2W4FA

Crystal structure of the first pdz domain of human scrib1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
EELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERETSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN LAP4
publication title Crystal Structure of the First Pdz Domain of Human Scrib1
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2w4fA00
1W9EA 2OSGA 4UU5A 3QO6A 2AWWA 1TQ3A 3GCOA 2VWRA 3MH6A 2H3MA 2M10A 1RGWA 4NMRA 1IU0A 1KY9A 2I0IA 2CSJA 2YT8A 3WKLA 4Z33A 1V6BA 2M3MA 3K82A 3HPKA 1X6DA 3TMHA 2M0TA 1MFGA 5HFCA 1V5LA 4NMVA 1MFLA 1TP5A 1N6DA 2X7ZA 1RY4A 2JINA 1UFXA 5HF4A 2H3LA 3KHFA 3PV5A 1N6EA 2JREA 5H3JA 5HEBA 3TSZA 1N7TA 5GLJA 3RL7A 3E17A 1WFGA 4NMTA 1VB7A 1U38A 3QJMA 2KRGA 1WFVA 2WL7A 3NFLA 3R69A 2M0UA 1KWAA 4Q6HA 2JWEA 1K32A 2PDZA 1NF3C 4Q2NA 3MH4A 3QIKA 3DIWA 2QT5A 2H2BA 4JOPA 4NXPA 5D13A 2EDPA 1U37A 4OEOA 4JOJA 1FC7A 1UF1A 1Z86A 4E34A 3L4FD 1YBOA 1KEFA 4Q2OA 5DTHA 1QAVA 5HETA 1V5QA 5EZ0A 3LNYA 2G5MB 1TP3A 1VJ6A 2KYLA 4P0CA 3RL8A 3PV4A 1SOTA 1I16A 2K20A 5HEYA 2IWPA 4JOGA 1WHAA 3AXAA 2QG1A 3K50A 3QGLA 1FC9A 2K1ZA 1VCWA 2YUBA 3HVQC 4OEPA 3R0HA 2H2CA 3QJNA 4JOHA 4NXQA 2PNTA 1Q3PA 2I1NA 1IU2A 3TSWA 5HF1A 4GHNA 3STJA 2EDZA 2G2LA 2I6VA 3FY5A 2KJKA 2EGKA 1VA8A 4XHVA 3PDVA 1OBXA 3OTPA 2EXGA 4H11A 4FGMA 3SUZA 1QLCA 3PS4A 2R4HA 2FNEA 1G9OA 4E35A 3R68A 2UZCA 2IWQA 3CYYA 1WH1A 2D90A 1LCYA 3DORA 2VZ5A 4JOFA 1WIFA 2QKUA 1N6FA 1V62A 2LUIA 2L97A 5G1DA 4F8KA 2EEIA 2VSPA 4EDJA 2OGPA 5E1YA 2PZDA 1N99A 5JXBA 3ZRTA 1GQ5A 2W4FA 2ENOA 1OZIA 3I4WA 3CBXA 3SHWA 1FCFA 2D92A 2EHRA 5A2PA 1WF7A 2L4TA 4NMSA 2OQSA 3GJ9A 3MH7A 2QKTA 1Y8TA 2DAZA 2KV8A 4LMMA 5HJ1A 1W9QA 3EGHC 3TSVA 4RI0A 1FC6A 3CBYA 2I4SA 4HOPA 1OBZA 1QAUA 1T2MA 1WG6A 5FHTA 4O06A 2HE2A 1UEWA 2KPKA 1P1EA 4K78A 1UHPA 2BYGA 3GCNA 5E11A 3GDVA 5HDYA 2DMZA 2EAQA 2LC6A 2Q9VA 4GVDA 5HFDA 1X5NA 2JXOA 3GDUA 4GVCA 4L8NA 1U39A 4YDPA 2PA1A 3GSLA 1X5RA 3SOEA 1RZXA 2DB5A 4JL7A 3CS0A 1D5GA 2DLSA 3EGGC 1X8SA 3VQFA 4N6XA 4YYXA 1WF8A 1N7FA 2EJYA 2DKRA 2GZVA 2EGOA 4K72A 2Q3GA 2PKUA 5E6PB 4Z8JA 1PDRA 3CC0A 1ZOKA 3SFJA 4KFWA 4NNMA 2RRMA 5HEDA 3VQGA 1SOZA 3K1RA 1N7EA 2KPLA 2FCFA 2MX6A 2VSVA 3O5NA 1RGRA 4JOEA 4Q2QA 2KL1A 1GQ4A 2OPGA 1M5ZA 2M0VA 1GM1A 2FN5A 1L6OA 3KZDA 3CBZA 1UM1A 2AWXA 2DLUA 2AWUA 3DJ3A 2LA8A 2DJTA 2YT7A 2KOMA 2IWOA 2O2TA 1QAVB 3NFKA 2ZPLA 1Q3OA 2YTWA 2EV8A 2KOJA 3CH8A 2I0LA 2D8IA 2E7KA 3WKMA 4OAJA 3GGEA 3ID3A 3NGHA 2JOAA 3SHUA 2KQFA 4NMPA 3JXTA 2PKTA 1X5QA 2V90A 2R3YA 2REYA 2EEGA 1UEZA 2HGAA 1B8QA 2JILA 1WI4A 2KG2A 1BE9A 5E21A 4PQWA 2HE4A 1U3BA 2OS6A 1I92A 1XZ9A 2EGNA 1Z87A 1R6JA 2EEHA 2I04A 5FB8C 2DM8A 4NMQA 2DC2A 2M0ZA 4IC6A 2OMJA 5GNDA 1UJVA 3B76A 2KA9A 4NMOA 4KFVA 1WHDA 5F67A 5E22A 2OZFA 4UU6A 4WYUA 2MHOA 1IHJA 2KOHA 4WYTA 1P1DA 2ZPMA 4R2ZA 2EDVA 3I18A 1WJLA 1W9OA 5G1EA 2Z9IA 3ID2A 4G69A 2VPHA 3LNXA 3PDZA 4Q6SA 2P3WA 5EYZA 5HFBA 3KZEA 1OBYA 3ID4A 3QDOA 2F0AA 1Y7NA 4K76A 3BPUA 4AMHA 2Z17A 4HOPB 2VRFA 5F3XA 1MC7A 1TE0A 1UEPA 2CS5A 3DJ1A 4Q2PA 2EEJA 2YUYA 3OU0A 4Q3HA 2OCSA 4JOKA 2F5YA 4REYA 4K6YA 2RCZA 2L4SA 5HFEA 1X45A 2FE5A 1V1TA 5B6LA 1WI2A 3ID1A 2V1WA 2KJDA 4NNLA 4K75A 5I7ZA 1ZUBA 3O46A 3QE1A 2CSSA 3DJAA 1UJDA 1VAEA 3GDSA 2KBSA 3PV2A 4E3BA 2IWNA 1UM7A 4MPAA 2QKVA 1UITA 1UEQA 1UJUA 4P2AB 2KJPA 5HFFA 4NXRA 2LC7A 2QBWA 3I1EA 2AINA 2KAWA 2W7RA 3RLEA 2LOBA 1NTEA 3HPMA 4JORA 1BFEA 1Q7XA 2JIKA
chains in the Genus database with same CATH superfamily
1W9EA 2OSGA 4UU5A 3QO6A 2AWWA 1TQ3A 3GABA 3GCOA 2VWRA 3MH6A 2H3MA 2M10A 1RGWA 4JJ0A 4NMRA 1IU0A 1KY9A 2I0IA 2CSJA 2YT8A 3WKLA 4Z33A 1V6BA 2M3MA 3K82A 3HPKA 1X6DA 3TMHA 2M0TA 1MFGA 5HFCA 1V5LA 4NMVA 1MFLA 1TP5A 1N6DA 5ILBA 2X7ZA 1RY4A 2JINA 2JSNA 1UFXA 5HF4A 2H3LA 3KHFA 5IL9A 3PV5A 1N6EA 2JREA 5H3JA 5HEBA 3TSZA 1N7TA 5GLJA 3RL7A 3E17A 1WFGA 3KDKA 4NMTA 1VB7A 1U38A 3QJMA 2KRGA 1WFVA 2WL7A 3NFLA 3R69A 2M0UA 1KWAA 4Q6HA 2JWEA 1K32A 2PDZA 1NF3C 4Q2NA 3MH4A 3QIKA 3DIWA 2QT5A 2H2BA 4JOPA 4NXPA 5D13A 2EDPA 1U37A 4OEOA 4JOJA 1FC7A 1UF1A 1Z86A 4E34A 3L4FD 1YBOA 1KEFA 4Q2OA 5DTHA 1QAVA 5HETA 1V5QA 5EZ0A 5B42A 3LNYA 2G5MB 1TP3A 1VJ6A 2KYLA 4P0CA 3RL8A 3PV4A 1SOTA 1I16A 2K20A 5HEYA 2IWPA 4JOGA 1WHAA 3AXAA 2QG1A 3K50A 3QGLA 1FC9A 2K1ZA 1VCWA 2YUBA 3HVQC 4OEPA 3R0HA 2H2CA 3QJNA 4JOHA 4NXQA 2PNTA 1Q3PA 2I1NA 1IU2A 3TSWA 5HF1A 4GHNA 3STJA 2EDZA 2G2LA 2I6VA 3FY5A 2KJKA 2EGKA 1VA8A 4XHVA 3PDVA 1OBXA 3OTPA 2EXGA 4H11A 4FGMA 3SUZA 1QLCA 3PS4A 2R4HA 2FNEA 1G9OA 4E35A 3R68A 2UZCA 2IWQA 3CYYA 1WH1A 2D90A 1LCYA 3DORA 2VZ5A 4JOFA 1WIFA 2QKUA 1N6FA 1V62A 2LUIA 2L97A 5G1DA 4F8KA 2EEIA 2VSPA 4EDJA 2OGPA 5E1YA 2PZDA 1N99A 5JXBA 3ZRTA 1GQ5A 2W4FA 2ENOA 1OZIA 3I4WA 3CBXA 3SHWA 1FCFA 2D92A 2EHRA 5A2PA 1WF7A 2L4TA 4NMSA 2OQSA 3GJ9A 3MH7A 2QKTA 1Y8TA 3KDGA 2DAZA 2KV8A 4LMMA 5HJ1A 1W9QA 3EGHC 3TSVA 4RI0A 1FC6A 3CBYA 2I4SA 4HOPA 1OBZA 1QAUA 1T2MA 1WG6A 5FHTA 4O06A 2HE2A 1UEWA 2KPKA 1P1EA 4K78A 1UHPA 2BYGA 3GCNA 5E11A 3GDVA 5HDYA 2DMZA 2EAQA 2LC6A 2Q9VA 4GVDA 5HFDA 1X5NA 2JXOA 3NCVA 3GDUA 4GVCA 4L8NA 1U39A 4YDPA 2PA1A 3GSLA 1X5RA 3SOEA 1RZXA 2DB5A 4JL7A 3CS0A 1D5GA 2DLSA 3EGGC 1X8SA 3VQFA 4N6XA 4YYXA 1WF8A 1N7FA 2EJYA 2DKRA 2GZVA 2EGOA 4K72A 2Q3GA 2PKUA 5E6PB 4Z8JA 1PDRA 3CC0A 1ZOKA 3SFJA 4KFWA 4NNMA 2RRMA 5HEDA 3VQGA 1SOZA 3K1RA 1N7EA 2KPLA 2FCFA 2MX6A 2VSVA 3O5NA 1RGRA 4JOEA 4Q2QA 2KL1A 1GQ4A 2OPGA 1M5ZA 2M0VA 1GM1A 2FN5A 1L6OA 3KZDA 3CBZA 1UM1A 2AWXA 2DLUA 2AWUA 3DJ3A 2LA8A 2DJTA 2YT7A 2KOMA 2IWOA 2O2TA 1QAVB 3NFKA 2GEFA 2ZPLA 1Q3OA 2YTWA 2EV8A 2KOJA 3CH8A 1X9ZA 2I0LA 2D8IA 2E7KA 3WKMA 4OAJA 3GGEA 3ID3A 3NGHA 2JOAA 3SHUA 2KQFA 4NMPA 4FLNA 3JXTA 2PKTA 1X5QA 2V90A 2R3YA 2REYA 2EEGA 1UEZA 2HGAA 1B8QA 2JILA 1WI4A 2KG2A 1BE9A 5E21A 4PQWA 2HE4A 1U3BA 2OS6A 1I92A 1XZ9A 2EGNA 1Z87A 1R6JA 2EEHA 2I04A 5FB8C 2DM8A 4NMQA 2DC2A 2M0ZA 4IC6A 2OMJA 5GNDA 1UJVA 3B76A 2KA9A 4NMOA 4KFVA 1WHDA 5F67A 5E22A 2OZFA 4UU6A 4WYUA 2MHOA 1IHJA 2KOHA 4WYTA 1P1DA 2ZPMA 4R2ZA 4JJ3A 2EDVA 3I18A 1WJLA 1W9OA 5G1EA 2Z9IA 3ID2A 4G69A 2VPHA 3LNXA 3PDZA 4Q6SA 2P3WA 5EYZA 5HFBA 3KZEA 1OBYA 3ID4A 3QDOA 2F0AA 1Y7NA 4K76A 3BPUA 4AMHA 2Z17A 4HOPB 2VRFA 5F3XA 1MC7A 1TE0A 1UEPA 2CS5A 3DJ1A 4Q2PA 2EEJA 2YUYA 3OU0A 4Q3HA 2OCSA 4JOKA 2F5YA 4REYA 4K6YA 2RCZA 2L4SA 5HFEA 1X45A 2FE5A 1V1TA 5B6LA 1WI2A 3ID1A 2V1WA 2KJDA 4NNLA 4K75A 5I7ZA 1ZUBA 3O46A 3QE1A 2CSSA 3DJAA 1UJDA 1VAEA 3GDSA 2KBSA 3PV2A 4E3BA 2IWNA 1UM7A 4MPAA 2QKVA 1UITA 1UEQA 1UJUA 4P2AB 2KJPA 5HFFA 4NXRA 2LC7A 2QBWA 3I1EA 2AINA 2KAWA 2W7RA 3RLEA 2LOBA 1NTEA 3HPMA 4JORA 1BFEA 1Q7XA 2JIKA
chains in the Genus database with same CATH topology
1W9EA 2OSGA 4UU5A 3QO6A 2AWWA 1TQ3A 3GABA 3GCOA 2VWRA 3MH6A 2H3MA 2M10A 1RGWA 4JJ0A 4NMRA 1IU0A 1KY9A 2I0IA 2CSJA 2YT8A 3WKLA 4Z33A 1V6BA 2M3MA 3K82A 3HPKA 1X6DA 3TMHA 2M0TA 1MFGA 5HFCA 1V5LA 4NMVA 1MFLA 1TP5A 1N6DA 5ILBA 2X7ZA 1RY4A 2JINA 2JSNA 1UFXA 5HF4A 2H3LA 3KHFA 5IL9A 3PV5A 1N6EA 2JREA 5H3JA 5HEBA 3TSZA 1N7TA 5GLJA 3RL7A 3E17A 1WFGA 3KDKA 4NMTA 1VB7A 1U38A 3QJMA 2KRGA 1WFVA 2WL7A 3NFLA 3R69A 2M0UA 1KWAA 4Q6HA 2JWEA 1K32A 2PDZA 1NF3C 4Q2NA 3MH4A 3QIKA 3DIWA 2QT5A 2H2BA 4JOPA 4NXPA 5D13A 2EDPA 1U37A 4OEOA 4JOJA 1FC7A 1UF1A 1Z86A 4E34A 3L4FD 1YBOA 1KEFA 4Q2OA 5DTHA 1QAVA 5HETA 1V5QA 5EZ0A 5B42A 3LNYA 2G5MB 1TP3A 1VJ6A 2KYLA 4P0CA 3RL8A 3PV4A 1SOTA 1I16A 2K20A 5HEYA 2IWPA 4JOGA 1WHAA 3AXAA 2QG1A 3K50A 3QGLA 1FC9A 2K1ZA 1VCWA 2YUBA 3HVQC 4OEPA 3R0HA 2H2CA 3QJNA 4JOHA 4NXQA 2PNTA 1Q3PA 2I1NA 1IU2A 3TSWA 5HF1A 4GHNA 3STJA 2EDZA 2G2LA 2I6VA 3FY5A 2KJKA 2EGKA 1VA8A 4XHVA 3PDVA 1OBXA 3OTPA 2EXGA 4H11A 4FGMA 3SUZA 1QLCA 3PS4A 2R4HA 2FNEA 1G9OA 4E35A 3R68A 2UZCA 2IWQA 3CYYA 1WH1A 2D90A 1LCYA 3DORA 2VZ5A 4JOFA 1WIFA 2QKUA 1N6FA 1V62A 2LUIA 2L97A 5G1DA 4F8KA 2EEIA 2VSPA 4EDJA 2OGPA 5E1YA 2PZDA 1N99A 5JXBA 3ZRTA 1GQ5A 2W4FA 2ENOA 1OZIA 3I4WA 3CBXA 3SHWA 1FCFA 2D92A 2EHRA 5A2PA 1WF7A 2L4TA 4NMSA 2OQSA 3GJ9A 3MH7A 2QKTA 1Y8TA 3KDGA 2DAZA 2KV8A 4LMMA 5HJ1A 1W9QA 3EGHC 3TSVA 4RI0A 1FC6A 3CBYA 2I4SA 4HOPA 1OBZA 1QAUA 1T2MA 1WG6A 5FHTA 4O06A 2HE2A 1UEWA 2KPKA 1P1EA 4K78A 1UHPA 2BYGA 3GCNA 5E11A 3GDVA 5HDYA 2DMZA 2EAQA 2LC6A 2Q9VA 4GVDA 5HFDA 1X5NA 2JXOA 3NCVA 3GDUA 4GVCA 4L8NA 1U39A 4YDPA 2PA1A 3GSLA 1X5RA 3SOEA 1RZXA 2DB5A 4JL7A 3CS0A 1D5GA 2DLSA 3EGGC 1X8SA 3VQFA 4N6XA 4YYXA 1WF8A 1N7FA 2EJYA 2DKRA 2GZVA 2EGOA 4K72A 2Q3GA 2PKUA 5E6PB 4Z8JA 1PDRA 3CC0A 1ZOKA 3SFJA 4KFWA 4NNMA 2RRMA 5HEDA 3VQGA 1SOZA 3K1RA 1N7EA 2KPLA 2FCFA 2MX6A 2VSVA 3O5NA 1RGRA 4JOEA 4Q2QA 2KL1A 1GQ4A 2OPGA 1M5ZA 2M0VA 1GM1A 2FN5A 1L6OA 3KZDA 3CBZA 1UM1A 2AWXA 2DLUA 2AWUA 3DJ3A 2LA8A 2DJTA 2YT7A 2KOMA 2IWOA 2O2TA 1QAVB 3NFKA 2GEFA 2ZPLA 1Q3OA 2YTWA 2EV8A 2KOJA 3CH8A 1X9ZA 2I0LA 2D8IA 2E7KA 3WKMA 4OAJA 3GGEA 3ID3A 3NGHA 2JOAA 3SHUA 2KQFA 4NMPA 4FLNA 3JXTA 2PKTA 1X5QA 2V90A 2R3YA 2REYA 2EEGA 1UEZA 2HGAA 1B8QA 2JILA 1WI4A 2KG2A 1BE9A 5E21A 4PQWA 2HE4A 1U3BA 2OS6A 1I92A 1XZ9A 2EGNA 1Z87A 1R6JA 2EEHA 2I04A 5FB8C 2DM8A 4NMQA 2DC2A 2M0ZA 4IC6A 2OMJA 5GNDA 1UJVA 3B76A 2KA9A 4NMOA 4KFVA 1WHDA 5F67A 5E22A 2OZFA 4UU6A 4WYUA 2MHOA 1IHJA 2KOHA 4WYTA 1P1DA 2ZPMA 4R2ZA 4JJ3A 2EDVA 3I18A 1WJLA 1W9OA 5G1EA 2Z9IA 3ID2A 4G69A 2VPHA 3LNXA 3PDZA 4Q6SA 2P3WA 5EYZA 5HFBA 3KZEA 1OBYA 3ID4A 3QDOA 2F0AA 1Y7NA 4K76A 3BPUA 4AMHA 2Z17A 4HOPB 2VRFA 5F3XA 1MC7A 1TE0A 1UEPA 2CS5A 3DJ1A 4Q2PA 2EEJA 2YUYA 3OU0A 4Q3HA 2OCSA 4JOKA 2F5YA 4REYA 4K6YA 2RCZA 2L4SA 5HFEA 1X45A 2FE5A 1V1TA 5B6LA 1WI2A 3ID1A 2V1WA 2KJDA 4NNLA 4K75A 5I7ZA 1ZUBA 3O46A 3QE1A 2CSSA 3DJAA 1UJDA 1VAEA 3GDSA 2KBSA 3PV2A 4E3BA 2IWNA 1UM7A 4MPAA 2QKVA 1UITA 1UEQA 1UJUA 4P2AB 2KJPA 5HFFA 4NXRA 2LC7A 2QBWA 3I1EA 2AINA 2KAWA 2W7RA 3RLEA 2LOBA 1NTEA 3HPMA 4JORA 1BFEA 1Q7XA 2JIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9E A;  2OSG A;  4UU5 A;  3QO6 A;  2AWW A;  1TQ3 A;  3GCO A;  2VWR A;  3MH6 A;  2H3M A;  2M10 A;  1RGW A;  4NMR A;  1IU0 A;  1KY9 A;  2I0I A;  2CSJ A;  2YT8 A;  3WKL A;  4Z33 A;  1V6B A;  2M3M A;  3K82 A;  3HPK A;  1X6D A;  3TMH A;  2M0T A;  1MFG A;  5HFC A;  1V5L A;  4NMV A;  1MFL A;  1TP5 A;  1N6D A;  2X7Z A;  1RY4 A;  2JIN A;  1UFX A;  5HF4 A;  2H3L A;  3KHF A;  3PV5 A;  1N6E A;  2JRE A;  5H3J A;  5HEB A;  3TSZ A;  1N7T A;  5GLJ A;  3RL7 A;  3E17 A;  1WFG A;  4NMT A;  1VB7 A;  1U38 A;  3QJM A;  2KRG A;  1WFV A;  2WL7 A;  3NFL A;  3R69 A;  2M0U A;  1KWA A;  4Q6H A;  2JWE A;  1K32 A;  2PDZ A;  1NF3 C;  4Q2N A;  3MH4 A;  3QIK A;  3DIW A;  2QT5 A;  2H2B A;  4JOP A;  4NXP A;  5D13 A;  2EDP A;  1U37 A;  4OEO A;  4JOJ A;  1FC7 A;  1UF1 A;  1Z86 A;  4E34 A;  3L4F D;  1YBO A;  1KEF A;  4Q2O A;  5DTH A;  1QAV A;  5HET A;  1V5Q A;  5EZ0 A;  3LNY A;  2G5M B;  1TP3 A;  1VJ6 A;  2KYL A;  4P0C A;  3RL8 A;  3PV4 A;  1SOT A;  1I16 A;  2K20 A;  5HEY A;  2IWP A;  4JOG A;  1WHA A;  3AXA A;  2QG1 A;  3K50 A;  3QGL A;  1FC9 A;  2K1Z A;  1VCW A;  2YUB A;  3HVQ C;  4OEP A;  3R0H A;  2H2C A;  3QJN A;  4JOH A;  4NXQ A;  2PNT A;  1Q3P A;  2I1N A;  1IU2 A;  3TSW A;  5HF1 A;  4GHN A;  3STJ A;  2EDZ A;  2G2L A;  2I6V A;  3FY5 A;  2KJK A;  2EGK A;  1VA8 A;  4XHV A;  3PDV A;  1OBX A;  3OTP A;  2EXG A;  4H11 A;  4FGM A;  3SUZ A;  1QLC A;  3PS4 A;  2R4H A;  2FNE A;  1G9O A;  4E35 A;  3R68 A;  2UZC A;  2IWQ A;  3CYY A;  1WH1 A;  2D90 A;  1LCY A;  3DOR A;  2VZ5 A;  4JOF A;  1WIF A;  2QKU A;  1N6F A;  1V62 A;  2LUI A;  2L97 A;  5G1D A;  4F8K A;  2EEI A;  2VSP A;  4EDJ A;  2OGP A;  5E1Y A;  2PZD A;  1N99 A;  5JXB A;  3ZRT A;  1GQ5 A;  2W4F A;  2ENO A;  1OZI A;  3I4W A;  3CBX A;  3SHW A;  1FCF A;  2D92 A;  2EHR A;  5A2P A;  1WF7 A;  2L4T A;  4NMS A;  2OQS A;  3GJ9 A;  3MH7 A;  2QKT A;  1Y8T A;  2DAZ A;  2KV8 A;  4LMM A;  5HJ1 A;  1W9Q A;  3EGH C;  3TSV A;  4RI0 A;  1FC6 A;  3CBY A;  2I4S A;  4HOP A;  1OBZ A;  1QAU A;  1T2M A;  1WG6 A;  5FHT A;  4O06 A;  2HE2 A;  1UEW A;  2KPK A;  1P1E A;  4K78 A;  1UHP A;  2BYG A;  3GCN A;  5E11 A;  3GDV A;  5HDY A;  2DMZ A;  2EAQ A;  2LC6 A;  2Q9V A;  4GVD A;  5HFD A;  1X5N A;  2JXO A;  3GDU A;  4GVC A;  4L8N A;  1U39 A;  4YDP A;  2PA1 A;  3GSL A;  1X5R A;  3SOE A;  1RZX A;  2DB5 A;  4JL7 A;  3CS0 A;  1D5G A;  2DLS A;  3EGG C;  1X8S A;  3VQF A;  4N6X A;  4YYX A;  1WF8 A;  1N7F A;  2EJY A;  2DKR A;  2GZV A;  2EGO A;  4K72 A;  2Q3G A;  2PKU A;  5E6P B;  4Z8J A;  1PDR A;  3CC0 A;  1ZOK A;  3SFJ A;  4KFW A;  4NNM A;  2RRM A;  5HED A;  3VQG A;  1SOZ A;  3K1R A;  1N7E A;  2KPL A;  2FCF A;  2MX6 A;  2VSV A;  3O5N A;  1RGR A;  4JOE A;  4Q2Q A;  2KL1 A;  1GQ4 A;  2OPG A;  1M5Z A;  2M0V A;  1GM1 A;  2FN5 A;  1L6O A;  3KZD A;  3CBZ A;  1UM1 A;  2AWX A;  2DLU A;  2AWU A;  3DJ3 A;  2LA8 A;  2DJT A;  2YT7 A;  2KOM A;  2IWO A;  2O2T A;  1QAV B;  3NFK A;  2ZPL A;  1Q3O A;  2YTW A;  2EV8 A;  2KOJ A;  3CH8 A;  2I0L A;  2D8I A;  2E7K A;  3WKM A;  4OAJ A;  3GGE A;  3ID3 A;  3NGH A;  2JOA A;  3SHU A;  2KQF A;  4NMP A;  3JXT A;  2PKT A;  1X5Q A;  2V90 A;  2R3Y A;  2REY A;  2EEG A;  1UEZ A;  2HGA A;  1B8Q A;  2JIL A;  1WI4 A;  2KG2 A;  1BE9 A;  5E21 A;  4PQW A;  2HE4 A;  1U3B A;  2OS6 A;  1I92 A;  1XZ9 A;  2EGN A;  1Z87 A;  1R6J A;  2EEH A;  2I04 A;  5FB8 C;  2DM8 A;  4NMQ A;  2DC2 A;  2M0Z A;  4IC6 A;  2OMJ A;  5GND A;  1UJV A;  3B76 A;  2KA9 A;  4NMO A;  4KFV A;  1WHD A;  5F67 A;  5E22 A;  2OZF A;  4UU6 A;  4WYU A;  2MHO A;  1IHJ A;  2KOH A;  4WYT A;  1P1D A;  2ZPM A;  4R2Z A;  2EDV A;  3I18 A;  1WJL A;  1W9O A;  5G1E A;  2Z9I A;  3ID2 A;  4G69 A;  2VPH A;  3LNX A;  3PDZ A;  4Q6S A;  2P3W A;  5EYZ A;  5HFB A;  3KZE A;  1OBY A;  3ID4 A;  3QDO A;  2F0A A;  1Y7N A;  4K76 A;  3BPU A;  4AMH A;  2Z17 A;  4HOP B;  2VRF A;  5F3X A;  1MC7 A;  1TE0 A;  1UEP A;  2CS5 A;  3DJ1 A;  4Q2P A;  2EEJ A;  2YUY A;  3OU0 A;  4Q3H A;  2OCS A;  4JOK A;  2F5Y A;  4REY A;  4K6Y A;  2RCZ A;  2L4S A;  5HFE A;  1X45 A;  2FE5 A;  1V1T A;  5B6L A;  1WI2 A;  3ID1 A;  2V1W A;  2KJD A;  4NNL A;  4K75 A;  5I7Z A;  1ZUB A;  3O46 A;  3QE1 A;  2CSS A;  3DJA A;  1UJD A;  1VAE A;  3GDS A;  2KBS A;  3PV2 A;  4E3B A;  2IWN A;  1UM7 A;  4MPA A;  2QKV A;  1UIT A;  1UEQ A;  1UJU A;  4P2A B;  2KJP A;  5HFF A;  4NXR A;  2LC7 A;  2QBW A;  3I1E A;  2AIN A;  2KAW A;  2W7R A;  3RLE A;  2LOB A;  1NTE A;  3HPM A;  4JOR A;  1BFE A;  1Q7X A;  2JIK A; 
#chains in the Genus database with same CATH topology
 1W9E A;  2OSG A;  4UU5 A;  3QO6 A;  2AWW A;  1TQ3 A;  3GAB A;  3GCO A;  2VWR A;  3MH6 A;  2H3M A;  2M10 A;  1RGW A;  4JJ0 A;  4NMR A;  1IU0 A;  1KY9 A;  2I0I A;  2CSJ A;  2YT8 A;  3WKL A;  4Z33 A;  1V6B A;  2M3M A;  3K82 A;  3HPK A;  1X6D A;  3TMH A;  2M0T A;  1MFG A;  5HFC A;  1V5L A;  4NMV A;  1MFL A;  1TP5 A;  1N6D A;  5ILB A;  2X7Z A;  1RY4 A;  2JIN A;  2JSN A;  1UFX A;  5HF4 A;  2H3L A;  3KHF A;  5IL9 A;  3PV5 A;  1N6E A;  2JRE A;  5H3J A;  5HEB A;  3TSZ A;  1N7T A;  5GLJ A;  3RL7 A;  3E17 A;  1WFG A;  3KDK A;  4NMT A;  1VB7 A;  1U38 A;  3QJM A;  2KRG A;  1WFV A;  2WL7 A;  3NFL A;  3R69 A;  2M0U A;  1KWA A;  4Q6H A;  2JWE A;  1K32 A;  2PDZ A;  1NF3 C;  4Q2N A;  3MH4 A;  3QIK A;  3DIW A;  2QT5 A;  2H2B A;  4JOP A;  4NXP A;  5D13 A;  2EDP A;  1U37 A;  4OEO A;  4JOJ A;  1FC7 A;  1UF1 A;  1Z86 A;  4E34 A;  3L4F D;  1YBO A;  1KEF A;  4Q2O A;  5DTH A;  1QAV A;  5HET A;  1V5Q A;  5EZ0 A;  5B42 A;  3LNY A;  2G5M B;  1TP3 A;  1VJ6 A;  2KYL A;  4P0C A;  3RL8 A;  3PV4 A;  1SOT A;  1I16 A;  2K20 A;  5HEY A;  2IWP A;  4JOG A;  1WHA A;  3AXA A;  2QG1 A;  3K50 A;  3QGL A;  1FC9 A;  2K1Z A;  1VCW A;  2YUB A;  3HVQ C;  4OEP A;  3R0H A;  2H2C A;  3QJN A;  4JOH A;  4NXQ A;  2PNT A;  1Q3P A;  2I1N A;  1IU2 A;  3TSW A;  5HF1 A;  4GHN A;  3STJ A;  2EDZ A;  2G2L A;  2I6V A;  3FY5 A;  2KJK A;  2EGK A;  1VA8 A;  4XHV A;  3PDV A;  1OBX A;  3OTP A;  2EXG A;  4H11 A;  4FGM A;  3SUZ A;  1QLC A;  3PS4 A;  2R4H A;  2FNE A;  1G9O A;  4E35 A;  3R68 A;  2UZC A;  2IWQ A;  3CYY A;  1WH1 A;  2D90 A;  1LCY A;  3DOR A;  2VZ5 A;  4JOF A;  1WIF A;  2QKU A;  1N6F A;  1V62 A;  2LUI A;  2L97 A;  5G1D A;  4F8K A;  2EEI A;  2VSP A;  4EDJ A;  2OGP A;  5E1Y A;  2PZD A;  1N99 A;  5JXB A;  3ZRT A;  1GQ5 A;  2W4F A;  2ENO A;  1OZI A;  3I4W A;  3CBX A;  3SHW A;  1FCF A;  2D92 A;  2EHR A;  5A2P A;  1WF7 A;  2L4T A;  4NMS A;  2OQS A;  3GJ9 A;  3MH7 A;  2QKT A;  1Y8T A;  3KDG A;  2DAZ A;  2KV8 A;  4LMM A;  5HJ1 A;  1W9Q A;  3EGH C;  3TSV A;  4RI0 A;  1FC6 A;  3CBY A;  2I4S A;  4HOP A;  1OBZ A;  1QAU A;  1T2M A;  1WG6 A;  5FHT A;  4O06 A;  2HE2 A;  1UEW A;  2KPK A;  1P1E A;  4K78 A;  1UHP A;  2BYG A;  3GCN A;  5E11 A;  3GDV A;  5HDY A;  2DMZ A;  2EAQ A;  2LC6 A;  2Q9V A;  4GVD A;  5HFD A;  1X5N A;  2JXO A;  3NCV A;  3GDU A;  4GVC A;  4L8N A;  1U39 A;  4YDP A;  2PA1 A;  3GSL A;  1X5R A;  3SOE A;  1RZX A;  2DB5 A;  4JL7 A;  3CS0 A;  1D5G A;  2DLS A;  3EGG C;  1X8S A;  3VQF A;  4N6X A;  4YYX A;  1WF8 A;  1N7F A;  2EJY A;  2DKR A;  2GZV A;  2EGO A;  4K72 A;  2Q3G A;  2PKU A;  5E6P B;  4Z8J A;  1PDR A;  3CC0 A;  1ZOK A;  3SFJ A;  4KFW A;  4NNM A;  2RRM A;  5HED A;  3VQG A;  1SOZ A;  3K1R A;  1N7E A;  2KPL A;  2FCF A;  2MX6 A;  2VSV A;  3O5N A;  1RGR A;  4JOE A;  4Q2Q A;  2KL1 A;  1GQ4 A;  2OPG A;  1M5Z A;  2M0V A;  1GM1 A;  2FN5 A;  1L6O A;  3KZD A;  3CBZ A;  1UM1 A;  2AWX A;  2DLU A;  2AWU A;  3DJ3 A;  2LA8 A;  2DJT A;  2YT7 A;  2KOM A;  2IWO A;  2O2T A;  1QAV B;  3NFK A;  2GEF A;  2ZPL A;  1Q3O A;  2YTW A;  2EV8 A;  2KOJ A;  3CH8 A;  1X9Z A;  2I0L A;  2D8I A;  2E7K A;  3WKM A;  4OAJ A;  3GGE A;  3ID3 A;  3NGH A;  2JOA A;  3SHU A;  2KQF A;  4NMP A;  4FLN A;  3JXT A;  2PKT A;  1X5Q A;  2V90 A;  2R3Y A;  2REY A;  2EEG A;  1UEZ A;  2HGA A;  1B8Q A;  2JIL A;  1WI4 A;  2KG2 A;  1BE9 A;  5E21 A;  4PQW A;  2HE4 A;  1U3B A;  2OS6 A;  1I92 A;  1XZ9 A;  2EGN A;  1Z87 A;  1R6J A;  2EEH A;  2I04 A;  5FB8 C;  2DM8 A;  4NMQ A;  2DC2 A;  2M0Z A;  4IC6 A;  2OMJ A;  5GND A;  1UJV A;  3B76 A;  2KA9 A;  4NMO A;  4KFV A;  1WHD A;  5F67 A;  5E22 A;  2OZF A;  4UU6 A;  4WYU A;  2MHO A;  1IHJ A;  2KOH A;  4WYT A;  1P1D A;  2ZPM A;  4R2Z A;  4JJ3 A;  2EDV A;  3I18 A;  1WJL A;  1W9O A;  5G1E A;  2Z9I A;  3ID2 A;  4G69 A;  2VPH A;  3LNX A;  3PDZ A;  4Q6S A;  2P3W A;  5EYZ A;  5HFB A;  3KZE A;  1OBY A;  3ID4 A;  3QDO A;  2F0A A;  1Y7N A;  4K76 A;  3BPU A;  4AMH A;  2Z17 A;  4HOP B;  2VRF A;  5F3X A;  1MC7 A;  1TE0 A;  1UEP A;  2CS5 A;  3DJ1 A;  4Q2P A;  2EEJ A;  2YUY A;  3OU0 A;  4Q3H A;  2OCS A;  4JOK A;  2F5Y A;  4REY A;  4K6Y A;  2RCZ A;  2L4S A;  5HFE A;  1X45 A;  2FE5 A;  1V1T A;  5B6L A;  1WI2 A;  3ID1 A;  2V1W A;  2KJD A;  4NNL A;  4K75 A;  5I7Z A;  1ZUB A;  3O46 A;  3QE1 A;  2CSS A;  3DJA A;  1UJD A;  1VAE A;  3GDS A;  2KBS A;  3PV2 A;  4E3B A;  2IWN A;  1UM7 A;  4MPA A;  2QKV A;  1UIT A;  1UEQ A;  1UJU A;  4P2A B;  2KJP A;  5HFF A;  4NXR A;  2LC7 A;  2QBW A;  3I1E A;  2AIN A;  2KAW A;  2W7R A;  3RLE A;  2LOB A;  1NTE A;  3HPM A;  4JOR A;  1BFE A;  1Q7X A;  2JIK A; 
#chains in the Genus database with same CATH homology
 1W9E A;  2OSG A;  4UU5 A;  3QO6 A;  2AWW A;  1TQ3 A;  3GAB A;  3GCO A;  2VWR A;  3MH6 A;  2H3M A;  2M10 A;  1RGW A;  4JJ0 A;  4NMR A;  1IU0 A;  1KY9 A;  2I0I A;  2CSJ A;  2YT8 A;  3WKL A;  4Z33 A;  1V6B A;  2M3M A;  3K82 A;  3HPK A;  1X6D A;  3TMH A;  2M0T A;  1MFG A;  5HFC A;  1V5L A;  4NMV A;  1MFL A;  1TP5 A;  1N6D A;  5ILB A;  2X7Z A;  1RY4 A;  2JIN A;  2JSN A;  1UFX A;  5HF4 A;  2H3L A;  3KHF A;  5IL9 A;  3PV5 A;  1N6E A;  2JRE A;  5H3J A;  5HEB A;  3TSZ A;  1N7T A;  5GLJ A;  3RL7 A;  3E17 A;  1WFG A;  3KDK A;  4NMT A;  1VB7 A;  1U38 A;  3QJM A;  2KRG A;  1WFV A;  2WL7 A;  3NFL A;  3R69 A;  2M0U A;  1KWA A;  4Q6H A;  2JWE A;  1K32 A;  2PDZ A;  1NF3 C;  4Q2N A;  3MH4 A;  3QIK A;  3DIW A;  2QT5 A;  2H2B A;  4JOP A;  4NXP A;  5D13 A;  2EDP A;  1U37 A;  4OEO A;  4JOJ A;  1FC7 A;  1UF1 A;  1Z86 A;  4E34 A;  3L4F D;  1YBO A;  1KEF A;  4Q2O A;  5DTH A;  1QAV A;  5HET A;  1V5Q A;  5EZ0 A;  5B42 A;  3LNY A;  2G5M B;  1TP3 A;  1VJ6 A;  2KYL A;  4P0C A;  3RL8 A;  3PV4 A;  1SOT A;  1I16 A;  2K20 A;  5HEY A;  2IWP A;  4JOG A;  1WHA A;  3AXA A;  2QG1 A;  3K50 A;  3QGL A;  1FC9 A;  2K1Z A;  1VCW A;  2YUB A;  3HVQ C;  4OEP A;  3R0H A;  2H2C A;  3QJN A;  4JOH A;  4NXQ A;  2PNT A;  1Q3P A;  2I1N A;  1IU2 A;  3TSW A;  5HF1 A;  4GHN A;  3STJ A;  2EDZ A;  2G2L A;  2I6V A;  3FY5 A;  2KJK A;  2EGK A;  1VA8 A;  4XHV A;  3PDV A;  1OBX A;  3OTP A;  2EXG A;  4H11 A;  4FGM A;  3SUZ A;  1QLC A;  3PS4 A;  2R4H A;  2FNE A;  1G9O A;  4E35 A;  3R68 A;  2UZC A;  2IWQ A;  3CYY A;  1WH1 A;  2D90 A;  1LCY A;  3DOR A;  2VZ5 A;  4JOF A;  1WIF A;  2QKU A;  1N6F A;  1V62 A;  2LUI A;  2L97 A;  5G1D A;  4F8K A;  2EEI A;  2VSP A;  4EDJ A;  2OGP A;  5E1Y A;  2PZD A;  1N99 A;  5JXB A;  3ZRT A;  1GQ5 A;  2W4F A;  2ENO A;  1OZI A;  3I4W A;  3CBX A;  3SHW A;  1FCF A;  2D92 A;  2EHR A;  5A2P A;  1WF7 A;  2L4T A;  4NMS A;  2OQS A;  3GJ9 A;  3MH7 A;  2QKT A;  1Y8T A;  3KDG A;  2DAZ A;  2KV8 A;  4LMM A;  5HJ1 A;  1W9Q A;  3EGH C;  3TSV A;  4RI0 A;  1FC6 A;  3CBY A;  2I4S A;  4HOP A;  1OBZ A;  1QAU A;  1T2M A;  1WG6 A;  5FHT A;  4O06 A;  2HE2 A;  1UEW A;  2KPK A;  1P1E A;  4K78 A;  1UHP A;  2BYG A;  3GCN A;  5E11 A;  3GDV A;  5HDY A;  2DMZ A;  2EAQ A;  2LC6 A;  2Q9V A;  4GVD A;  5HFD A;  1X5N A;  2JXO A;  3NCV A;  3GDU A;  4GVC A;  4L8N A;  1U39 A;  4YDP A;  2PA1 A;  3GSL A;  1X5R A;  3SOE A;  1RZX A;  2DB5 A;  4JL7 A;  3CS0 A;  1D5G A;  2DLS A;  3EGG C;  1X8S A;  3VQF A;  4N6X A;  4YYX A;  1WF8 A;  1N7F A;  2EJY A;  2DKR A;  2GZV A;  2EGO A;  4K72 A;  2Q3G A;  2PKU A;  5E6P B;  4Z8J A;  1PDR A;  3CC0 A;  1ZOK A;  3SFJ A;  4KFW A;  4NNM A;  2RRM A;  5HED A;  3VQG A;  1SOZ A;  3K1R A;  1N7E A;  2KPL A;  2FCF A;  2MX6 A;  2VSV A;  3O5N A;  1RGR A;  4JOE A;  4Q2Q A;  2KL1 A;  1GQ4 A;  2OPG A;  1M5Z A;  2M0V A;  1GM1 A;  2FN5 A;  1L6O A;  3KZD A;  3CBZ A;  1UM1 A;  2AWX A;  2DLU A;  2AWU A;  3DJ3 A;  2LA8 A;  2DJT A;  2YT7 A;  2KOM A;  2IWO A;  2O2T A;  1QAV B;  3NFK A;  2GEF A;  2ZPL A;  1Q3O A;  2YTW A;  2EV8 A;  2KOJ A;  3CH8 A;  1X9Z A;  2I0L A;  2D8I A;  2E7K A;  3WKM A;  4OAJ A;  3GGE A;  3ID3 A;  3NGH A;  2JOA A;  3SHU A;  2KQF A;  4NMP A;  4FLN A;  3JXT A;  2PKT A;  1X5Q A;  2V90 A;  2R3Y A;  2REY A;  2EEG A;  1UEZ A;  2HGA A;  1B8Q A;  2JIL A;  1WI4 A;  2KG2 A;  1BE9 A;  5E21 A;  4PQW A;  2HE4 A;  1U3B A;  2OS6 A;  1I92 A;  1XZ9 A;  2EGN A;  1Z87 A;  1R6J A;  2EEH A;  2I04 A;  5FB8 C;  2DM8 A;  4NMQ A;  2DC2 A;  2M0Z A;  4IC6 A;  2OMJ A;  5GND A;  1UJV A;  3B76 A;  2KA9 A;  4NMO A;  4KFV A;  1WHD A;  5F67 A;  5E22 A;  2OZF A;  4UU6 A;  4WYU A;  2MHO A;  1IHJ A;  2KOH A;  4WYT A;  1P1D A;  2ZPM A;  4R2Z A;  4JJ3 A;  2EDV A;  3I18 A;  1WJL A;  1W9O A;  5G1E A;  2Z9I A;  3ID2 A;  4G69 A;  2VPH A;  3LNX A;  3PDZ A;  4Q6S A;  2P3W A;  5EYZ A;  5HFB A;  3KZE A;  1OBY A;  3ID4 A;  3QDO A;  2F0A A;  1Y7N A;  4K76 A;  3BPU A;  4AMH A;  2Z17 A;  4HOP B;  2VRF A;  5F3X A;  1MC7 A;  1TE0 A;  1UEP A;  2CS5 A;  3DJ1 A;  4Q2P A;  2EEJ A;  2YUY A;  3OU0 A;  4Q3H A;  2OCS A;  4JOK A;  2F5Y A;  4REY A;  4K6Y A;  2RCZ A;  2L4S A;  5HFE A;  1X45 A;  2FE5 A;  1V1T A;  5B6L A;  1WI2 A;  3ID1 A;  2V1W A;  2KJD A;  4NNL A;  4K75 A;  5I7Z A;  1ZUB A;  3O46 A;  3QE1 A;  2CSS A;  3DJA A;  1UJD A;  1VAE A;  3GDS A;  2KBS A;  3PV2 A;  4E3B A;  2IWN A;  1UM7 A;  4MPA A;  2QKV A;  1UIT A;  1UEQ A;  1UJU A;  4P2A B;  2KJP A;  5HFF A;  4NXR A;  2LC7 A;  2QBW A;  3I1E A;  2AIN A;  2KAW A;  2W7R A;  3RLE A;  2LOB A;  1NTE A;  3HPM A;  4JOR A;  1BFE A;  1Q7X A;  2JIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...