAV A;  2KL1 A;  1U37 A;  2RRM A;  2DB5 A;  2H3L A;  2Z9I A;  3OTP A;  1G9O A;  3ID3 A;  5G1E A;  4Z8J A;  1Z87 A;  1OBY A;  5B6L A;  2KPK A;  1V5Q A;  2GZV A;  1V5L A;  2LOB A;  2M0Z A;  2OSG A;  1GM1 A;  3PS4 A;  3MH7 A;  3NFL A;  5HED A;  5E11 A;  1N7F A;  1TE0 A;  1R6J A;  1UEQ A;  2WL7 A;  2IWN A;  2I0L A;  3NGH A;  5E6P B;  1X9Z A;  3FY5 A;  2I0I A;  2VSP A;  2R3Y A;  1Z86 A;  2KQF A;  5HFE A;  1MFL A;  1KY9 A;  3KZD A;  4K78 A;  2VRF A;  2P3W A;  2AWW A;  5FB8 C;  3DJ3 A;  4IC6 A;  1MFG A;  4UU5 A;  4JOJ A;  3SFJ A;  2QKU A;  2HE4 A;  4GHN A;  3KHF A;  3LNX A;  2YT8 A;  4JOH A;  5A2P A;  5HFB A;  4K6Y A;  1Y7N A;  1QLC A;  5HF1 A;  1X5R A;  3O5N A;  5F67 A;  2OS6 A;  2H2B A;  3TSZ A;  4OAJ A;  1Q3P A;  3B76 A;  3NFK A;  3SOE A;  2IWP A;  3I4W A;  4GVC A;  1RZX A;  2KV8 A;  2EXG A;  2O2T A;  4JOK A;  2OQS A;  1WI2 A;  1BFE A;  2Z17 A;  2CSS A;  3QJM A;  2BYG A;  2YT7 A;  3EGH C;  4E35 A;  2M10 A;  1X5N A;  4Q6S A;  1I16 A;  1WG6 A;  3GDS A;  4FLN A;  4NXQ A;  1SOZ A;  2EDZ A;  2F0A A;  2OCS A;  3ID2 A;  5ILB A;  2PKT A;  1OBZ A;  1WH1 A;  2I04 A;  5E22 A;  1WF7 A;  3NCV A;  2VZ5 A;  3WKL A;  4NXP A;  3MH6 A;  4REY A;  1WFV A;  3RLE A;  4JJ0 A;  1WFG A;  2M3M A;  2M0U A;  1FC6 A;  4NMP A;  1W9Q A;  4YYX A;  1T2M A;  5HEB A;  3DJ1 A;  3PDV A;  3CBZ A;  3PV2 A;  1UIT A;  5FHT A;  3K82 A;  3DOR A;  5HF4 A;  2ENO A;  2LC6 A;  2D8I A;  2Q9V A;  2VWR A;  2QKT A;  4L8N A;  2JIK A;  2EJY A;  3TSV A;  1NTE A;  4OEP A;  3HVQ C;  2EEI A;  1NF3 C;  1Q7X A;  1UF1 A;  3ID1 A;  1GQ4 A;  2JOA A;  1UEZ A;  3CS0 A;  4JOR A;  3STJ A;  2IWO A;  3JXT A;  5D13 A;  4PQW A;  2CS5 A;  2KBS A;  3KDG A;  3QE1 A;  2W7R A;  4F8K A;  1P1D A;  2VSV A;  4NMT A;  1P1E A;  2DKR A;  3QIK A;  4KFW A;  4NMO A;  2KOH A;  1UJD A;  2H3M A;  5B42 A;  4FGM A;  4Q2O A;  1WIF A;  1WHA A;  2LA8 A;  2JIL A;  3ID4 A;  2HGA A;  3SUZ A;  3CH8 A;  2JRE A;  2DLU A;  4NNM A;  2EDV A;  2PZD A;  3GJ9 A;  3QGL A;  2OGP A;  1RGR A;  3DIW A;  3K1R A;  5F3X A;  1UEW A;  5DTH A;  2QBW A;  1X45 A;  4G69 A;  3BPU A;  1VB7 A;  2DLS A;  3GAB A;  1UJV A;  3K50 A;  2MX6 A;  4NXR A;  4JL7 A;  2IWQ A;  1W9E A;  2KJK A;  3MH4 A;  4K75 A;  4JOE A;  2DJT A;  2EGN A;  1XZ9 A;  1IU0 A;  1N6D A;  5I7Z A;  1IHJ A;  2OMJ A;  1FC7 A;  5HET A;  1I92 A;  1Y8T A;  2AIN A;  4HOP B;  2KJP A;  1V1T A;  4H11 A;  2I4S A;  4JOP A;  3GCN A;  2RCZ A;  4YDP A;  2ZPM A;  4K72 A;  3SHW A;  2EV8 A;  2DMZ A;  3SHU A;  2DM8 A;  1WHD A;  3KDK A;  3ZRT A;  4Q2Q A;  2JXO A;  3HPK A;  2CSJ A;  4NMS A;  2OZF A;  4E3B A;  3GGE A;  3GDV A;  3TSW A;  2EGO A;  1FC9 A;  3R68 A;  2PA1 A;  2L4S A;  3R0H A;  3GCO A;  4R2Z A;  2ZPL A;  3HPM A;  2EEH A;  5EYZ A;  1WJL A;  3QO6 A;  2JSN A;  4Q6H A;  4Q2N A;  1UHP A;  3GSL A;  3LNY A;  2JIN A;  2KAW A;  1OZI A;  4N6X A;  2QG1 A;  3EGG C;  2FE5 A;  2M0V A;  1Q3O A;  2AWX A;  1WI4 A;  3KZE A;  5HDY A;  4MPA A;  1GQ5 A;  1X5Q A;  4Z33 A;  4O06 A;  4RI0 A; 
#chains in the Genus database with same CATH homology
 3CYY A;  2M0T A;  1TP3 A;  2EEJ A;  1UFX A;  2REY A;  5E1Y A;  4XHV A;  4P0C A;  4P2A B;  2R4H A;  2W4F A;  2E7K A;  1VAE A;  1UJU A;  4NNL A;  3L4F D;  1QAV B;  4LMM A;  2D90 A;  2DC2 A;  2PKU A;  2KYL A;  1D5G A;  2QKV A;  2K1Z A;  1N7E A;  2EHR A;  3I18 A;  4NMV A;  2L97 A;  1FCF A;  2MHO A;  2KJD A;  2G5M B;  1TQ3 A;  1N7T A;  2G2L A;  1X8S A;  1WF8 A;  4OEO A;  1RGW A;  1KWA A;  1U39 A;  4Q3H A;  1LCY A;  5HFF A;  3VQF A;  4WYT A;  2AWU A;  5H3J A;  3AXA A;  4UU6 A;  3QDO A;  2EGK A;  2EDP A;  1PDR A;  4Q2P A;  2L4T A;  2PNT A;  5HEY A;  4NMQ A;  2KPL A;  2LC7 A;  3CBY A;  4HOP A;  2HE2 A;  5E21 A;  1OBX A;  1N6E A;  1UEP A;  2I6V A;  1L6O A;  1UM7 A;  1VJ6 A;  2GEF A;  3E17 A;  1M5Z A;  3OU0 A;  4WYU A;  1KEF A;  3TMH A;  3QJN A;  1VA8 A;  3R69 A;  2X7Z A;  2YUB A;  4JJ3 A;  2JWE A;  4K76 A;  1IU2 A;  5EZ0 A;  1B8Q A;  1U38 A;  2D92 A;  2KA9 A;  1BE9 A;  2KG2 A;  4AMH A;  1V62 A;  4JOG A;  2V90 A;  5GND A;  5JXB A;  1YBO A;  1SOT A;  1U3B A;  1X6D A;  2YUY A;  5HJ1 A;  2PDZ A;  3CC0 A;  2KRG A;  3GDU A;  2DAZ A;  2V1W A;  1N6F A;  1ZUB A;  2OPG A;  2KOM A;  3I1E A;  3PV4 A;  2YTW A;  1RY4 A;  2EEG A;  4EDJ A;  4GVD A;  1ZOK A;  2H2C A;  4KFV A;  3PDZ A;  2F5Y A;  3CBX A;  3PV5 A;  2Q3G A;  4E34 A;  2UZC A;  3VQG A;  2QT5 A;  2VPH A;  1V6B A;  3O46 A;  5HFC A;  1TP5 A;  2FNE A;  1UM1 A;  1W9O A;  2LUI A;  4JOF A;  5G1D A;  5IL9 A;  1VCW A;  3RL7 A;  1N99 A;  2I1N A;  5HFD A;  4NMR A;  3RL8 A;  1K32 A;  1MC7 A;  1QAU A;  2FCF A;  3DJA A;  2FN5 A;  2K20 A;  5GLJ A;  3WKM A;  2KOJ A;  2EAQ A;  1QAV A;  2KL1 A;  1U37 A;  2RRM A;  2DB5 A;  2H3L A;  2Z9I A;  3OTP A;  1G9O A;  3ID3 A;  5G1E A;  4Z8J A;  1Z87 A;  1OBY A;  5B6L A;  2KPK A;  1V5Q A;  2GZV A;  1V5L A;  2LOB A;  2M0Z A;  2OSG A;  1GM1 A;  3PS4 A;  3MH7 A;  3NFL A;  5HED A;  5E11 A;  1N7F A;  1TE0 A;  1R6J A;  1UEQ A;  2WL7 A;  2IWN A;  2I0L A;  3NGH A;  5E6P B;  1X9Z A;  3FY5 A;  2I0I A;  2VSP A;  2R3Y A;  1Z86 A;  2KQF A;  5HFE A;  1MFL A;  1KY9 A;  3KZD A;  4K78 A;  2VRF A;  2P3W A;  2AWW A;  5FB8 C;  3DJ3 A;  4IC6 A;  1MFG A;  4UU5 A;  4JOJ A;  3SFJ A;  2QKU A;  2HE4 A;  4GHN A;  3KHF A;  3LNX A;  2YT8 A;  4JOH A;  5A2P A;  5HFB A;  4K6Y A;  1Y7N A;  1QLC A;  5HF1 A;  1X5R A;  3O5N A;  5F67 A;  2OS6 A;  2H2B A;  3TSZ A;  4OAJ A;  1Q3P A;  3B76 A;  3NFK A;  3SOE A;  2IWP A;  3I4W A;  4GVC A;  1RZX A;  2KV8 A;  2EXG A;  2O2T A;  4JOK A;  2OQS A;  1WI2 A;  1BFE A;  2Z17 A;  2CSS A;  3QJM A;  2BYG A;  2YT7 A;  3EGH C;  4E35 A;  2M10 A;  1X5N A;  4Q6S A;  1I16 A;  1WG6 A;  3GDS A;  4FLN A;  4NXQ A;  1SOZ A;  2EDZ A;  2F0A A;  2OCS A;  3ID2 A;  5ILB A;  2PKT A;  1OBZ A;  1WH1 A;  2I04 A;  5E22 A;  1WF7 A;  3NCV A;  2VZ5 A;  3WKL A;  4NXP A;  3MH6 A;  4REY A;  1WFV A;  3RLE A;  4JJ0 A;  1WFG A;  2M3M A;  2M0U A;  1FC6 A;  4NMP A;  1W9Q A;  4YYX A;  1T2M A;  5HEB A;  3DJ1 A;  3PDV A;  3CBZ A;  3PV2 A;  1UIT A;  5FHT A;  3K82 A;  3DOR A;  5HF4 A;  2ENO A;  2LC6 A;  2D8I A;  2Q9V A;  2VWR A;  2QKT A;  4L8N A;  2JIK A;  2EJY A;  3TSV A;  1NTE A;  4OEP A;  3HVQ C;  2EEI A;  1NF3 C;  1Q7X A;  1UF1 A;  3ID1 A;  1GQ4 A;  2JOA A;  1UEZ A;  3CS0 A;  4JOR A;  3STJ A;  2IWO A;  3JXT A;  5D13 A;  4PQW A;  2CS5 A;  2KBS A;  3KDG A;  3QE1 A;  2W7R A;  4F8K A;  1P1D A;  2VSV A;  4NMT A;  1P1E A;  2DKR A;  3QIK A;  4KFW A;  4NMO A;  2KOH A;  1UJD A;  2H3M A;  5B42 A;  4FGM A;  4Q2O A;  1WIF A;  1WHA A;  2LA8 A;  2JIL A;  3ID4 A;  2HGA A;  3SUZ A;  3CH8 A;  2JRE A;  2DLU A;  4NNM A;  2EDV A;  2PZD A;  3GJ9 A;  3QGL A;  2OGP A;  1RGR A;  3DIW A;  3K1R A;  5F3X A;  1UEW A;  5DTH A;  2QBW A;  1X45 A;  4G69 A;  3BPU A;  1VB7 A;  2DLS A;  3GAB A;  1UJV A;  3K50 A;  2MX6 A;  4NXR A;  4JL7 A;  2IWQ A;  1W9E A;  2KJK A;  3MH4 A;  4K75 A;  4JOE A;  2DJT A;  2EGN A;  1XZ9 A;  1IU0 A;  1N6D A;  5I7Z A;  1IHJ A;  2OMJ A;  1FC7 A;  5HET A;  1I92 A;  1Y8T A;  2AIN A;  4HOP B;  2KJP A;  1V1T A;  4H11 A;  2I4S A;  4JOP A;  3GCN A;  2RCZ A;  4YDP A;  2ZPM A;  4K72 A;  3SHW A;  2EV8 A;  2DMZ A;  3SHU A;  2DM8 A;  1WHD A;  3KDK A;  3ZRT A;  4Q2Q A;  2JXO A;  3HPK A;  2CSJ A;  4NMS A;  2OZF A;  4E3B A;  3GGE A;  3GDV A;  3TSW A;  2EGO A;  1FC9 A;  3R68 A;  2PA1 A;  2L4S A;  3R0H A;  3GCO A;  4R2Z A;  2ZPL A;  3HPM A;  2EEH A;  5EYZ A;  1WJL A;  3QO6 A;  2JSN A;  4Q6H A;  4Q2N A;  1UHP A;  3GSL A;  3LNY A;  2JIN A;  2KAW A;  1OZI A;  4N6X A;  2QG1 A;  3EGG C;  2FE5 A;  2M0V A;  1Q3O A;  2AWX A;  1WI4 A;  3KZE A;  5HDY A;  4MPA A;  1GQ5 A;  1X5Q A;  4Z33 A;  4O06 A;  4RI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...