1VA8A

Solution structure of the pdz domain of pals1 protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
113
structure length
113
Chain Sequence
GSSGSSGPITDERVYESIGHYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAGUK p55 subfamily member 5
publication title Solution structure of the PDZ domain of Pals1 protein
rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 13
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1va8A01
1Q3OA 4OAJA 2EAQA 2I0IA 3MH7A 2EGNA 1OBZA 2FNEA 2YTWA 2K1ZA 1VB7A 4NMQA 4NXPA 2UZCA 2AWXA 2AWUA 4Q3HA 1PDRA 1TP5A 4NMTA 4JOHA 2KRGA 4E34A 4JOJA 2RCZA 4LMMA 1GQ4A 2PZDA 3ID4A 1MFLA 1B8QA 2QKTA 2HE4A 3RL8A 1OBXA 2WL7A 1N6DA 3EGGC 3MH4A 1W9QA 5HF1A 1N6EA 1VA8A 4GHNA 5HDYA 2I04A 5GNDA 4PQWA 3HVQC 1WFVA 2KYLA 4N6XA 2EDVA 2VPHA 1U38A 3JXTA 2W4FA 1RZXA 2OS6A 5A2PA 2I6VA 1I16A 1QAVB 2ZPLA 3KZDA 2OGPA 2R4HA 2KJDA 2E7KA 2VSPA 5HF4A 1OZIA 1W9EA 2EJYA 2DM8A 1WF7A 3DJAA 5HEBA 5E6PB 1Q3PA 2EGKA 2LC6A 1ZUBA 2PKUA 2I1NA 2W7RA 1WG6A 2OPGA 1GQ5A 2QBWA 2H2CA 4G69A 1BE9A 1MC7A 2EEJA 3BPUA 2HE2A 1W9OA 3PV5A 1KWAA 3RLEA 1ZOKA 3R69A 5HEYA 1X6DA 4E3BA 4R2ZA 1IHJA 2QKVA 2R3YA 3R0HA 5EZ0A 5G1EA 2PNTA 3ID2A 2DKRA 4JORA 5F3XA 1N99A 3VQGA 1UEQA 2M0UA 3ID1A 4OEPA 5HFEA 4HOPA 3PV4A 2I4SA 1QLCA 3R68A 3GGEA 2EEHA 3RL7A 3KHFA 4EDJA 3ID3A 3GCOA 3O5NA 1Z86A 4NNMA 4NNLA 1NTEA 2OSGA 3DIWA 5HJ1A 3I18A 2KPLA 2EXGA 2JILA 3HPKA 1OBYA 1WH1A 5DTHA 2LUIA 4JOGA 4P2AB 2JIKA 1SOTA 2V90A 2DLUA 2VZ5A 4KFVA 1X5RA 3TSWA 2IWOA 1TQ3A 2VRFA 1G9OA 5HFDA 3KZEA 1KY9A 2KBSA 2M0TA 2KJKA 1V5LA 3OTPA 1SOZA 2X7ZA 2AWWA 2JWEA 3SUZA 5FHTA 1P1DA 3WKLA 1UFXA 1WHDA 1T2MA 4YYXA 3CYYA 3MH6A 4JL7A 3ZRTA 2M3MA 5HFBA 2L97A 3QE1A 1KEFA 4UU5A 1V1TA 1L6OA 2BYGA 4GVCA 1Y8TA 1M5ZA 2IWQA 3SHUA 1WF8A 1X45A 2JREA 5HETA 4WYTA 1MFGA 2DB5A 3QJNA 2Z9IA 1WIFA 2KA9A 2RRMA 1I92A 3OU0A 4OEOA 2Q9VA 5HFFA 3VQFA 1WHAA 5D13A 2LC7A 2FCFA 4NXQA 3TSZA 1UF1A 5E1YA 2JOAA 1FC7A 1VAEA 2VWRA 5FB8C 4Q2QA 3L4FD 1UITA 2P3WA 3PDVA 4P0CA 3HPMA 2QG1A 5F67A 4FGMA 4HOPB 2YT7A 3NFLA 2MX6A 1RGWA 2DJTA 3QGLA 5HFCA 5E21A 1UHPA 3CC0A 5E11A 2AINA 3DJ3A 4IC6A 3LNYA 3FY5A 3AXAA 4F8KA 1UM1A 1WI4A 5GLJA 3K1RA 3QJMA 2ZPMA 2KOHA 2YUBA 3NFKA 2H3MA 2CSSA 2OMJA 1FC9A 4NMVA 4JOKA 2Z17A 2PA1A 2QKUA 1XZ9A 2LOBA 3TSVA 1VJ6A 5HEDA 4Z8JA 2H2BA 1BFEA 4GVDA 3SOEA 1N7FA 1WFGA 2FE5A 2OZFA 1V62A 4NMSA 4Z33A 1K32A 2EGOA 4K72A 1YBOA 1VCWA 2YT8A 5E22A 1TP3A 3TMHA 5I7ZA 3K50A 4NMOA 3QO6A 4Q2OA 4JOPA 2DAZA 2L4TA 3PS4A 1IU2A 1WJLA 1Z87A 2IWNA 4WYUA 2M0VA 2QT5A 3K82A 4UU6A 1UEWA 1LCYA 3QDOA 3PDZA 2D8IA 1GM1A 1U39A 1N6FA 1UJVA 1UJUA 3LNXA 3SFJA 2FN5A 4E35A 1UEZA 2EEGA 4Q2NA 3E17A 4H11A 1WI2A 1TE0A 2F5YA 4Q6HA 2EV8A 2H3LA 4REYA 4KFWA 1X8SA 2G2LA 2IWPA 3QIKA 1QAUA 1UJDA 2OQSA 2EDPA 2VSVA 2EHRA 3WKMA 2KV8A 4K78A 2K20A 5H3JA 1X5QA 4JOEA 4YDPA 1FCFA 2M10A 1Q7XA 3CBYA 2LA8A 3O46A 3CBZA 4O06A 5JXBA 1X5NA 3GSLA 3GDVA 4MPAA 1P1EA 3NGHA 1V5QA 5G1DA 1Y7NA 2D92A 4JOFA 2DLSA 1N7EA 1RGRA 1U3BA 2JINA 4RI0A 2GZVA 4K6YA 2F0AA 1IU0A 4NMPA 2DMZA 2G5MB 2EDZA 3STJA 4XHVA 3I1EA 1RY4A 2KL1A 3GJ9A 2REYA 2CS5A 4AMHA 2EEIA 2D90A 1QAVA 1R6JA 2CSJA 2I0LA 2OCSA 3DJ1A 3EGHC 1UEPA 2PDZA 2KPKA 4Q2PA 3I4WA 2L4SA 4NMRA 2V1WA 1UM7A 2M0ZA 2KOMA 2O2TA 2YUYA 3CS0A 4NXRA 2KAWA 1NF3C 1U37A 2ENOA 4K75A 2Q3GA 2DC2A 3B76A 3GCNA 4K76A 3PV2A 2MHOA 2KOJA 2KG2A 2KJPA 3SHWA 1FC6A 1D5GA 3CH8A 2JXOA 3DORA 1N7TA 5EYZA 5B6LA 3GDUA 3CBXA 2HGAA 4Q6SA 2PKTA 3GDSA 1V6BA 4L8NA 2KQFA
chains in the Genus database with same CATH superfamily
1Q3OA 4OAJA 2EAQA 2I0IA 3MH7A 2EGNA 1OBZA 2FNEA 2YTWA 2K1ZA 1VB7A 4NMQA 4NXPA 2UZCA 2AWXA 2AWUA 4Q3HA 1PDRA 1TP5A 4NMTA 4JOHA 2KRGA 4E34A 4JOJA 2RCZA 4LMMA 1GQ4A 2PZDA 3ID4A 1MFLA 2GEFA 1B8QA 2QKTA 2HE4A 3RL8A 1OBXA 2WL7A 1N6DA 3EGGC 3MH4A 1W9QA 5HF1A 1N6EA 1VA8A 4GHNA 5HDYA 2I04A 5GNDA 4PQWA 3HVQC 1WFVA 2KYLA 5ILBA 4N6XA 2EDVA 2VPHA 1U38A 3JXTA 2W4FA 1RZXA 2OS6A 5A2PA 2I6VA 1I16A 1QAVB 2ZPLA 3KZDA 2OGPA 2R4HA 2KJDA 2E7KA 2VSPA 5HF4A 1OZIA 1W9EA 2EJYA 2DM8A 1WF7A 3DJAA 5HEBA 5E6PB 1Q3PA 2EGKA 2LC6A 1ZUBA 2PKUA 2I1NA 2W7RA 1WG6A 2OPGA 1GQ5A 2QBWA 2H2CA 4G69A 1BE9A 1MC7A 2EEJA 3BPUA 2HE2A 1W9OA 3PV5A 1KWAA 3RLEA 1ZOKA 3R69A 5HEYA 1X6DA 4E3BA 4R2ZA 1IHJA 2QKVA 2R3YA 3R0HA 5EZ0A 5G1EA 2PNTA 3ID2A 2DKRA 4JORA 5F3XA 1N99A 3VQGA 1UEQA 2M0UA 3ID1A 4OEPA 5HFEA 4HOPA 3PV4A 2I4SA 1QLCA 3R68A 3GGEA 2EEHA 3RL7A 3KHFA 4EDJA 3ID3A 3GCOA 3O5NA 1Z86A 4NNMA 4NNLA 1NTEA 2OSGA 3DIWA 5HJ1A 3I18A 2KPLA 2EXGA 3KDKA 2JILA 3HPKA 1OBYA 1WH1A 5DTHA 2LUIA 4JOGA 4P2AB 2JIKA 1SOTA 2V90A 2DLUA 2VZ5A 4KFVA 1X5RA 3TSWA 2IWOA 1TQ3A 2VRFA 1G9OA 5HFDA 3KZEA 1KY9A 2KBSA 2M0TA 2KJKA 1V5LA 3OTPA 1SOZA 2X7ZA 2AWWA 2JWEA 3SUZA 5FHTA 1P1DA 3WKLA 1UFXA 1WHDA 1T2MA 4YYXA 3CYYA 3MH6A 4JL7A 3ZRTA 2M3MA 3NCVA 5HFBA 2L97A 3QE1A 1KEFA 4UU5A 1V1TA 1L6OA 2BYGA 4GVCA 1Y8TA 1M5ZA 2IWQA 3SHUA 1WF8A 1X45A 2JREA 5HETA 4WYTA 1MFGA 2DB5A 3QJNA 2Z9IA 1WIFA 2KA9A 2RRMA 1I92A 3OU0A 4OEOA 2Q9VA 5HFFA 3VQFA 1WHAA 5D13A 2LC7A 2FCFA 4NXQA 3TSZA 1UF1A 5E1YA 2JOAA 1FC7A 1VAEA 2VWRA 5FB8C 4JJ3A 4Q2QA 3L4FD 5IL9A 1UITA 2P3WA 3PDVA 4P0CA 3HPMA 2QG1A 5F67A 4FGMA 4HOPB 2YT7A 3NFLA 2MX6A 1RGWA 5B42A 2DJTA 3QGLA 5HFCA 5E21A 1UHPA 3CC0A 5E11A 2AINA 3DJ3A 4IC6A 3LNYA 3FY5A 3AXAA 4F8KA 1UM1A 1WI4A 5GLJA 3K1RA 3QJMA 2ZPMA 2KOHA 3GABA 2YUBA 3NFKA 2H3MA 2CSSA 2OMJA 1FC9A 4NMVA 4JOKA 2Z17A 2PA1A 2QKUA 1XZ9A 2LOBA 3TSVA 1VJ6A 5HEDA 4Z8JA 2H2BA 1BFEA 4GVDA 3SOEA 1N7FA 1WFGA 2FE5A 2OZFA 1V62A 4NMSA 4Z33A 1K32A 2EGOA 4K72A 1YBOA 1VCWA 2YT8A 5E22A 1TP3A 3TMHA 5I7ZA 3K50A 4NMOA 3QO6A 4Q2OA 4JOPA 2DAZA 2L4TA 3KDGA 3PS4A 1IU2A 1WJLA 1Z87A 2IWNA 4WYUA 2M0VA 2QT5A 3K82A 4UU6A 1UEWA 1LCYA 3QDOA 3PDZA 2D8IA 1GM1A 1U39A 1N6FA 1UJVA 1UJUA 3LNXA 3SFJA 2FN5A 4E35A 1UEZA 2EEGA 4Q2NA 3E17A 4H11A 1WI2A 1TE0A 2F5YA 4Q6HA 2EV8A 2H3LA 4REYA 4KFWA 1X8SA 2G2LA 2IWPA 3QIKA 1QAUA 1UJDA 2OQSA 2EDPA 2VSVA 2EHRA 3WKMA 2KV8A 4K78A 2K20A 4FLNA 5H3JA 1X5QA 4JOEA 4YDPA 1FCFA 2M10A 1Q7XA 3CBYA 2LA8A 3O46A 3CBZA 4O06A 5JXBA 1X5NA 3GSLA 3GDVA 4MPAA 1P1EA 3NGHA 1V5QA 5G1DA 1Y7NA 2D92A 4JOFA 1X9ZA 2DLSA 1N7EA 1RGRA 1U3BA 2JINA 4RI0A 2GZVA 4K6YA 2F0AA 1IU0A 4NMPA 2DMZA 2G5MB 2EDZA 3STJA 4XHVA 3I1EA 1RY4A 2KL1A 3GJ9A 2REYA 2CS5A 4AMHA 2JSNA 2EEIA 2D90A 1QAVA 1R6JA 2CSJA 2I0LA 2OCSA 4JJ0A 3DJ1A 3EGHC 1UEPA 2PDZA 2KPKA 4Q2PA 3I4WA 2L4SA 4NMRA 2V1WA 1UM7A 2M0ZA 2KOMA 2O2TA 2YUYA 3CS0A 4NXRA 2KAWA 1NF3C 1U37A 2ENOA 4K75A 2Q3GA 2DC2A 3B76A 3GCNA 4K76A 3PV2A 2MHOA 2KOJA 2KG2A 2KJPA 3SHWA 1FC6A 1D5GA 3CH8A 2JXOA 3DORA 1N7TA 5EYZA 5B6LA 3GDUA 3CBXA 2HGAA 4Q6SA 2PKTA 3GDSA 1V6BA 4L8NA 2KQFA
chains in the Genus database with same CATH topology
1Q3OA 4OAJA 2EAQA 2I0IA 3MH7A 2EGNA 1OBZA 2FNEA 2YTWA 2K1ZA 1VB7A 4NMQA 4NXPA 2UZCA 2AWXA 2AWUA 4Q3HA 1PDRA 1TP5A 4NMTA 4JOHA 2KRGA 4E34A 4JOJA 2RCZA 4LMMA 1GQ4A 2PZDA 3ID4A 1MFLA 2GEFA 1B8QA 2QKTA 2HE4A 3RL8A 1OBXA 2WL7A 1N6DA 3EGGC 3MH4A 1W9QA 5HF1A 1N6EA 1VA8A 4GHNA 5HDYA 2I04A 5GNDA 4PQWA 3HVQC 1WFVA 2KYLA 5ILBA 4N6XA 2EDVA 2VPHA 1U38A 3JXTA 2W4FA 1RZXA 2OS6A 5A2PA 2I6VA 1I16A 1QAVB 2ZPLA 3KZDA 2OGPA 2R4HA 2KJDA 2E7KA 2VSPA 5HF4A 1OZIA 1W9EA 2EJYA 2DM8A 1WF7A 3DJAA 5HEBA 5E6PB 1Q3PA 2EGKA 2LC6A 1ZUBA 2PKUA 2I1NA 2W7RA 1WG6A 2OPGA 1GQ5A 2QBWA 2H2CA 4G69A 1BE9A 1MC7A 2EEJA 3BPUA 2HE2A 1W9OA 3PV5A 1KWAA 3RLEA 1ZOKA 3R69A 5HEYA 1X6DA 4E3BA 4R2ZA 1IHJA 2QKVA 2R3YA 3R0HA 5EZ0A 5G1EA 2PNTA 3ID2A 2DKRA 4JORA 5F3XA 1N99A 3VQGA 1UEQA 2M0UA 3ID1A 4OEPA 5HFEA 4HOPA 3PV4A 2I4SA 1QLCA 3R68A 3GGEA 2EEHA 3RL7A 3KHFA 4EDJA 3ID3A 3GCOA 3O5NA 1Z86A 4NNMA 4NNLA 1NTEA 2OSGA 3DIWA 5HJ1A 3I18A 2KPLA 2EXGA 3KDKA 2JILA 3HPKA 1OBYA 1WH1A 5DTHA 2LUIA 4JOGA 4P2AB 2JIKA 1SOTA 2V90A 2DLUA 2VZ5A 4KFVA 1X5RA 3TSWA 2IWOA 1TQ3A 2VRFA 1G9OA 5HFDA 3KZEA 1KY9A 2KBSA 2M0TA 2KJKA 1V5LA 3OTPA 1SOZA 2X7ZA 2AWWA 2JWEA 3SUZA 5FHTA 1P1DA 3WKLA 1UFXA 1WHDA 1T2MA 4YYXA 3CYYA 3MH6A 4JL7A 3ZRTA 2M3MA 3NCVA 5HFBA 2L97A 3QE1A 1KEFA 4UU5A 1V1TA 1L6OA 2BYGA 4GVCA 1Y8TA 1M5ZA 2IWQA 3SHUA 1WF8A 1X45A 2JREA 5HETA 4WYTA 1MFGA 2DB5A 3QJNA 2Z9IA 1WIFA 2KA9A 2RRMA 1I92A 3OU0A 4OEOA 2Q9VA 5HFFA 3VQFA 1WHAA 5D13A 2LC7A 2FCFA 4NXQA 3TSZA 1UF1A 5E1YA 2JOAA 1FC7A 1VAEA 2VWRA 5FB8C 4JJ3A 4Q2QA 3L4FD 5IL9A 1UITA 2P3WA 3PDVA 4P0CA 3HPMA 2QG1A 5F67A 4FGMA 4HOPB 2YT7A 3NFLA 2MX6A 1RGWA 5B42A 2DJTA 3QGLA 5HFCA 5E21A 1UHPA 3CC0A 5E11A 2AINA 3DJ3A 4IC6A 3LNYA 3FY5A 3AXAA 4F8KA 1UM1A 1WI4A 5GLJA 3K1RA 3QJMA 2ZPMA 2KOHA 3GABA 2YUBA 3NFKA 2H3MA 2CSSA 2OMJA 1FC9A 4NMVA 4JOKA 2Z17A 2PA1A 2QKUA 1XZ9A 2LOBA 3TSVA 1VJ6A 5HEDA 4Z8JA 2H2BA 1BFEA 4GVDA 3SOEA 1N7FA 1WFGA 2FE5A 2OZFA 1V62A 4NMSA 4Z33A 1K32A 2EGOA 4K72A 1YBOA 1VCWA 2YT8A 5E22A 1TP3A 3TMHA 5I7ZA 3K50A 4NMOA 3QO6A 4Q2OA 4JOPA 2DAZA 2L4TA 3KDGA 3PS4A 1IU2A 1WJLA 1Z87A 2IWNA 4WYUA 2M0VA 2QT5A 3K82A 4UU6A 1UEWA 1LCYA 3QDOA 3PDZA 2D8IA 1GM1A 1U39A 1N6FA 1UJVA 1UJUA 3LNXA 3SFJA 2FN5A 4E35A 1UEZA 2EEGA 4Q2NA 3E17A 4H11A 1WI2A 1TE0A 2F5YA 4Q6HA 2EV8A 2H3LA 4REYA 4KFWA 1X8SA 2G2LA 2IWPA 3QIKA 1QAUA 1UJDA 2OQSA 2EDPA 2VSVA 2EHRA 3WKMA 2KV8A 4K78A 2K20A 4FLNA 5H3JA 1X5QA 4JOEA 4YDPA 1FCFA 2M10A 1Q7XA 3CBYA 2LA8A 3O46A 3CBZA 4O06A 5JXBA 1X5NA 3GSLA 3GDVA 4MPAA 1P1EA 3NGHA 1V5QA 5G1DA 1Y7NA 2D92A 4JOFA 1X9ZA 2DLSA 1N7EA 1RGRA 1U3BA 2JINA 4RI0A 2GZVA 4K6YA 2F0AA 1IU0A 4NMPA 2DMZA 2G5MB 2EDZA 3STJA 4XHVA 3I1EA 1RY4A 2KL1A 3GJ9A 2REYA 2CS5A 4AMHA 2JSNA 2EEIA 2D90A 1QAVA 1R6JA 2CSJA 2I0LA 2OCSA 4JJ0A 3DJ1A 3EGHC 1UEPA 2PDZA 2KPKA 4Q2PA 3I4WA 2L4SA 4NMRA 2V1WA 1UM7A 2M0ZA 2KOMA 2O2TA 2YUYA 3CS0A 4NXRA 2KAWA 1NF3C 1U37A 2ENOA 4K75A 2Q3GA 2DC2A 3B76A 3GCNA 4K76A 3PV2A 2MHOA 2KOJA 2KG2A 2KJPA 3SHWA 1FC6A 1D5GA 3CH8A 2JXOA 3DORA 1N7TA 5EYZA 5B6LA 3GDUA 3CBXA 2HGAA 4Q6SA 2PKTA 3GDSA 1V6BA 4L8NA 2KQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3O A;  4OAJ A;  2EAQ A;  2I0I A;  3MH7 A;  2EGN A;  1OBZ A;  2FNE A;  2YTW A;  2K1Z A;  1VB7 A;  4NMQ A;  4NXP A;  2UZC A;  2AWX A;  2AWU A;  4Q3H A;  1PDR A;  1TP5 A;  4NMT A;  4JOH A;  2KRG A;  4E34 A;  4JOJ A;  2RCZ A;  4LMM A;  1GQ4 A;  2PZD A;  3ID4 A;  1MFL A;  1B8Q A;  2QKT A;  2HE4 A;  3RL8 A;  1OBX A;  2WL7 A;  1N6D A;  3EGG C;  3MH4 A;  1W9Q A;  5HF1 A;  1N6E A;  1VA8 A;  4GHN A;  5HDY A;  2I04 A;  5GND A;  4PQW A;  3HVQ C;  1WFV A;  2KYL A;  4N6X A;  2EDV A;  2VPH A;  1U38 A;  3JXT A;  2W4F A;  1RZX A;  2OS6 A;  5A2P A;  2I6V A;  1I16 A;  1QAV B;  2ZPL A;  3KZD A;  2OGP A;  2R4H A;  2KJD A;  2E7K A;  2VSP A;  5HF4 A;  1OZI A;  1W9E A;  2EJY A;  2DM8 A;  1WF7 A;  3DJA A;  5HEB A;  5E6P B;  1Q3P A;  2EGK A;  2LC6 A;  1ZUB A;  2PKU A;  2I1N A;  2W7R A;  1WG6 A;  2OPG A;  1GQ5 A;  2QBW A;  2H2C A;  4G69 A;  1BE9 A;  1MC7 A;  2EEJ A;  3BPU A;  2HE2 A;  1W9O A;  3PV5 A;  1KWA A;  3RLE A;  1ZOK A;  3R69 A;  5HEY A;  1X6D A;  4E3B A;  4R2Z A;  1IHJ A;  2QKV A;  2R3Y A;  3R0H A;  5EZ0 A;  5G1E A;  2PNT A;  3ID2 A;  2DKR A;  4JOR A;  5F3X A;  1N99 A;  3VQG A;  1UEQ A;  2M0U A;  3ID1 A;  4OEP A;  5HFE A;  4HOP A;  3PV4 A;  2I4S A;  1QLC A;  3R68 A;  3GGE A;  2EEH A;  3RL7 A;  3KHF A;  4EDJ A;  3ID3 A;  3GCO A;  3O5N A;  1Z86 A;  4NNM A;  4NNL A;  1NTE A;  2OSG A;  3DIW A;  5HJ1 A;  3I18 A;  2KPL A;  2EXG A;  2JIL A;  3HPK A;  1OBY A;  1WH1 A;  5DTH A;  2LUI A;  4JOG A;  4P2A B;  2JIK A;  1SOT A;  2V90 A;  2DLU A;  2VZ5 A;  4KFV A;  1X5R A;  3TSW A;  2IWO A;  1TQ3 A;  2VRF A;  1G9O A;  5HFD A;  3KZE A;  1KY9 A;  2KBS A;  2M0T A;  2KJK A;  1V5L A;  3OTP A;  1SOZ A;  2X7Z A;  2AWW A;  2JWE A;  3SUZ A;  5FHT A;  1P1D A;  3WKL A;  1UFX A;  1WHD A;  1T2M A;  4YYX A;  3CYY A;  3MH6 A;  4JL7 A;  3ZRT A;  2M3M A;  5HFB A;  2L97 A;  3QE1 A;  1KEF A;  4UU5 A;  1V1T A;  1L6O A;  2BYG A;  4GVC A;  1Y8T A;  1M5Z A;  2IWQ A;  3SHU A;  1WF8 A;  1X45 A;  2JRE A;  5HET A;  4WYT A;  1MFG A;  2DB5 A;  3QJN A;  2Z9I A;  1WIF A;  2KA9 A;  2RRM A;  1I92 A;  3OU0 A;  4OEO A;  2Q9V A;  5HFF A;  3VQF A;  1WHA A;  5D13 A;  2LC7 A;  2FCF A;  4NXQ A;  3TSZ A;  1UF1 A;  5E1Y A;  2JOA A;  1FC7 A;  1VAE A;  2VWR A;  5FB8 C;  4Q2Q A;  3L4F D;  1UIT A;  2P3W A;  3PDV A;  4P0C A;  3HPM A;  2QG1 A;  5F67 A;  4FGM A;  4HOP B;  2YT7 A;  3NFL A;  2MX6 A;  1RGW A;  2DJT A;  3QGL A;  5HFC A;  5E21 A;  1UHP A;  3CC0 A;  5E11 A;  2AIN A;  3DJ3 A;  4IC6 A;  3LNY A;  3FY5 A;  3AXA A;  4F8K A;  1UM1 A;  1WI4 A;  5GLJ A;  3K1R A;  3QJM A;  2ZPM A;  2KOH A;  2YUB A;  3NFK A;  2H3M A;  2CSS A;  2OMJ A;  1FC9 A;  4NMV A;  4JOK A;  2Z17 A;  2PA1 A;  2QKU A;  1XZ9 A;  2LOB A;  3TSV A;  1VJ6 A;  5HED A;  4Z8J A;  2H2B A;  1BFE A;  4GVD A;  3SOE A;  1N7F A;  1WFG A;  2FE5 A;  2OZF A;  1V62 A;  4NMS A;  4Z33 A;  1K32 A;  2EGO A;  4K72 A;  1YBO A;  1VCW A;  2YT8 A;  5E22 A;  1TP3 A;  3TMH A;  5I7Z A;  3K50 A;  4NMO A;  3QO6 A;  4Q2O A;  4JOP A;  2DAZ A;  2L4T A;  3PS4 A;  1IU2 A;  1WJL A;  1Z87 A;  2IWN A;  4WYU A;  2M0V A;  2QT5 A;  3K82 A;  4UU6 A;  1UEW A;  1LCY A;  3QDO A;  3PDZ A;  2D8I A;  1GM1 A;  1U39 A;  1N6F A;  1UJV A;  1UJU A;  3LNX A;  3SFJ A;  2FN5 A;  4E35 A;  1UEZ A;  2EEG A;  4Q2N A;  3E17 A;  4H11 A;  1WI2 A;  1TE0 A;  2F5Y A;  4Q6H A;  2EV8 A;  2H3L A;  4REY A;  4KFW A;  1X8S A;  2G2L A;  2IWP A;  3QIK A;  1QAU A;  1UJD A;  2OQS A;  2EDP A;  2VSV A;  2EHR A;  3WKM A;  2KV8 A;  4K78 A;  2K20 A;  5H3J A;  1X5Q A;  4JOE A;  4YDP A;  1FCF A;  2M10 A;  1Q7X A;  3CBY A;  2LA8 A;  3O46 A;  3CBZ A;  4O06 A;  5JXB A;  1X5N A;  3GSL A;  3GDV A;  4MPA A;  1P1E A;  3NGH A;  1V5Q A;  5G1D A;  1Y7N A;  2D92 A;  4JOF A;  2DLS A;  1N7E A;  1RGR A;  1U3B A;  2JIN A;  4RI0 A;  2GZV A;  4K6Y A;  2F0A A;  1IU0 A;  4NMP A;  2DMZ A;  2G5M B;  2EDZ A;  3STJ A;  4XHV A;  3I1E A;  1RY4 A;  2KL1 A;  3GJ9 A;  2REY A;  2CS5 A;  4AMH A;  2EEI A;  2D90 A;  1QAV A;  1R6J A;  2CSJ A;  2I0L A;  2OCS A;  3DJ1 A;  3EGH C;  1UEP A;  2PDZ A;  2KPK A;  4Q2P A;  3I4W A;  2L4S A;  4NMR A;  2V1W A;  1UM7 A;  2M0Z A;  2KOM A;  2O2T A;  2YUY A;  3CS0 A;  4NXR A;  2KAW A;  1NF3 C;  1U37 A;  2ENO A;  4K75 A;  2Q3G A;  2DC2 A;  3B76 A;  3GCN A;  4K76 A;  3PV2 A;  2MHO A;  2KOJ A;  2KG2 A;  2KJP A;  3SHW A;  1FC6 A;  1D5G A;  3CH8 A;  2JXO A;  3DOR A;  1N7T A;  5EYZ A;  5B6L A;  3GDU A;  3CBX A;  2HGA A;  4Q6S A;  2PKT A;  3GDS A;  1V6B A;  4L8N A;  2KQF A; 
#chains in the Genus database with same CATH topology
 1Q3O A;  4OAJ A;  2EAQ A;  2I0I A;  3MH7 A;  2EGN A;  1OBZ A;  2FNE A;  2YTW A;  2K1Z A;  1VB7 A;  4NMQ A;  4NXP A;  2UZC A;  2AWX A;  2AWU A;  4Q3H A;  1PDR A;  1TP5 A;  4NMT A;  4JOH A;  2KRG A;  4E34 A;  4JOJ A;  2RCZ A;  4LMM A;  1GQ4 A;  2PZD A;  3ID4 A;  1MFL A;  2GEF A;  1B8Q A;  2QKT A;  2HE4 A;  3RL8 A;  1OBX A;  2WL7 A;  1N6D A;  3EGG C;  3MH4 A;  1W9Q A;  5HF1 A;  1N6E A;  1VA8 A;  4GHN A;  5HDY A;  2I04 A;  5GND A;  4PQW A;  3HVQ C;  1WFV A;  2KYL A;  5ILB A;  4N6X A;  2EDV A;  2VPH A;  1U38 A;  3JXT A;  2W4F A;  1RZX A;  2OS6 A;  5A2P A;  2I6V A;  1I16 A;  1QAV B;  2ZPL A;  3KZD A;  2OGP A;  2R4H A;  2KJD A;  2E7K A;  2VSP A;  5HF4 A;  1OZI A;  1W9E A;  2EJY A;  2DM8 A;  1WF7 A;  3DJA A;  5HEB A;  5E6P B;  1Q3P A;  2EGK A;  2LC6 A;  1ZUB A;  2PKU A;  2I1N A;  2W7R A;  1WG6 A;  2OPG A;  1GQ5 A;  2QBW A;  2H2C A;  4G69 A;  1BE9 A;  1MC7 A;  2EEJ A;  3BPU A;  2HE2 A;  1W9O A;  3PV5 A;  1KWA A;  3RLE A;  1ZOK A;  3R69 A;  5HEY A;  1X6D A;  4E3B A;  4R2Z A;  1IHJ A;  2QKV A;  2R3Y A;  3R0H A;  5EZ0 A;  5G1E A;  2PNT A;  3ID2 A;  2DKR A;  4JOR A;  5F3X A;  1N99 A;  3VQG A;  1UEQ A;  2M0U A;  3ID1 A;  4OEP A;  5HFE A;  4HOP A;  3PV4 A;  2I4S A;  1QLC A;  3R68 A;  3GGE A;  2EEH A;  3RL7 A;  3KHF A;  4EDJ A;  3ID3 A;  3GCO A;  3O5N A;  1Z86 A;  4NNM A;  4NNL A;  1NTE A;  2OSG A;  3DIW A;  5HJ1 A;  3I18 A;  2KPL A;  2EXG A;  3KDK A;  2JIL A;  3HPK A;  1OBY A;  1WH1 A;  5DTH A;  2LUI A;  4JOG A;  4P2A B;  2JIK A;  1SOT A;  2V90 A;  2DLU A;  2VZ5 A;  4KFV A;  1X5R A;  3TSW A;  2IWO A;  1TQ3 A;  2VRF A;  1G9O A;  5HFD A;  3KZE A;  1KY9 A;  2KBS A;  2M0T A;  2KJK A;  1V5L A;  3OTP A;  1SOZ A;  2X7Z A;  2AWW A;  2JWE A;  3SUZ A;  5FHT A;  1P1D A;  3WKL A;  1UFX A;  1WHD A;  1T2M A;  4YYX A;  3CYY A;  3MH6 A;  4JL7 A;  3ZRT A;  2M3M A;  3NCV A;  5HFB A;  2L97 A;  3QE1 A;  1KEF A;  4UU5 A;  1V1T A;  1L6O A;  2BYG A;  4GVC A;  1Y8T A;  1M5Z A;  2IWQ A;  3SHU A;  1WF8 A;  1X45 A;  2JRE A;  5HET A;  4WYT A;  1MFG A;  2DB5 A;  3QJN A;  2Z9I A;  1WIF A;  2KA9 A;  2RRM A;  1I92 A;  3OU0 A;  4OEO A;  2Q9V A;  5HFF A;  3VQF A;  1WHA A;  5D13 A;  2LC7 A;  2FCF A;  4NXQ A;  3TSZ A;  1UF1 A;  5E1Y A;  2JOA A;  1FC7 A;  1VAE A;  2VWR A;  5FB8 C;  4JJ3 A;  4Q2Q A;  3L4F D;  5IL9 A;  1UIT A;  2P3W A;  3PDV A;  4P0C A;  3HPM A;  2QG1 A;  5F67 A;  4FGM A;  4HOP B;  2YT7 A;  3NFL A;  2MX6 A;  1RGW A;  5B42 A;  2DJT A;  3QGL A;  5HFC A;  5E21 A;  1UHP A;  3CC0 A;  5E11 A;  2AIN A;  3DJ3 A;  4IC6 A;  3LNY A;  3FY5 A;  3AXA A;  4F8K A;  1UM1 A;  1WI4 A;  5GLJ A;  3K1R A;  3QJM A;  2ZPM A;  2KOH A;  3GAB A;  2YUB A;  3NFK A;  2H3M A;  2CSS A;  2OMJ A;  1FC9 A;  4NMV A;  4JOK A;  2Z17 A;  2PA1 A;  2QKU A;  1XZ9 A;  2LOB A;  3TSV A;  1VJ6 A;  5HED A;  4Z8J A;  2H2B A;  1BFE A;  4GVD A;  3SOE A;  1N7F A;  1WFG A;  2FE5 A;  2OZF A;  1V62 A;  4NMS A;  4Z33 A;  1K32 A;  2EGO A;  4K72 A;  1YBO A;  1VCW A;  2YT8 A;  5E22 A;  1TP3 A;  3TMH A;  5I7Z A;  3K50 A;  4NMO A;  3QO6 A;  4Q2O A;  4JOP A;  2DAZ A;  2L4T A;  3KDG A;  3PS4 A;  1IU2 A;  1WJL A;  1Z87 A;  2IWN A;  4WYU A;  2M0V A;  2QT5 A;  3K82 A;  4UU6 A;  1UEW A;  1LCY A;  3QDO A;  3PDZ A;  2D8I A;  1GM1 A;  1U39 A;  1N6F A;  1UJV A;  1UJU A;  3LNX A;  3SFJ A;  2FN5 A;  4E35 A;  1UEZ A;  2EEG A;  4Q2N A;  3E17 A;  4H11 A;  1WI2 A;  1TE0 A;  2F5Y A;  4Q6H A;  2EV8 A;  2H3L A;  4REY A;  4KFW A;  1X8S A;  2G2L A;  2IWP A;  3QIK A;  1QAU A;  1UJD A;  2OQS A;  2EDP A;  2VSV A;  2EHR A;  3WKM A;  2KV8 A;  4K78 A;  2K20 A;  4FLN A;  5H3J A;  1X5Q A;  4JOE A;  4YDP A;  1FCF A;  2M10 A;  1Q7X A;  3CBY A;  2LA8 A;  3O46 A;  3CBZ A;  4O06 A;  5JXB A;  1X5N A;  3GSL A;  3GDV A;  4MPA A;  1P1E A;  3NGH A;  1V5Q A;  5G1D A;  1Y7N A;  2D92 A;  4JOF A;  1X9Z A;  2DLS A;  1N7E A;  1RGR A;  1U3B A;  2JIN A;  4RI0 A;  2GZV A;  4K6Y A;  2F0A A;  1IU0 A;  4NMP A;  2DMZ A;  2G5M B;  2EDZ A;  3STJ A;  4XHV A;  3I1E A;  1RY4 A;  2KL1 A;  3GJ9 A;  2REY A;  2CS5 A;  4AMH A;  2JSN A;  2EEI A;  2D90 A;  1QAV A;  1R6J A;  2CSJ A;  2I0L A;  2OCS A;  4JJ0 A;  3DJ1 A;  3EGH C;  1UEP A;  2PDZ A;  2KPK A;  4Q2P A;  3I4W A;  2L4S A;  4NMR A;  2V1W A;  1UM7 A;  2M0Z A;  2KOM A;  2O2T A;  2YUY A;  3CS0 A;  4NXR A;  2KAW A;  1NF3 C;  1U37 A;  2ENO A;  4K75 A;  2Q3G A;  2DC2 A;  3B76 A;  3GCN A;  4K76 A;  3PV2 A;  2MHO A;  2KOJ A;  2KG2 A;  2KJP A;  3SHW A;  1FC6 A;  1D5G A;  3CH8 A;  2JXO A;  3DOR A;  1N7T A;  5EYZ A;  5B6L A;  3GDU A;  3CBX A;  2HGA A;  4Q6S A;  2PKT A;  3GDS A;  1V6B A;  4L8N A;  2KQF A; 
#chains in the Genus database with same CATH homology
 1Q3O A;  4OAJ A;  2EAQ A;  2I0I A;  3MH7 A;  2EGN A;  1OBZ A;  2FNE A;  2YTW A;  2K1Z A;  1VB7 A;  4NMQ A;  4NXP A;  2UZC A;  2AWX A;  2AWU A;  4Q3H A;  1PDR A;  1TP5 A;  4NMT A;  4JOH A;  2KRG A;  4E34 A;  4JOJ A;  2RCZ A;  4LMM A;  1GQ4 A;  2PZD A;  3ID4 A;  1MFL A;  2GEF A;  1B8Q A;  2QKT A;  2HE4 A;  3RL8 A;  1OBX A;  2WL7 A;  1N6D A;  3EGG C;  3MH4 A;  1W9Q A;  5HF1 A;  1N6E A;  1VA8 A;  4GHN A;  5HDY A;  2I04 A;  5GND A;  4PQW A;  3HVQ C;  1WFV A;  2KYL A;  5ILB A;  4N6X A;  2EDV A;  2VPH A;  1U38 A;  3JXT A;  2W4F A;  1RZX A;  2OS6 A;  5A2P A;  2I6V A;  1I16 A;  1QAV B;  2ZPL A;  3KZD A;  2OGP A;  2R4H A;  2KJD A;  2E7K A;  2VSP A;  5HF4 A;  1OZI A;  1W9E A;  2EJY A;  2DM8 A;  1WF7 A;  3DJA A;  5HEB A;  5E6P B;  1Q3P A;  2EGK A;  2LC6 A;  1ZUB A;  2PKU A;  2I1N A;  2W7R A;  1WG6 A;  2OPG A;  1GQ5 A;  2QBW A;  2H2C A;  4G69 A;  1BE9 A;  1MC7 A;  2EEJ A;  3BPU A;  2HE2 A;  1W9O A;  3PV5 A;  1KWA A;  3RLE A;  1ZOK A;  3R69 A;  5HEY A;  1X6D A;  4E3B A;  4R2Z A;  1IHJ A;  2QKV A;  2R3Y A;  3R0H A;  5EZ0 A;  5G1E A;  2PNT A;  3ID2 A;  2DKR A;  4JOR A;  5F3X A;  1N99 A;  3VQG A;  1UEQ A;  2M0U A;  3ID1 A;  4OEP A;  5HFE A;  4HOP A;  3PV4 A;  2I4S A;  1QLC A;  3R68 A;  3GGE A;  2EEH A;  3RL7 A;  3KHF A;  4EDJ A;  3ID3 A;  3GCO A;  3O5N A;  1Z86 A;  4NNM A;  4NNL A;  1NTE A;  2OSG A;  3DIW A;  5HJ1 A;  3I18 A;  2KPL A;  2EXG A;  3KDK A;  2JIL A;  3HPK A;  1OBY A;  1WH1 A;  5DTH A;  2LUI A;  4JOG A;  4P2A B;  2JIK A;  1SOT A;  2V90 A;  2DLU A;  2VZ5 A;  4KFV A;  1X5R A;  3TSW A;  2IWO A;  1TQ3 A;  2VRF A;  1G9O A;  5HFD A;  3KZE A;  1KY9 A;  2KBS A;  2M0T A;  2KJK A;  1V5L A;  3OTP A;  1SOZ A;  2X7Z A;  2AWW A;  2JWE A;  3SUZ A;  5FHT A;  1P1D A;  3WKL A;  1UFX A;  1WHD A;  1T2M A;  4YYX A;  3CYY A;  3MH6 A;  4JL7 A;  3ZRT A;  2M3M A;  3NCV A;  5HFB A;  2L97 A;  3QE1 A;  1KEF A;  4UU5 A;  1V1T A;  1L6O A;  2BYG A;  4GVC A;  1Y8T A;  1M5Z A;  2IWQ A;  3SHU A;  1WF8 A;  1X45 A;  2JRE A;  5HET A;  4WYT A;  1MFG A;  2DB5 A;  3QJN A;  2Z9I A;  1WIF A;  2KA9 A;  2RRM A;  1I92 A;  3OU0 A;  4OEO A;  2Q9V A;  5HFF A;  3VQF A;  1WHA A;  5D13 A;  2LC7 A;  2FCF A;  4NXQ A;  3TSZ A;  1UF1 A;  5E1Y A;  2JOA A;  1FC7 A;  1VAE A;  2VWR A;  5FB8 C;  4JJ3 A;  4Q2Q A;  3L4F D;  5IL9 A;  1UIT A;  2P3W A;  3PDV A;  4P0C A;  3HPM A;  2QG1 A;  5F67 A;  4FGM A;  4HOP B;  2YT7 A;  3NFL A;  2MX6 A;  1RGW A;  5B42 A;  2DJT A;  3QGL A;  5HFC A;  5E21 A;  1UHP A;  3CC0 A;  5E11 A;  2AIN A;  3DJ3 A;  4IC6 A;  3LNY A;  3FY5 A;  3AXA A;  4F8K A;  1UM1 A;  1WI4 A;  5GLJ A;  3K1R A;  3QJM A;  2ZPM A;  2KOH A;  3GAB A;  2YUB A;  3NFK A;  2H3M A;  2CSS A;  2OMJ A;  1FC9 A;  4NMV A;  4JOK A;  2Z17 A;  2PA1 A;  2QKU A;  1XZ9 A;  2LOB A;  3TSV A;  1VJ6 A;  5HED A;  4Z8J A;  2H2B A;  1BFE A;  4GVD A;  3SOE A;  1N7F A;  1WFG A;  2FE5 A;  2OZF A;  1V62 A;  4NMS A;  4Z33 A;  1K32 A;  2EGO A;  4K72 A;  1YBO A;  1VCW A;  2YT8 A;  5E22 A;  1TP3 A;  3TMH A;  5I7Z A;  3K50 A;  4NMO A;  3QO6 A;  4Q2O A;  4JOP A;  2DAZ A;  2L4T A;  3KDG A;  3PS4 A;  1IU2 A;  1WJL A;  1Z87 A;  2IWN A;  4WYU A;  2M0V A;  2QT5 A;  3K82 A;  4UU6 A;  1UEW A;  1LCY A;  3QDO A;  3PDZ A;  2D8I A;  1GM1 A;  1U39 A;  1N6F A;  1UJV A;  1UJU A;  3LNX A;  3SFJ A;  2FN5 A;  4E35 A;  1UEZ A;  2EEG A;  4Q2N A;  3E17 A;  4H11 A;  1WI2 A;  1TE0 A;  2F5Y A;  4Q6H A;  2EV8 A;  2H3L A;  4REY A;  4KFW A;  1X8S A;  2G2L A;  2IWP A;  3QIK A;  1QAU A;  1UJD A;  2OQS A;  2EDP A;  2VSV A;  2EHR A;  3WKM A;  2KV8 A;  4K78 A;  2K20 A;  4FLN A;  5H3J A;  1X5Q A;  4JOE A;  4YDP A;  1FCF A;  2M10 A;  1Q7X A;  3CBY A;  2LA8 A;  3O46 A;  3CBZ A;  4O06 A;  5JXB A;  1X5N A;  3GSL A;  3GDV A;  4MPA A;  1P1E A;  3NGH A;  1V5Q A;  5G1D A;  1Y7N A;  2D92 A;  4JOF A;  1X9Z A;  2DLS A;  1N7E A;  1RGR A;  1U3B A;  2JIN A;  4RI0 A;  2GZV A;  4K6Y A;  2F0A A;  1IU0 A;  4NMP A;  2DMZ A;  2G5M B;  2EDZ A;  3STJ A;  4XHV A;  3I1E A;  1RY4 A;  2KL1 A;  3GJ9 A;  2REY A;  2CS5 A;  4AMH A;  2JSN A;  2EEI A;  2D90 A;  1QAV A;  1R6J A;  2CSJ A;  2I0L A;  2OCS A;  4JJ0 A;  3DJ1 A;  3EGH C;  1UEP A;  2PDZ A;  2KPK A;  4Q2P A;  3I4W A;  2L4S A;  4NMR A;  2V1W A;  1UM7 A;  2M0Z A;  2KOM A;  2O2T A;  2YUY A;  3CS0 A;  4NXR A;  2KAW A;  1NF3 C;  1U37 A;  2ENO A;  4K75 A;  2Q3G A;  2DC2 A;  3B76 A;  3GCN A;  4K76 A;  3PV2 A;  2MHO A;  2KOJ A;  2KG2 A;  2KJP A;  3SHW A;  1FC6 A;  1D5G A;  3CH8 A;  2JXO A;  3DOR A;  1N7T A;  5EYZ A;  5B6L A;  3GDU A;  3CBX A;  2HGA A;  4Q6S A;  2PKT A;  3GDS A;  1V6B A;  4L8N A;  2KQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...