1VA8A

Solution structure of the pdz domain of pals1 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGPITDERVYESIGHYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAGUK p55 subfamily member 5
publication title Solution structure of the PDZ domain of Pals1 protein
rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1va8A01
2KOJA 2QKTA 2EGNA 2KAWA 4O06A 1I92A 2YUYA 3PDVA 3PS4A 3QJMA 2PA1A 1U38A 3QE1A 1MFLA 3EGHC 5HFFA 2AWWA 1X5NA 1BE9A 4LMMA 2LOBA 2M0ZA 5HEYA 2KJPA 4OAJA 3KZEA 2OGPA 5E21A 3RL7A 2K20A 2KG2A 4N6XA 2PZDA 1N7EA 3TSZA 4P0CA 4GHNA 3KZDA 1U37A 1N7FA 4GVDA 3R0HA 2KA9A 3LNYA 2EAQA 1ZOKA 1N99A 3FY5A 1WI2A 3ID1A 2D90A 2BYGA 2M3MA 2G5MB 4JOFA 2IWQA 2IWPA 1FC7A 3PDZA 1X6DA 1W9EA 3MH7A 1W9QA 2D8IA 3SHWA 1WI4A 2CSJA 2JREA 5B6LA 3CYYA 1FCFA 5DTHA 3SUZA 1OBXA 2CSSA 4XHVA 2F5YA 2RCZA 1RY4A 3HVQC 2I04A 2RRMA 1VA8A 3CBZA 2ZPMA 1WG6A 3I18A 2PNTA 4FGMA 1X45A 3HPMA 3PV5A 2H3LA 3QGLA 2YT7A 1OBYA 2I0LA 2OQSA 2KJDA 1MC7A 1OBZA 4JOGA 2VPHA 1G9OA 2KV8A 2LC7A 1U39A 1X5RA 5F3XA 2CS5A 4Z8JA 4YDPA 5H3JA 3K50A 2EEHA 3GSLA 2JOAA 3MH6A 5A2PA 2I4SA 2H3MA 2LA8A 1K32A 2I0IA 2V1WA 5HF1A 5HDYA 2H2CA 1QAVB 1UJUA 1Y7NA 1UITA 1VAEA 2VWRA 3I4WA 2PKUA 2YUBA 3NGHA 4NXQA 2QG1A 3DJAA 3TSWA 2KL1A 3CBXA 1TQ3A 1V5QA 1UFXA 1N7TA 2O2TA 2I6VA 2D92A 3L4FD 2K1ZA 2MHOA 4F8KA 3VQGA 2EEJA 3O5NA 1WIFA 3ID2A 1U3BA 5JXBA 1UM7A 3WKMA 5D13A 2ZPLA 2Z17A 2WL7A 2DLSA 2JWEA 2LUIA 2VSVA 4H11A 1V62A 1GM1A 1YBOA 2DB5A 2OZFA 2QKVA 1UEQA 2VSPA 4WYTA 4GVCA 4G69A 2IWOA 4NMTA 2DJTA 4E35A 1Q7XA 5G1EA 1Z86A 4JOPA 2R3YA 4Q2NA 1WF7A 2EDPA 3STJA 2YTWA 1UM1A 2Q9VA 3GDUA 4HOPA 1D5GA 4KFWA 2KRGA 2KYLA 2L4SA 4EDJA 4JOJA 3GCNA 1R6JA 2DKRA 3NFKA 1Z87A 2Z9IA 4PQWA 3PV2A 4Q2QA 4K6YA 5FB8C 2PKTA 5HFEA 2PDZA 2R4HA 2KOHA 2EHRA 2QBWA 5HFDA 1T2MA 1UEZA 2EDVA 2VRFA 2OMJA 2X7ZA 3K1RA 3ZRTA 4NNLA 4YYXA 4Q6HA 1Q3PA 3B76A 1Y8TA 2DAZA 1N6FA 1N6DA 4JL7A 2FCFA 4IC6A 2EJYA 3ID3A 1KY9A 1N6EA 4KFVA 2FE5A 2YT8A 3I1EA 2QKUA 3E17A 1RZXA 2UZCA 5E22A 4JORA 3VQFA 2HE2A 4MPAA 4UU6A 5F67A 3QJNA 2JINA 2EEGA 3DJ3A 2OSGA 4K72A 1IHJA 2M10A 2GZVA 3CH8A 5HF4A 1WFVA 2W4FA 5HETA 5FHTA 5E6PB 1UF1A 2G2LA 2KJKA 4NXRA 3NFLA 4K75A 3DORA 3JXTA 1VB7A 3SHUA 2QT5A 4Z33A 3BPUA 5E11A 2EXGA 5GNDA 2M0TA 3CBYA 3K82A 2KPKA 2HGAA 2L4TA 2DMZA 5GLJA 1FC6A 3RLEA 1TP3A 1VJ6A 1WJLA 3MH4A 1P1DA 3OTPA 2I1NA 4NNMA 1X5QA 3DJ1A 4NMOA 1UJVA 1ZUBA 3GDSA 2M0VA 2OPGA 1QAUA 2REYA 3QO6A 2AWUA 1MFGA 1WHDA 2EGOA 2EEIA 1UEWA 4UU5A 2FN5A 5HEBA 4HOPB 2LC6A 5HFCA 2EDZA 1Q3OA 1OZIA 1KWAA 1UHPA 2DLUA 1QAVA 3AXAA 4NXPA 1X8SA 4NMQA 2KQFA 3CS0A 4JOHA 1IU0A 1GQ5A 1M5ZA 1VCWA 3R69A 4P2AB 4Q2OA 1P1EA 5G1DA 1B8QA 2H2BA 4AMHA 2AWXA 1WF8A 1WHAA 1TE0A 2AINA 2F0AA 3TSVA 4NMVA 1UJDA 2VZ5A 1BFEA 4WYUA 2W7RA 2EV8A 3LNXA 3O46A 2DM8A 5HFBA 1NF3C 4E3BA 1RGRA 3RL8A 4NMSA 1IU2A 2JXOA 1FC9A 3KHFA 2V90A 3GJ9A 1NTEA 5HEDA 2EGKA 4Q6SA 4RI0A 1TP5A 1UEPA 3GGEA 3R68A 2KPLA 3PV4A 4Q2PA 1GQ4A 1W9OA 4R2ZA 2L97A 4NMRA 2M0UA 5EYZA 1KEFA 4K78A 3DIWA 3GDVA 1RGWA 1PDRA 1V1TA 4L8NA 3QDOA 1L6OA 2ENOA 1SOTA 3HPKA 4OEPA 3SFJA 3EGGC 3SOEA 4K76A 2IWNA 1I16A 3TMHA 3CC0A 4Q3HA 4JOKA 2OS6A 3OU0A 2P3WA 3WKLA 1XZ9A 2JIKA 4OEOA 1WH1A 1V6BA 1LCYA 5HJ1A 2DC2A 1QLCA 2MX6A 1SOZA 5E1YA 2JILA 2Q3GA 4E34A 2KBSA 5I7ZA 3QIKA 5EZ0A 4NMPA 2E7KA 2OCSA 1WFGA 3ID4A 4JOEA 3GCOA 2FNEA 4REYA 2HE4A 2KOMA 1V5LA
chains in the Genus database with same CATH superfamily
2KOJA 2QKTA 2EGNA 2KAWA 4O06A 1I92A 2YUYA 3PDVA 3PS4A 3QJMA 2PA1A 1U38A 3QE1A 1MFLA 3EGHC 5HFFA 2AWWA 1X5NA 1BE9A 4LMMA 2LOBA 2M0ZA 5HEYA 2KJPA 4OAJA 3KZEA 2OGPA 5E21A 3RL7A 2K20A 2KG2A 4N6XA 2PZDA 1N7EA 3TSZA 4P0CA 4GHNA 3KZDA 1U37A 1N7FA 4GVDA 3R0HA 2KA9A 3LNYA 2EAQA 1ZOKA 1N99A 3FY5A 1WI2A 3ID1A 2D90A 2BYGA 2M3MA 2G5MB 4JOFA 2IWQA 2IWPA 1FC7A 3PDZA 3KDKA 1X6DA 1W9EA 3MH7A 1W9QA 2D8IA 3SHWA 1WI4A 2CSJA 2JREA 5B6LA 3CYYA 1FCFA 5DTHA 3SUZA 1OBXA 2CSSA 2GEFA 4XHVA 2F5YA 2RCZA 1RY4A 3HVQC 2I04A 2RRMA 1VA8A 3CBZA 2ZPMA 1WG6A 3I18A 2PNTA 4FGMA 1X45A 3HPMA 3PV5A 2H3LA 3QGLA 2YT7A 1OBYA 2I0LA 2OQSA 2KJDA 1MC7A 1OBZA 4JOGA 2VPHA 1G9OA 2KV8A 2LC7A 1U39A 1X5RA 5F3XA 2CS5A 4Z8JA 4YDPA 5H3JA 3K50A 2EEHA 3GSLA 2JOAA 3MH6A 5A2PA 2I4SA 2H3MA 2LA8A 1K32A 2I0IA 2V1WA 5HF1A 5HDYA 2H2CA 1QAVB 1UJUA 1Y7NA 1UITA 1VAEA 2VWRA 3I4WA 2PKUA 2YUBA 3NGHA 4NXQA 2QG1A 3DJAA 3TSWA 2KL1A 3CBXA 1TQ3A 1V5QA 1UFXA 1N7TA 2O2TA 5B42A 2I6VA 2D92A 3L4FD 2K1ZA 2MHOA 4F8KA 3VQGA 2EEJA 3O5NA 1WIFA 3ID2A 1U3BA 5JXBA 1UM7A 3WKMA 5D13A 2ZPLA 2Z17A 2WL7A 2DLSA 2JWEA 2LUIA 2VSVA 4H11A 1V62A 1GM1A 1YBOA 2DB5A 2OZFA 2QKVA 1UEQA 2VSPA 4WYTA 4GVCA 4G69A 2IWOA 4NMTA 2DJTA 4E35A 1Q7XA 5G1EA 1Z86A 4JOPA 2R3YA 4Q2NA 1WF7A 2EDPA 3STJA 2YTWA 1UM1A 2Q9VA 3GDUA 4HOPA 1D5GA 4KFWA 2KRGA 2KYLA 2L4SA 4EDJA 4JOJA 3GCNA 1R6JA 2DKRA 3NFKA 1Z87A 2Z9IA 4PQWA 3PV2A 4Q2QA 4K6YA 5FB8C 2PKTA 5HFEA 2PDZA 2R4HA 2KOHA 2EHRA 2QBWA 5HFDA 1T2MA 1UEZA 2EDVA 2VRFA 2OMJA 2X7ZA 3K1RA 3ZRTA 4NNLA 4YYXA 4Q6HA 1Q3PA 3B76A 1Y8TA 2DAZA 1N6FA 1N6DA 4JL7A 2FCFA 4IC6A 2EJYA 3ID3A 1KY9A 1N6EA 4KFVA 2FE5A 2YT8A 3I1EA 2QKUA 3E17A 1RZXA 2UZCA 5E22A 4JORA 3VQFA 2HE2A 4MPAA 4UU6A 5F67A 3QJNA 2JINA 2EEGA 3DJ3A 2OSGA 4K72A 1IHJA 2M10A 2GZVA 3CH8A 5HF4A 1WFVA 2W4FA 5HETA 5FHTA 5E6PB 1UF1A 2G2LA 2KJKA 4NXRA 3NFLA 4K75A 3DORA 3JXTA 1VB7A 3SHUA 2QT5A 4Z33A 3BPUA 5E11A 2EXGA 5GNDA 2M0TA 3CBYA 3K82A 2KPKA 2HGAA 2L4TA 2DMZA 5GLJA 1FC6A 3RLEA 1TP3A 1VJ6A 1WJLA 3MH4A 1P1DA 3OTPA 2I1NA 4NNMA 1X5QA 3DJ1A 4NMOA 1UJVA 1ZUBA 3GDSA 2M0VA 2OPGA 1QAUA 2REYA 3QO6A 2AWUA 1MFGA 1WHDA 2EGOA 2EEIA 1UEWA 4UU5A 2FN5A 5HEBA 4HOPB 2LC6A 5HFCA 2EDZA 1Q3OA 1OZIA 1KWAA 1UHPA 2DLUA 1QAVA 5ILBA 3AXAA 3KDGA 4NXPA 3GABA 1X8SA 4NMQA 2KQFA 3CS0A 4JOHA 1IU0A 1GQ5A 3NCVA 1M5ZA 1VCWA 3R69A 4P2AB 4JJ3A 4Q2OA 1P1EA 5G1DA 1B8QA 2H2BA 4AMHA 2AWXA 1WF8A 1WHAA 1TE0A 2AINA 2F0AA 3TSVA 4NMVA 1UJDA 2VZ5A 1BFEA 4WYUA 2W7RA 2EV8A 3LNXA 3O46A 2DM8A 5HFBA 1NF3C 4E3BA 1RGRA 3RL8A 4NMSA 4JJ0A 1IU2A 2JXOA 1FC9A 3KHFA 2V90A 3GJ9A 1NTEA 1X9ZA 5HEDA 2EGKA 4Q6SA 4RI0A 1TP5A 1UEPA 3GGEA 3R68A 2KPLA 3PV4A 4Q2PA 1GQ4A 1W9OA 4R2ZA 2L97A 4NMRA 2M0UA 5EYZA 1KEFA 4K78A 3DIWA 3GDVA 1RGWA 1PDRA 1V1TA 4L8NA 3QDOA 1L6OA 2ENOA 1SOTA 3HPKA 4OEPA 3SFJA 3EGGC 3SOEA 4K76A 2IWNA 1I16A 3TMHA 3CC0A 4Q3HA 4JOKA 2OS6A 3OU0A 2P3WA 3WKLA 1XZ9A 2JSNA 2JIKA 4OEOA 1WH1A 1V6BA 1LCYA 5HJ1A 2DC2A 1QLCA 4FLNA 2MX6A 1SOZA 5E1YA 5IL9A 2JILA 2Q3GA 4E34A 2KBSA 5I7ZA 3QIKA 5EZ0A 4NMPA 2E7KA 2OCSA 1WFGA 3ID4A 4JOEA 3GCOA 2FNEA 4REYA 2HE4A 2KOMA 1V5LA
chains in the Genus database with same CATH topology
2KOJA 2QKTA 2EGNA 2KAWA 4O06A 1I92A 2YUYA 3PDVA 3PS4A 3QJMA 2PA1A 1U38A 3QE1A 1MFLA 3EGHC 5HFFA 2AWWA 1X5NA 1BE9A 4LMMA 2LOBA 2M0ZA 5HEYA 2KJPA 4OAJA 3KZEA 2OGPA 5E21A 3RL7A 2K20A 2KG2A 4N6XA 2PZDA 1N7EA 3TSZA 4P0CA 4GHNA 3KZDA 1U37A 1N7FA 4GVDA 3R0HA 2KA9A 3LNYA 2EAQA 1ZOKA 1N99A 3FY5A 1WI2A 3ID1A 2D90A 2BYGA 2M3MA 2G5MB 4JOFA 2IWQA 2IWPA 1FC7A 3PDZA 3KDKA 1X6DA 1W9EA 3MH7A 1W9QA 2D8IA 3SHWA 1WI4A 2CSJA 2JREA 5B6LA 3CYYA 1FCFA 5DTHA 3SUZA 1OBXA 2CSSA 2GEFA 4XHVA 2F5YA 2RCZA 1RY4A 3HVQC 2I04A 2RRMA 1VA8A 3CBZA 2ZPMA 1WG6A 3I18A 2PNTA 4FGMA 1X45A 3HPMA 3PV5A 2H3LA 3QGLA 2YT7A 1OBYA 2I0LA 2OQSA 2KJDA 1MC7A 1OBZA 4JOGA 2VPHA 1G9OA 2KV8A 2LC7A 1U39A 1X5RA 5F3XA 2CS5A 4Z8JA 4YDPA 5H3JA 3K50A 2EEHA 3GSLA 2JOAA 3MH6A 5A2PA 2I4SA 2H3MA 2LA8A 1K32A 2I0IA 2V1WA 5HF1A 5HDYA 2H2CA 1QAVB 1UJUA 1Y7NA 1UITA 1VAEA 2VWRA 3I4WA 2PKUA 2YUBA 3NGHA 4NXQA 2QG1A 3DJAA 3TSWA 2KL1A 3CBXA 1TQ3A 1V5QA 1UFXA 1N7TA 2O2TA 5B42A 2I6VA 2D92A 3L4FD 2K1ZA 2MHOA 4F8KA 3VQGA 2EEJA 3O5NA 1WIFA 3ID2A 1U3BA 5JXBA 1UM7A 3WKMA 5D13A 2ZPLA 2Z17A 2WL7A 2DLSA 2JWEA 2LUIA 2VSVA 4H11A 1V62A 1GM1A 1YBOA 2DB5A 2OZFA 2QKVA 1UEQA 2VSPA 4WYTA 4GVCA 4G69A 2IWOA 4NMTA 2DJTA 4E35A 1Q7XA 5G1EA 1Z86A 4JOPA 2R3YA 4Q2NA 1WF7A 2EDPA 3STJA 2YTWA 1UM1A 2Q9VA 3GDUA 4HOPA 1D5GA 4KFWA 2KRGA 2KYLA 2L4SA 4EDJA 4JOJA 3GCNA 1R6JA 2DKRA 3NFKA 1Z87A 2Z9IA 4PQWA 3PV2A 4Q2QA 4K6YA 5FB8C 2PKTA 5HFEA 2PDZA 2R4HA 2KOHA 2EHRA 2QBWA 5HFDA 1T2MA 1UEZA 2EDVA 2VRFA 2OMJA 2X7ZA 3K1RA 3ZRTA 4NNLA 4YYXA 4Q6HA 1Q3PA 3B76A 1Y8TA 2DAZA 1N6FA 1N6DA 4JL7A 2FCFA 4IC6A 2EJYA 3ID3A 1KY9A 1N6EA 4KFVA 2FE5A 2YT8A 3I1EA 2QKUA 3E17A 1RZXA 2UZCA 5E22A 4JORA 3VQFA 2HE2A 4MPAA 4UU6A 5F67A 3QJNA 2JINA 2EEGA 3DJ3A 2OSGA 4K72A 1IHJA 2M10A 2GZVA 3CH8A 5HF4A 1WFVA 2W4FA 5HETA 5FHTA 5E6PB 1UF1A 2G2LA 2KJKA 4NXRA 3NFLA 4K75A 3DORA 3JXTA 1VB7A 3SHUA 2QT5A 4Z33A 3BPUA 5E11A 2EXGA 5GNDA 2M0TA 3CBYA 3K82A 2KPKA 2HGAA 2L4TA 2DMZA 5GLJA 1FC6A 3RLEA 1TP3A 1VJ6A 1WJLA 3MH4A 1P1DA 3OTPA 2I1NA 4NNMA 1X5QA 3DJ1A 4NMOA 1UJVA 1ZUBA 3GDSA 2M0VA 2OPGA 1QAUA 2REYA 3QO6A 2AWUA 1MFGA 1WHDA 2EGOA 2EEIA 1UEWA 4UU5A 2FN5A 5HEBA 4HOPB 2LC6A 5HFCA 2EDZA 1Q3OA 1OZIA 1KWAA 1UHPA 2DLUA 1QAVA 5ILBA 3AXAA 3KDGA 4NXPA 3GABA 1X8SA 4NMQA 2KQFA 3CS0A 4JOHA 1IU0A 1GQ5A 3NCVA 1M5ZA 1VCWA 3R69A 4P2AB 4JJ3A 4Q2OA 1P1EA 5G1DA 1B8QA 2H2BA 4AMHA 2AWXA 1WF8A 1WHAA 1TE0A 2AINA 2F0AA 3TSVA 4NMVA 1UJDA 2VZ5A 1BFEA 4WYUA 2W7RA 2EV8A 3LNXA 3O46A 2DM8A 5HFBA 1NF3C 4E3BA 1RGRA 3RL8A 4NMSA 4JJ0A 1IU2A 2JXOA 1FC9A 3KHFA 2V90A 3GJ9A 1NTEA 1X9ZA 5HEDA 2EGKA 4Q6SA 4RI0A 1TP5A 1UEPA 3GGEA 3R68A 2KPLA 3PV4A 4Q2PA 1GQ4A 1W9OA 4R2ZA 2L97A 4NMRA 2M0UA 5EYZA 1KEFA 4K78A 3DIWA 3GDVA 1RGWA 1PDRA 1V1TA 4L8NA 3QDOA 1L6OA 2ENOA 1SOTA 3HPKA 4OEPA 3SFJA 3EGGC 3SOEA 4K76A 2IWNA 1I16A 3TMHA 3CC0A 4Q3HA 4JOKA 2OS6A 3OU0A 2P3WA 3WKLA 1XZ9A 2JSNA 2JIKA 4OEOA 1WH1A 1V6BA 1LCYA 5HJ1A 2DC2A 1QLCA 4FLNA 2MX6A 1SOZA 5E1YA 5IL9A 2JILA 2Q3GA 4E34A 2KBSA 5I7ZA 3QIKA 5EZ0A 4NMPA 2E7KA 2OCSA 1WFGA 3ID4A 4JOEA 3GCOA 2FNEA 4REYA 2HE4A 2KOMA 1V5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOJ A;  2QKT A;  2EGN A;  2KAW A;  4O06 A;  1I92 A;  2YUY A;  3PDV A;  3PS4 A;  3QJM A;  2PA1 A;  1U38 A;  3QE1 A;  1MFL A;  3EGH C;  5HFF A;  2AWW A;  1X5N A;  1BE9 A;  4LMM A;  2LOB A;  2M0Z A;  5HEY A;  2KJP A;  4OAJ A;  3KZE A;  2OGP A;  5E21 A;  3RL7 A;  2K20 A;  2KG2 A;  4N6X A;  2PZD A;  1N7E A;  3TSZ A;  4P0C A;  4GHN A;  3KZD A;  1U37 A;  1N7F A;  4GVD A;  3R0H A;  2KA9 A;  3LNY A;  2EAQ A;  1ZOK A;  1N99 A;  3FY5 A;  1WI2 A;  3ID1 A;  2D90 A;  2BYG A;  2M3M A;  2G5M B;  4JOF A;  2IWQ A;  2IWP A;  1FC7 A;  3PDZ A;  1X6D A;  1W9E A;  3MH7 A;  1W9Q A;  2D8I A;  3SHW A;  1WI4 A;  2CSJ A;  2JRE A;  5B6L A;  3CYY A;  1FCF A;  5DTH A;  3SUZ A;  1OBX A;  2CSS A;  4XHV A;  2F5Y A;  2RCZ A;  1RY4 A;  3HVQ C;  2I04 A;  2RRM A;  1VA8 A;  3CBZ A;  2ZPM A;  1WG6 A;  3I18 A;  2PNT A;  4FGM A;  1X45 A;  3HPM A;  3PV5 A;  2H3L A;  3QGL A;  2YT7 A;  1OBY A;  2I0L A;  2OQS A;  2KJD A;  1MC7 A;  1OBZ A;  4JOG A;  2VPH A;  1G9O A;  2KV8 A;  2LC7 A;  1U39 A;  1X5R A;  5F3X A;  2CS5 A;  4Z8J A;  4YDP A;  5H3J A;  3K50 A;  2EEH A;  3GSL A;  2JOA A;  3MH6 A;  5A2P A;  2I4S A;  2H3M A;  2LA8 A;  1K32 A;  2I0I A;  2V1W A;  5HF1 A;  5HDY A;  2H2C A;  1QAV B;  1UJU A;  1Y7N A;  1UIT A;  1VAE A;  2VWR A;  3I4W A;  2PKU A;  2YUB A;  3NGH A;  4NXQ A;  2QG1 A;  3DJA A;  3TSW A;  2KL1 A;  3CBX A;  1TQ3 A;  1V5Q A;  1UFX A;  1N7T A;  2O2T A;  2I6V A;  2D92 A;  3L4F D;  2K1Z A;  2MHO A;  4F8K A;  3VQG A;  2EEJ A;  3O5N A;  1WIF A;  3ID2 A;  1U3B A;  5JXB A;  1UM7 A;  3WKM A;  5D13 A;  2ZPL A;  2Z17 A;  2WL7 A;  2DLS A;  2JWE A;  2LUI A;  2VSV A;  4H11 A;  1V62 A;  1GM1 A;  1YBO A;  2DB5 A;  2OZF A;  2QKV A;  1UEQ A;  2VSP A;  4WYT A;  4GVC A;  4G69 A;  2IWO A;  4NMT A;  2DJT A;  4E35 A;  1Q7X A;  5G1E A;  1Z86 A;  4JOP A;  2R3Y A;  4Q2N A;  1WF7 A;  2EDP A;  3STJ A;  2YTW A;  1UM1 A;  2Q9V A;  3GDU A;  4HOP A;  1D5G A;  4KFW A;  2KRG A;  2KYL A;  2L4S A;  4EDJ A;  4JOJ A;  3GCN A;  1R6J A;  2DKR A;  3NFK A;  1Z87 A;  2Z9I A;  4PQW A;  3PV2 A;  4Q2Q A;  4K6Y A;  5FB8 C;  2PKT A;  5HFE A;  2PDZ A;  2R4H A;  2KOH A;  2EHR A;  2QBW A;  5HFD A;  1T2M A;  1UEZ A;  2EDV A;  2VRF A;  2OMJ A;  2X7Z A;  3K1R A;  3ZRT A;  4NNL A;  4YYX A;  4Q6H A;  1Q3P A;  3B76 A;  1Y8T A;  2DAZ A;  1N6F A;  1N6D A;  4JL7 A;  2FCF A;  4IC6 A;  2EJY A;  3ID3 A;  1KY9 A;  1N6E A;  4KFV A;  2FE5 A;  2YT8 A;  3I1E A;  2QKU A;  3E17 A;  1RZX A;  2UZC A;  5E22 A;  4JOR A;  3VQF A;  2HE2 A;  4MPA A;  4UU6 A;  5F67 A;  3QJN A;  2JIN A;  2EEG A;  3DJ3 A;  2OSG A;  4K72 A;  1IHJ A;  2M10 A;  2GZV A;  3CH8 A;  5HF4 A;  1WFV A;  2W4F A;  5HET A;  5FHT A;  5E6P B;  1UF1 A;  2G2L A;  2KJK A;  4NXR A;  3NFL A;  4K75 A;  3DOR A;  3JXT A;  1VB7 A;  3SHU A;  2QT5 A;  4Z33 A;  3BPU A;  5E11 A;  2EXG A;  5GND A;  2M0T A;  3CBY A;  3K82 A;  2KPK A;  2HGA A;  2L4T A;  2DMZ A;  5GLJ A;  1FC6 A;  3RLE A;  1TP3 A;  1VJ6 A;  1WJL A;  3MH4 A;  1P1D A;  3OTP A;  2I1N A;  4NNM A;  1X5Q A;  3DJ1 A;  4NMO A;  1UJV A;  1ZUB A;  3GDS A;  2M0V A;  2OPG A;  1QAU A;  2REY A;  3QO6 A;  2AWU A;  1MFG A;  1WHD A;  2EGO A;  2EEI A;  1UEW A;  4UU5 A;  2FN5 A;  5HEB A;  4HOP B;  2LC6 A;  5HFC A;  2EDZ A;  1Q3O A;  1OZI A;  1KWA A;  1UHP A;  2DLU A;  1QAV A;  3AXA A;  4NXP A;  1X8S A;  4NMQ A;  2KQF A;  3CS0 A;  4JOH A;  1IU0 A;  1GQ5 A;  1M5Z A;  1VCW A;  3R69 A;  4P2A B;  4Q2O A;  1P1E A;  5G1D A;  1B8Q A;  2H2B A;  4AMH A;  2AWX A;  1WF8 A;  1WHA A;  1TE0 A;  2AIN A;  2F0A A;  3TSV A;  4NMV A;  1UJD A;  2VZ5 A;  1BFE A;  4WYU A;  2W7R A;  2EV8 A;  3LNX A;  3O46 A;  2DM8 A;  5HFB A;  1NF3 C;  4E3B A;  1RGR A;  3RL8 A;  4NMS A;  1IU2 A;  2JXO A;  1FC9 A;  3KHF A;  2V90 A;  3GJ9 A;  1NTE A;  5HED A;  2EGK A;  4Q6S A;  4RI0 A;  1TP5 A;  1UEP A;  3GGE A;  3R68 A;  2KPL A;  3PV4 A;  4Q2P A;  1GQ4 A;  1W9O A;  4R2Z A;  2L97 A;  4NMR A;  2M0U A;  5EYZ A;  1KEF A;  4K78 A;  3DIW A;  3GDV A;  1RGW A;  1PDR A;  1V1T A;  4L8N A;  3QDO A;  1L6O A;  2ENO A;  1SOT A;  3HPK A;  4OEP A;  3SFJ A;  3EGG C;  3SOE A;  4K76 A;  2IWN A;  1I16 A;  3TMH A;  3CC0 A;  4Q3H A;  4JOK A;  2OS6 A;  3OU0 A;  2P3W A;  3WKL A;  1XZ9 A;  2JIK A;  4OEO A;  1WH1 A;  1V6B A;  1LCY A;  5HJ1 A;  2DC2 A;  1QLC A;  2MX6 A;  1SOZ A;  5E1Y A;  2JIL A;  2Q3G A;  4E34 A;  2KBS A;  5I7Z A;  3QIK A;  5EZ0 A;  4NMP A;  2E7K A;  2OCS A;  1WFG A;  3ID4 A;  4JOE A;  3GCO A;  2FNE A;  4REY A;  2HE4 A;  2KOM A;  1V5L A; 
#chains in the Genus database with same CATH topology
 2KOJ A;  2QKT A;  2EGN A;  2KAW A;  4O06 A;  1I92 A;  2YUY A;  3PDV A;  3PS4 A;  3QJM A;  2PA1 A;  1U38 A;  3QE1 A;  1MFL A;  3EGH C;  5HFF A;  2AWW A;  1X5N A;  1BE9 A;  4LMM A;  2LOB A;  2M0Z A;  5HEY A;  2KJP A;  4OAJ A;  3KZE A;  2OGP A;  5E21 A;  3RL7 A;  2K20 A;  2KG2 A;  4N6X A;  2PZD A;  1N7E A;  3TSZ A;  4P0C A;  4GHN A;  3KZD A;  1U37 A;  1N7F A;  4GVD A;  3R0H A;  2KA9 A;  3LNY A;  2EAQ A;  1ZOK A;  1N99 A;  3FY5 A;  1WI2 A;  3ID1 A;  2D90 A;  2BYG A;  2M3M A;  2G5M B;  4JOF A;  2IWQ A;  2IWP A;  1FC7 A;  3PDZ A;  3KDK A;  1X6D A;  1W9E A;  3MH7 A;  1W9Q A;  2D8I A;  3SHW A;  1WI4 A;  2CSJ A;  2JRE A;  5B6L A;  3CYY A;  1FCF A;  5DTH A;  3SUZ A;  1OBX A;  2CSS A;  2GEF A;  4XHV A;  2F5Y A;  2RCZ A;  1RY4 A;  3HVQ C;  2I04 A;  2RRM A;  1VA8 A;  3CBZ A;  2ZPM A;  1WG6 A;  3I18 A;  2PNT A;  4FGM A;  1X45 A;  3HPM A;  3PV5 A;  2H3L A;  3QGL A;  2YT7 A;  1OBY A;  2I0L A;  2OQS A;  2KJD A;  1MC7 A;  1OBZ A;  4JOG A;  2VPH A;  1G9O A;  2KV8 A;  2LC7 A;  1U39 A;  1X5R A;  5F3X A;  2CS5 A;  4Z8J A;  4YDP A;  5H3J A;  3K50 A;  2EEH A;  3GSL A;  2JOA A;  3MH6 A;  5A2P A;  2I4S A;  2H3M A;  2LA8 A;  1K32 A;  2I0I A;  2V1W A;  5HF1 A;  5HDY A;  2H2C A;  1QAV B;  1UJU A;  1Y7N A;  1UIT A;  1VAE A;  2VWR A;  3I4W A;  2PKU A;  2YUB A;  3NGH A;  4NXQ A;  2QG1 A;  3DJA A;  3TSW A;  2KL1 A;  3CBX A;  1TQ3 A;  1V5Q A;  1UFX A;  1N7T A;  2O2T A;  5B42 A;  2I6V A;  2D92 A;  3L4F D;  2K1Z A;  2MHO A;  4F8K A;  3VQG A;  2EEJ A;  3O5N A;  1WIF A;  3ID2 A;  1U3B A;  5JXB A;  1UM7 A;  3WKM A;  5D13 A;  2ZPL A;  2Z17 A;  2WL7 A;  2DLS A;  2JWE A;  2LUI A;  2VSV A;  4H11 A;  1V62 A;  1GM1 A;  1YBO A;  2DB5 A;  2OZF A;  2QKV A;  1UEQ A;  2VSP A;  4WYT A;  4GVC A;  4G69 A;  2IWO A;  4NMT A;  2DJT A;  4E35 A;  1Q7X A;  5G1E A;  1Z86 A;  4JOP A;  2R3Y A;  4Q2N A;  1WF7 A;  2EDP A;  3STJ A;  2YTW A;  1UM1 A;  2Q9V A;  3GDU A;  4HOP A;  1D5G A;  4KFW A;  2KRG A;  2KYL A;  2L4S A;  4EDJ A;  4JOJ A;  3GCN A;  1R6J A;  2DKR A;  3NFK A;  1Z87 A;  2Z9I A;  4PQW A;  3PV2 A;  4Q2Q A;  4K6Y A;  5FB8 C;  2PKT A;  5HFE A;  2PDZ A;  2R4H A;  2KOH A;  2EHR A;  2QBW A;  5HFD A;  1T2M A;  1UEZ A;  2EDV A;  2VRF A;  2OMJ A;  2X7Z A;  3K1R A;  3ZRT A;  4NNL A;  4YYX A;  4Q6H A;  1Q3P A;  3B76 A;  1Y8T A;  2DAZ A;  1N6F A;  1N6D A;  4JL7 A;  2FCF A;  4IC6 A;  2EJY A;  3ID3 A;  1KY9 A;  1N6E A;  4KFV A;  2FE5 A;  2YT8 A;  3I1E A;  2QKU A;  3E17 A;  1RZX A;  2UZC A;  5E22 A;  4JOR A;  3VQF A;  2HE2 A;  4MPA A;  4UU6 A;  5F67 A;  3QJN A;  2JIN A;  2EEG A;  3DJ3 A;  2OSG A;  4K72 A;  1IHJ A;  2M10 A;  2GZV A;  3CH8 A;  5HF4 A;  1WFV A;  2W4F A;  5HET A;  5FHT A;  5E6P B;  1UF1 A;  2G2L A;  2KJK A;  4NXR A;  3NFL A;  4K75 A;  3DOR A;  3JXT A;  1VB7 A;  3SHU A;  2QT5 A;  4Z33 A;  3BPU A;  5E11 A;  2EXG A;  5GND A;  2M0T A;  3CBY A;  3K82 A;  2KPK A;  2HGA A;  2L4T A;  2DMZ A;  5GLJ A;  1FC6 A;  3RLE A;  1TP3 A;  1VJ6 A;  1WJL A;  3MH4 A;  1P1D A;  3OTP A;  2I1N A;  4NNM A;  1X5Q A;  3DJ1 A;  4NMO A;  1UJV A;  1ZUB A;  3GDS A;  2M0V A;  2OPG A;  1QAU A;  2REY A;  3QO6 A;  2AWU A;  1MFG A;  1WHD A;  2EGO A;  2EEI A;  1UEW A;  4UU5 A;  2FN5 A;  5HEB A;  4HOP B;  2LC6 A;  5HFC A;  2EDZ A;  1Q3O A;  1OZI A;  1KWA A;  1UHP A;  2DLU A;  1QAV A;  5ILB A;  3AXA A;  3KDG A;  4NXP A;  3GAB A;  1X8S A;  4NMQ A;  2KQF A;  3CS0 A;  4JOH A;  1IU0 A;  1GQ5 A;  3NCV A;  1M5Z A;  1VCW A;  3R69 A;  4P2A B;  4JJ3 A;  4Q2O A;  1P1E A;  5G1D A;  1B8Q A;  2H2B A;  4AMH A;  2AWX A;  1WF8 A;  1WHA A;  1TE0 A;  2AIN A;  2F0A A;  3TSV A;  4NMV A;  1UJD A;  2VZ5 A;  1BFE A;  4WYU A;  2W7R A;  2EV8 A;  3LNX A;  3O46 A;  2DM8 A;  5HFB A;  1NF3 C;  4E3B A;  1RGR A;  3RL8 A;  4NMS A;  4JJ0 A;  1IU2 A;  2JXO A;  1FC9 A;  3KHF A;  2V90 A;  3GJ9 A;  1NTE A;  1X9Z A;  5HED A;  2EGK A;  4Q6S A;  4RI0 A;  1TP5 A;  1UEP A;  3GGE A;  3R68 A;  2KPL A;  3PV4 A;  4Q2P A;  1GQ4 A;  1W9O A;  4R2Z A;  2L97 A;  4NMR A;  2M0U A;  5EYZ A;  1KEF A;  4K78 A;  3DIW A;  3GDV A;  1RGW A;  1PDR A;  1V1T A;  4L8N A;  3QDO A;  1L6O A;  2ENO A;  1SOT A;  3HPK A;  4OEP A;  3SFJ A;  3EGG C;  3SOE A;  4K76 A;  2IWN A;  1I16 A;  3TMH A;  3CC0 A;  4Q3H A;  4JOK A;  2OS6 A;  3OU0 A;  2P3W A;  3WKL A;  1XZ9 A;  2JSN A;  2JIK A;  4OEO A;  1WH1 A;  1V6B A;  1LCY A;  5HJ1 A;  2DC2 A;  1QLC A;  4FLN A;  2MX6 A;  1SOZ A;  5E1Y A;  5IL9 A;  2JIL A;  2Q3G A;  4E34 A;  2KBS A;  5I7Z A;  3QIK A;  5EZ0 A;  4NMP A;  2E7K A;  2OCS A;  1WFG A;  3ID4 A;  4JOE A;  3GCO A;  2FNE A;  4REY A;  2HE4 A;  2KOM A;  1V5L A; 
#chains in the Genus database with same CATH homology
 2KOJ A;  2QKT A;  2EGN A;  2KAW A;  4O06 A;  1I92 A;  2YUY A;  3PDV A;  3PS4 A;  3QJM A;  2PA1 A;  1U38 A;  3QE1 A;  1MFL A;  3EGH C;  5HFF A;  2AWW A;  1X5N A;  1BE9 A;  4LMM A;  2LOB A;  2M0Z A;  5HEY A;  2KJP A;  4OAJ A;  3KZE A;  2OGP A;  5E21 A;  3RL7 A;  2K20 A;  2KG2 A;  4N6X A;  2PZD A;  1N7E A;  3TSZ A;  4P0C A;  4GHN A;  3KZD A;  1U37 A;  1N7F A;  4GVD A;  3R0H A;  2KA9 A;  3LNY A;  2EAQ A;  1ZOK A;  1N99 A;  3FY5 A;  1WI2 A;  3ID1 A;  2D90 A;  2BYG A;  2M3M A;  2G5M B;  4JOF A;  2IWQ A;  2IWP A;  1FC7 A;  3PDZ A;  3KDK A;  1X6D A;  1W9E A;  3MH7 A;  1W9Q A;  2D8I A;  3SHW A;  1WI4 A;  2CSJ A;  2JRE A;  5B6L A;  3CYY A;  1FCF A;  5DTH A;  3SUZ A;  1OBX A;  2CSS A;  2GEF A;  4XHV A;  2F5Y A;  2RCZ A;  1RY4 A;  3HVQ C;  2I04 A;  2RRM A;  1VA8 A;  3CBZ A;  2ZPM A;  1WG6 A;  3I18 A;  2PNT A;  4FGM A;  1X45 A;  3HPM A;  3PV5 A;  2H3L A;  3QGL A;  2YT7 A;  1OBY A;  2I0L A;  2OQS A;  2KJD A;  1MC7 A;  1OBZ A;  4JOG A;  2VPH A;  1G9O A;  2KV8 A;  2LC7 A;  1U39 A;  1X5R A;  5F3X A;  2CS5 A;  4Z8J A;  4YDP A;  5H3J A;  3K50 A;  2EEH A;  3GSL A;  2JOA A;  3MH6 A;  5A2P A;  2I4S A;  2H3M A;  2LA8 A;  1K32 A;  2I0I A;  2V1W A;  5HF1 A;  5HDY A;  2H2C A;  1QAV B;  1UJU A;  1Y7N A;  1UIT A;  1VAE A;  2VWR A;  3I4W A;  2PKU A;  2YUB A;  3NGH A;  4NXQ A;  2QG1 A;  3DJA A;  3TSW A;  2KL1 A;  3CBX A;  1TQ3 A;  1V5Q A;  1UFX A;  1N7T A;  2O2T A;  5B42 A;  2I6V A;  2D92 A;  3L4F D;  2K1Z A;  2MHO A;  4F8K A;  3VQG A;  2EEJ A;  3O5N A;  1WIF A;  3ID2 A;  1U3B A;  5JXB A;  1UM7 A;  3WKM A;  5D13 A;  2ZPL A;  2Z17 A;  2WL7 A;  2DLS A;  2JWE A;  2LUI A;  2VSV A;  4H11 A;  1V62 A;  1GM1 A;  1YBO A;  2DB5 A;  2OZF A;  2QKV A;  1UEQ A;  2VSP A;  4WYT A;  4GVC A;  4G69 A;  2IWO A;  4NMT A;  2DJT A;  4E35 A;  1Q7X A;  5G1E A;  1Z86 A;  4JOP A;  2R3Y A;  4Q2N A;  1WF7 A;  2EDP A;  3STJ A;  2YTW A;  1UM1 A;  2Q9V A;  3GDU A;  4HOP A;  1D5G A;  4KFW A;  2KRG A;  2KYL A;  2L4S A;  4EDJ A;  4JOJ A;  3GCN A;  1R6J A;  2DKR A;  3NFK A;  1Z87 A;  2Z9I A;  4PQW A;  3PV2 A;  4Q2Q A;  4K6Y A;  5FB8 C;  2PKT A;  5HFE A;  2PDZ A;  2R4H A;  2KOH A;  2EHR A;  2QBW A;  5HFD A;  1T2M A;  1UEZ A;  2EDV A;  2VRF A;  2OMJ A;  2X7Z A;  3K1R A;  3ZRT A;  4NNL A;  4YYX A;  4Q6H A;  1Q3P A;  3B76 A;  1Y8T A;  2DAZ A;  1N6F A;  1N6D A;  4JL7 A;  2FCF A;  4IC6 A;  2EJY A;  3ID3 A;  1KY9 A;  1N6E A;  4KFV A;  2FE5 A;  2YT8 A;  3I1E A;  2QKU A;  3E17 A;  1RZX A;  2UZC A;  5E22 A;  4JOR A;  3VQF A;  2HE2 A;  4MPA A;  4UU6 A;  5F67 A;  3QJN A;  2JIN A;  2EEG A;  3DJ3 A;  2OSG A;  4K72 A;  1IHJ A;  2M10 A;  2GZV A;  3CH8 A;  5HF4 A;  1WFV A;  2W4F A;  5HET A;  5FHT A;  5E6P B;  1UF1 A;  2G2L A;  2KJK A;  4NXR A;  3NFL A;  4K75 A;  3DOR A;  3JXT A;  1VB7 A;  3SHU A;  2QT5 A;  4Z33 A;  3BPU A;  5E11 A;  2EXG A;  5GND A;  2M0T A;  3CBY A;  3K82 A;  2KPK A;  2HGA A;  2L4T A;  2DMZ A;  5GLJ A;  1FC6 A;  3RLE A;  1TP3 A;  1VJ6 A;  1WJL A;  3MH4 A;  1P1D A;  3OTP A;  2I1N A;  4NNM A;  1X5Q A;  3DJ1 A;  4NMO A;  1UJV A;  1ZUB A;  3GDS A;  2M0V A;  2OPG A;  1QAU A;  2REY A;  3QO6 A;  2AWU A;  1MFG A;  1WHD A;  2EGO A;  2EEI A;  1UEW A;  4UU5 A;  2FN5 A;  5HEB A;  4HOP B;  2LC6 A;  5HFC A;  2EDZ A;  1Q3O A;  1OZI A;  1KWA A;  1UHP A;  2DLU A;  1QAV A;  5ILB A;  3AXA A;  3KDG A;  4NXP A;  3GAB A;  1X8S A;  4NMQ A;  2KQF A;  3CS0 A;  4JOH A;  1IU0 A;  1GQ5 A;  3NCV A;  1M5Z A;  1VCW A;  3R69 A;  4P2A B;  4JJ3 A;  4Q2O A;  1P1E A;  5G1D A;  1B8Q A;  2H2B A;  4AMH A;  2AWX A;  1WF8 A;  1WHA A;  1TE0 A;  2AIN A;  2F0A A;  3TSV A;  4NMV A;  1UJD A;  2VZ5 A;  1BFE A;  4WYU A;  2W7R A;  2EV8 A;  3LNX A;  3O46 A;  2DM8 A;  5HFB A;  1NF3 C;  4E3B A;  1RGR A;  3RL8 A;  4NMS A;  4JJ0 A;  1IU2 A;  2JXO A;  1FC9 A;  3KHF A;  2V90 A;  3GJ9 A;  1NTE A;  1X9Z A;  5HED A;  2EGK A;  4Q6S A;  4RI0 A;  1TP5 A;  1UEP A;  3GGE A;  3R68 A;  2KPL A;  3PV4 A;  4Q2P A;  1GQ4 A;  1W9O A;  4R2Z A;  2L97 A;  4NMR A;  2M0U A;  5EYZ A;  1KEF A;  4K78 A;  3DIW A;  3GDV A;  1RGW A;  1PDR A;  1V1T A;  4L8N A;  3QDO A;  1L6O A;  2ENO A;  1SOT A;  3HPK A;  4OEP A;  3SFJ A;  3EGG C;  3SOE A;  4K76 A;  2IWN A;  1I16 A;  3TMH A;  3CC0 A;  4Q3H A;  4JOK A;  2OS6 A;  3OU0 A;  2P3W A;  3WKL A;  1XZ9 A;  2JSN A;  2JIK A;  4OEO A;  1WH1 A;  1V6B A;  1LCY A;  5HJ1 A;  2DC2 A;  1QLC A;  4FLN A;  2MX6 A;  1SOZ A;  5E1Y A;  5IL9 A;  2JIL A;  2Q3G A;  4E34 A;  2KBS A;  5I7Z A;  3QIK A;  5EZ0 A;  4NMP A;  2E7K A;  2OCS A;  1WFG A;  3ID4 A;  4JOE A;  3GCO A;  2FNE A;  4REY A;  2HE4 A;  2KOM A;  1V5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...