2W4FA

Crystal structure of the first pdz domain of human scrib1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
EELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERETSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN LAP4
publication title Crystal Structure of the First Pdz Domain of Human Scrib1
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2w4fA00
4Q2PA 3CBZA 2L4TA 4HOPB 3QO6A 1U38A 1OZIA 1LCYA 3DIWA 2CS5A 1V5LA 1N99A 2AINA 1X8SA 1OBYA 1BFEA 2VWRA 4OEPA 1BE9A 3GJ9A 2GZVA 1IU0A 1NTEA 1RGRA 2BYGA 2QBWA 4UU6A 1I16A 4WYTA 5DTHA 4NMTA 4NXPA 3STJA 2K20A 1G9OA 3K50A 2KJDA 5E1YA 4F8KA 3AXAA 2I6VA 3I18A 1UHPA 1X5QA 2W7RA 4NMQA 2LC7A 2DKRA 3TSVA 3O46A 1UITA 2FCFA 3GDSA 3GCOA 2EAQA 1MFGA 2KV8A 1VJ6A 1TQ3A 1VB7A 2D92A 1VCWA 2H2BA 2PNTA 1TE0A 5HFCA 1FCFA 2MX6A 1W9QA 2M0TA 3FY5A 1N7TA 2RRMA 3SUZA 1I92A 3NGHA 2LA8A 1RZXA 2JINA 3BPUA 3PS4A 1WHDA 5FHTA 4N6XA 1WI4A 3TSWA 3R0HA 1ZOKA 3OU0A 5E6PB 5HFBA 1WH1A 2DLSA 1B8QA 2F5YA 2EDPA 4AMHA 3MH4A 2KL1A 2ZPMA 3JXTA 5FB8C 4WYUA 3R69A 2WL7A 5HEDA 1Z87A 1FC7A 3QDOA 1MFLA 4JOGA 2YT8A 2H3LA 4KFVA 2EV8A 1QAUA 2VSVA 3QIKA 1Z86A 2KG2A 5I7ZA 2EGNA 1N7EA 2JXOA 4K78A 2KAWA 2QKUA 1UF1A 2DLUA 1GQ5A 3CS0A 3O5NA 1Q7XA 5A2PA 2AWUA 3I1EA 4EDJA 4JOHA 2AWXA 4NMOA 2RCZA 4NMSA 2E7KA 2QT5A 3DJ3A 1UEZA 1UEQA 4NNLA 3VQFA 1XZ9A 5GLJA 3QJMA 2OPGA 3TMHA 4O06A 2M3MA 1Y8TA 4HOPA 4OEOA 4Q2OA 2Z9IA 3HPKA 4FGMA 2K1ZA 3DJAA 2QKTA 2KA9A 3SHUA 1P1DA 2I0LA 2W4FA 2Q9VA 2LUIA 3EGHC 2IWOA 1UM7A 4P0CA 2QKVA 2YT7A 1UEWA 4Z8JA 2PKUA 2KPLA 2HE2A 2R3YA 2AWWA 4PQWA 3MH7A 1Q3OA 2JWEA 3OTPA 4E35A 2KPKA 4G69A 1WFVA 2I0IA 2OSGA 2G5MB 3E17A 4REYA 2HGAA 1X6DA 5EYZA 1N6DA 5G1EA 2Z17A 3RLEA 2KRGA 1TP3A 1WFGA 4Z33A 2EGOA 3GSLA 2EXGA 2VPHA 3RL7A 3RL8A 1KY9A 1UFXA 2G2LA 2OGPA 3WKLA 3PDZA 1UJVA 3PDVA 2REYA 1L6OA 4UU5A 1IU2A 3K82A 2IWPA 1WG6A 1WF7A 1IHJA 1PDRA 3SFJA 4Q6SA 1V6BA 2JOAA 3KHFA 1QAVB 2VRFA 4Q3HA 5HFFA 5D13A 1U39A 2LC6A 4NMPA 3KZDA 3HVQC 2EJYA 2DAZA 5HDYA 4JORA 3DORA 4LMMA 2M10A 2CSSA 4JOKA 2HE4A 2KOJA 4Q6HA 4E34A 3K1RA 1V1TA 2KJPA 3PV5A 1X5RA 2OCSA 1RGWA 2DB5A 2JREA 5EZ0A 2UZCA 5HFEA 5E21A 2IWNA 5G1DA 1VA8A 3EGGC 4JOPA 1N6FA 3WKMA 2KJKA 2VZ5A 3ID4A 4Q2QA 3ID1A 2ZPLA 4YDPA 3KZEA 4MPAA 5JXBA 2DC2A 2EGKA 5B6LA 1WJLA 1N6EA 2KQFA 4K6YA 3QE1A 1GQ4A 1UM1A 1GM1A 2OMJA 2KOMA 4OAJA 5HFDA 2DM8A 3PV4A 1WI2A 1KEFA 2PDZA 2F0AA 2DJTA 3GGEA 2L97A 2L4SA 1D5GA 4GHNA 2KBSA 2CSJA 1WIFA 3B76A 4NXRA 2KOHA 1UEPA 3SOEA 2P3WA 2EEHA 4YYXA 3GCNA 2YUBA 5HF1A 1M5ZA 3GDUA 1Q3PA 1U37A 2YUYA 3QGLA 2OQSA 2O2TA 4GVCA 5HJ1A 3NFLA 1OBXA 1FC6A 2FE5A 3SHWA 4L8NA 2I04A 1V62A 3DJ1A 2PA1A 5H3JA 3GDVA 3LNXA 2PKTA 3VQGA 1RY4A 2FNEA 4K72A 1P1EA 4KFWA 5HETA 4XHVA 3PV2A 4NXQA 1X45A 1UJDA 1VAEA 1X5NA 4H11A 2H3MA 4JOFA 2MHOA 1QLCA 1WF8A 3NFKA 1W9EA 5HEYA 1ZUBA 5HEBA 1MC7A 3CH8A 5E11A 2EEJA 2EEIA 2KYLA 4JOEA 2FN5A 4R2ZA 1QAVA 3LNYA 3R68A 1KWAA 2OZFA 4IC6A 2EDVA 1U3BA 3L4FD 4E3BA 2V90A 2IWQA 1TP5A 2OS6A 5GNDA 2X7ZA 4Q2NA 1YBOA 3QJNA 5F3XA 4JOJA 4RI0A 2VSPA 3ZRTA 4NMRA 2V1WA 2M0VA 2D8IA 1SOTA 2ENOA 2M0ZA 1K32A 2EEGA 3HPMA 4K76A 1FC9A 3I4WA 1R6JA 1NF3C 2LOBA 1N7FA 2JILA 3MH6A 3CBXA 3CYYA 2EHRA 2M0UA 2H2CA 2D90A 4NNMA 1OBZA 1T2MA 3CBYA 2QG1A 1UJUA 2JIKA 1Y7NA 2EDZA 4JL7A 2R4HA 2DMZA 4P2AB 5F67A 2I1NA 2PZDA 1V5QA 1SOZA 5E22A 1W9OA 1WHAA 3TSZA 4NMVA 3ID2A 2Q3GA 4K75A 4GVDA 2YTWA 5HF4A 3CC0A 3ID3A 2I4SA
chains in the Genus database with same CATH superfamily
4Q2PA 3CBZA 2L4TA 4HOPB 3QO6A 1U38A 1OZIA 1LCYA 3DIWA 2CS5A 1V5LA 1N99A 2AINA 1X8SA 1OBYA 1BFEA 2VWRA 4OEPA 1BE9A 3GJ9A 2GZVA 1IU0A 1NTEA 1RGRA 2BYGA 2QBWA 4UU6A 4FLNA 1I16A 4WYTA 5DTHA 4NMTA 4NXPA 3STJA 2K20A 1G9OA 3K50A 2KJDA 5E1YA 4F8KA 3AXAA 2I6VA 3I18A 1UHPA 1X5QA 2W7RA 4NMQA 2LC7A 2DKRA 3TSVA 3O46A 1UITA 2FCFA 3GDSA 3GCOA 2EAQA 1MFGA 2KV8A 1VJ6A 1TQ3A 1VB7A 2D92A 1VCWA 2H2BA 2PNTA 1TE0A 5HFCA 1FCFA 2MX6A 1W9QA 2M0TA 3FY5A 1N7TA 2RRMA 3SUZA 1I92A 3NGHA 2LA8A 1RZXA 2JINA 3BPUA 3PS4A 1WHDA 5FHTA 3KDGA 4N6XA 1WI4A 3TSWA 3R0HA 1ZOKA 3OU0A 5E6PB 5HFBA 1WH1A 2DLSA 1B8QA 2F5YA 2EDPA 4AMHA 3MH4A 2KL1A 2ZPMA 3JXTA 5FB8C 4WYUA 5B42A 3R69A 2WL7A 5HEDA 2GEFA 1Z87A 1FC7A 3QDOA 1MFLA 4JOGA 2YT8A 2H3LA 4KFVA 2EV8A 1QAUA 2VSVA 3QIKA 1Z86A 2KG2A 5I7ZA 2EGNA 1N7EA 2JXOA 4K78A 2KAWA 2QKUA 1UF1A 2DLUA 1GQ5A 3CS0A 3O5NA 1Q7XA 5A2PA 2AWUA 3I1EA 4EDJA 4JOHA 2AWXA 4NMOA 2RCZA 4NMSA 1X9ZA 2E7KA 2QT5A 3DJ3A 1UEZA 1UEQA 4NNLA 3VQFA 1XZ9A 5GLJA 3QJMA 2OPGA 3TMHA 4O06A 2M3MA 1Y8TA 4HOPA 4OEOA 4Q2OA 2Z9IA 3HPKA 4FGMA 2K1ZA 3DJAA 2QKTA 2KA9A 3SHUA 1P1DA 2I0LA 2W4FA 2Q9VA 2LUIA 3EGHC 2IWOA 1UM7A 4P0CA 2QKVA 2YT7A 1UEWA 4Z8JA 2PKUA 2KPLA 2HE2A 2R3YA 2AWWA 4PQWA 3MH7A 5IL9A 1Q3OA 2JWEA 3OTPA 4E35A 2KPKA 4G69A 1WFVA 2I0IA 2OSGA 4JJ3A 2G5MB 3E17A 4REYA 2HGAA 1X6DA 5EYZA 1N6DA 5G1EA 2Z17A 3RLEA 2KRGA 1TP3A 1WFGA 4Z33A 2EGOA 3GSLA 2EXGA 2VPHA 3RL7A 3RL8A 1KY9A 1UFXA 2G2LA 2OGPA 3WKLA 3PDZA 4JJ0A 1UJVA 3PDVA 2REYA 1L6OA 4UU5A 1IU2A 3K82A 2IWPA 1WG6A 1WF7A 1IHJA 1PDRA 3SFJA 4Q6SA 1V6BA 2JOAA 3KHFA 1QAVB 2VRFA 4Q3HA 5HFFA 3GABA 5D13A 1U39A 2LC6A 4NMPA 3KZDA 3HVQC 2EJYA 2DAZA 5HDYA 4JORA 3DORA 4LMMA 2M10A 2CSSA 4JOKA 2HE4A 2KOJA 4Q6HA 4E34A 3K1RA 1V1TA 2KJPA 3PV5A 1X5RA 2OCSA 1RGWA 2DB5A 2JREA 5EZ0A 2UZCA 5HFEA 5E21A 2IWNA 5G1DA 1VA8A 3EGGC 4JOPA 1N6FA 3WKMA 2KJKA 2VZ5A 3ID4A 4Q2QA 3ID1A 2ZPLA 4YDPA 3KZEA 4MPAA 5JXBA 2DC2A 2EGKA 5B6LA 1WJLA 1N6EA 2KQFA 4K6YA 3QE1A 1GQ4A 1UM1A 1GM1A 2OMJA 2KOMA 4OAJA 5HFDA 2DM8A 3PV4A 1WI2A 1KEFA 2PDZA 2F0AA 2DJTA 3GGEA 2L97A 5ILBA 3KDKA 2L4SA 1D5GA 4GHNA 2KBSA 2CSJA 1WIFA 3B76A 4NXRA 2KOHA 1UEPA 3SOEA 2P3WA 2EEHA 4YYXA 3GCNA 2YUBA 5HF1A 1M5ZA 3GDUA 1Q3PA 1U37A 2YUYA 3QGLA 2OQSA 2O2TA 4GVCA 5HJ1A 3NFLA 1OBXA 1FC6A 2FE5A 3SHWA 4L8NA 2I04A 1V62A 3DJ1A 2PA1A 5H3JA 3GDVA 3LNXA 2PKTA 3VQGA 1RY4A 2FNEA 4K72A 1P1EA 4KFWA 5HETA 4XHVA 3PV2A 4NXQA 1X45A 1UJDA 1VAEA 1X5NA 4H11A 2H3MA 4JOFA 2MHOA 1QLCA 1WF8A 3NFKA 1W9EA 5HEYA 1ZUBA 5HEBA 1MC7A 3CH8A 5E11A 2EEJA 2EEIA 2KYLA 4JOEA 2FN5A 4R2ZA 1QAVA 3LNYA 3R68A 1KWAA 2OZFA 4IC6A 2EDVA 1U3BA 3L4FD 4E3BA 2V90A 2IWQA 1TP5A 2OS6A 5GNDA 2X7ZA 4Q2NA 1YBOA 3QJNA 3NCVA 5F3XA 4JOJA 4RI0A 2VSPA 3ZRTA 4NMRA 2V1WA 2M0VA 2D8IA 1SOTA 2ENOA 2M0ZA 1K32A 2EEGA 3HPMA 4K76A 1FC9A 2JSNA 3I4WA 1R6JA 1NF3C 2LOBA 1N7FA 2JILA 3MH6A 3CBXA 3CYYA 2EHRA 2M0UA 2H2CA 2D90A 4NNMA 1OBZA 1T2MA 3CBYA 2QG1A 1UJUA 2JIKA 1Y7NA 2EDZA 4JL7A 2R4HA 2DMZA 4P2AB 5F67A 2I1NA 2PZDA 1V5QA 1SOZA 5E22A 1W9OA 1WHAA 3TSZA 4NMVA 3ID2A 2Q3GA 4K75A 4GVDA 2YTWA 5HF4A 3CC0A 3ID3A 2I4SA
chains in the Genus database with same CATH topology
4Q2PA 3CBZA 2L4TA 4HOPB 3QO6A 1U38A 1OZIA 1LCYA 3DIWA 2CS5A 1V5LA 1N99A 2AINA 1X8SA 1OBYA 1BFEA 2VWRA 4OEPA 1BE9A 3GJ9A 2GZVA 1IU0A 1NTEA 1RGRA 2BYGA 2QBWA 4UU6A 4FLNA 1I16A 4WYTA 5DTHA 4NMTA 4NXPA 3STJA 2K20A 1G9OA 3K50A 2KJDA 5E1YA 4F8KA 3AXAA 2I6VA 3I18A 1UHPA 1X5QA 2W7RA 4NMQA 2LC7A 2DKRA 3TSVA 3O46A 1UITA 2FCFA 3GDSA 3GCOA 2EAQA 1MFGA 2KV8A 1VJ6A 1TQ3A 1VB7A 2D92A 1VCWA 2H2BA 2PNTA 1TE0A 5HFCA 1FCFA 2MX6A 1W9QA 2M0TA 3FY5A 1N7TA 2RRMA 3SUZA 1I92A 3NGHA 2LA8A 1RZXA 2JINA 3BPUA 3PS4A 1WHDA 5FHTA 3KDGA 4N6XA 1WI4A 3TSWA 3R0HA 1ZOKA 3OU0A 5E6PB 5HFBA 1WH1A 2DLSA 1B8QA 2F5YA 2EDPA 4AMHA 3MH4A 2KL1A 2ZPMA 3JXTA 5FB8C 4WYUA 5B42A 3R69A 2WL7A 5HEDA 2GEFA 1Z87A 1FC7A 3QDOA 1MFLA 4JOGA 2YT8A 2H3LA 4KFVA 2EV8A 1QAUA 2VSVA 3QIKA 1Z86A 2KG2A 5I7ZA 2EGNA 1N7EA 2JXOA 4K78A 2KAWA 2QKUA 1UF1A 2DLUA 1GQ5A 3CS0A 3O5NA 1Q7XA 5A2PA 2AWUA 3I1EA 4EDJA 4JOHA 2AWXA 4NMOA 2RCZA 4NMSA 1X9ZA 2E7KA 2QT5A 3DJ3A 1UEZA 1UEQA 4NNLA 3VQFA 1XZ9A 5GLJA 3QJMA 2OPGA 3TMHA 4O06A 2M3MA 1Y8TA 4HOPA 4OEOA 4Q2OA 2Z9IA 3HPKA 4FGMA 2K1ZA 3DJAA 2QKTA 2KA9A 3SHUA 1P1DA 2I0LA 2W4FA 2Q9VA 2LUIA 3EGHC 2IWOA 1UM7A 4P0CA 2QKVA 2YT7A 1UEWA 4Z8JA 2PKUA 2KPLA 2HE2A 2R3YA 2AWWA 4PQWA 3MH7A 5IL9A 1Q3OA 2JWEA 3OTPA 4E35A 2KPKA 4G69A 1WFVA 2I0IA 2OSGA 4JJ3A 2G5MB 3E17A 4REYA 2HGAA 1X6DA 5EYZA 1N6DA 5G1EA 2Z17A 3RLEA 2KRGA 1TP3A 1WFGA 4Z33A 2EGOA 3GSLA 2EXGA 2VPHA 3RL7A 3RL8A 1KY9A 1UFXA 2G2LA 2OGPA 3WKLA 3PDZA 4JJ0A 1UJVA 3PDVA 2REYA 1L6OA 4UU5A 1IU2A 3K82A 2IWPA 1WG6A 1WF7A 1IHJA 1PDRA 3SFJA 4Q6SA 1V6BA 2JOAA 3KHFA 1QAVB 2VRFA 4Q3HA 5HFFA 3GABA 5D13A 1U39A 2LC6A 4NMPA 3KZDA 3HVQC 2EJYA 2DAZA 5HDYA 4JORA 3DORA 4LMMA 2M10A 2CSSA 4JOKA 2HE4A 2KOJA 4Q6HA 4E34A 3K1RA 1V1TA 2KJPA 3PV5A 1X5RA 2OCSA 1RGWA 2DB5A 2JREA 5EZ0A 2UZCA 5HFEA 5E21A 2IWNA 5G1DA 1VA8A 3EGGC 4JOPA 1N6FA 3WKMA 2KJKA 2VZ5A 3ID4A 4Q2QA 3ID1A 2ZPLA 4YDPA 3KZEA 4MPAA 5JXBA 2DC2A 2EGKA 5B6LA 1WJLA 1N6EA 2KQFA 4K6YA 3QE1A 1GQ4A 1UM1A 1GM1A 2OMJA 2KOMA 4OAJA 5HFDA 2DM8A 3PV4A 1WI2A 1KEFA 2PDZA 2F0AA 2DJTA 3GGEA 2L97A 5ILBA 3KDKA 2L4SA 1D5GA 4GHNA 2KBSA 2CSJA 1WIFA 3B76A 4NXRA 2KOHA 1UEPA 3SOEA 2P3WA 2EEHA 4YYXA 3GCNA 2YUBA 5HF1A 1M5ZA 3GDUA 1Q3PA 1U37A 2YUYA 3QGLA 2OQSA 2O2TA 4GVCA 5HJ1A 3NFLA 1OBXA 1FC6A 2FE5A 3SHWA 4L8NA 2I04A 1V62A 3DJ1A 2PA1A 5H3JA 3GDVA 3LNXA 2PKTA 3VQGA 1RY4A 2FNEA 4K72A 1P1EA 4KFWA 5HETA 4XHVA 3PV2A 4NXQA 1X45A 1UJDA 1VAEA 1X5NA 4H11A 2H3MA 4JOFA 2MHOA 1QLCA 1WF8A 3NFKA 1W9EA 5HEYA 1ZUBA 5HEBA 1MC7A 3CH8A 5E11A 2EEJA 2EEIA 2KYLA 4JOEA 2FN5A 4R2ZA 1QAVA 3LNYA 3R68A 1KWAA 2OZFA 4IC6A 2EDVA 1U3BA 3L4FD 4E3BA 2V90A 2IWQA 1TP5A 2OS6A 5GNDA 2X7ZA 4Q2NA 1YBOA 3QJNA 3NCVA 5F3XA 4JOJA 4RI0A 2VSPA 3ZRTA 4NMRA 2V1WA 2M0VA 2D8IA 1SOTA 2ENOA 2M0ZA 1K32A 2EEGA 3HPMA 4K76A 1FC9A 2JSNA 3I4WA 1R6JA 1NF3C 2LOBA 1N7FA 2JILA 3MH6A 3CBXA 3CYYA 2EHRA 2M0UA 2H2CA 2D90A 4NNMA 1OBZA 1T2MA 3CBYA 2QG1A 1UJUA 2JIKA 1Y7NA 2EDZA 4JL7A 2R4HA 2DMZA 4P2AB 5F67A 2I1NA 2PZDA 1V5QA 1SOZA 5E22A 1W9OA 1WHAA 3TSZA 4NMVA 3ID2A 2Q3GA 4K75A 4GVDA 2YTWA 5HF4A 3CC0A 3ID3A 2I4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2P A;  3CBZ A;  2L4T A;  4HOP B;  3QO6 A;  1U38 A;  1OZI A;  1LCY A;  3DIW A;  2CS5 A;  1V5L A;  1N99 A;  2AIN A;  1X8S A;  1OBY A;  1BFE A;  2VWR A;  4OEP A;  1BE9 A;  3GJ9 A;  2GZV A;  1IU0 A;  1NTE A;  1RGR A;  2BYG A;  2QBW A;  4UU6 A;  1I16 A;  4WYT A;  5DTH A;  4NMT A;  4NXP A;  3STJ A;  2K20 A;  1G9O A;  3K50 A;  2KJD A;  5E1Y A;  4F8K A;  3AXA A;  2I6V A;  3I18 A;  1UHP A;  1X5Q A;  2W7R A;  4NMQ A;  2LC7 A;  2DKR A;  3TSV A;  3O46 A;  1UIT A;  2FCF A;  3GDS A;  3GCO A;  2EAQ A;  1MFG A;  2KV8 A;  1VJ6 A;  1TQ3 A;  1VB7 A;  2D92 A;  1VCW A;  2H2B A;  2PNT A;  1TE0 A;  5HFC A;  1FCF A;  2MX6 A;  1W9Q A;  2M0T A;  3FY5 A;  1N7T A;  2RRM A;  3SUZ A;  1I92 A;  3NGH A;  2LA8 A;  1RZX A;  2JIN A;  3BPU A;  3PS4 A;  1WHD A;  5FHT A;  4N6X A;  1WI4 A;  3TSW A;  3R0H A;  1ZOK A;  3OU0 A;  5E6P B;  5HFB A;  1WH1 A;  2DLS A;  1B8Q A;  2F5Y A;  2EDP A;  4AMH A;  3MH4 A;  2KL1 A;  2ZPM A;  3JXT A;  5FB8 C;  4WYU A;  3R69 A;  2WL7 A;  5HED A;  1Z87 A;  1FC7 A;  3QDO A;  1MFL A;  4JOG A;  2YT8 A;  2H3L A;  4KFV A;  2EV8 A;  1QAU A;  2VSV A;  3QIK A;  1Z86 A;  2KG2 A;  5I7Z A;  2EGN A;  1N7E A;  2JXO A;  4K78 A;  2KAW A;  2QKU A;  1UF1 A;  2DLU A;  1GQ5 A;  3CS0 A;  3O5N A;  1Q7X A;  5A2P A;  2AWU A;  3I1E A;  4EDJ A;  4JOH A;  2AWX A;  4NMO A;  2RCZ A;  4NMS A;  2E7K A;  2QT5 A;  3DJ3 A;  1UEZ A;  1UEQ A;  4NNL A;  3VQF A;  1XZ9 A;  5GLJ A;  3QJM A;  2OPG A;  3TMH A;  4O06 A;  2M3M A;  1Y8T A;  4HOP A;  4OEO A;  4Q2O A;  2Z9I A;  3HPK A;  4FGM A;  2K1Z A;  3DJA A;  2QKT A;  2KA9 A;  3SHU A;  1P1D A;  2I0L A;  2W4F A;  2Q9V A;  2LUI A;  3EGH C;  2IWO A;  1UM7 A;  4P0C A;  2QKV A;  2YT7 A;  1UEW A;  4Z8J A;  2PKU A;  2KPL A;  2HE2 A;  2R3Y A;  2AWW A;  4PQW A;  3MH7 A;  1Q3O A;  2JWE A;  3OTP A;  4E35 A;  2KPK A;  4G69 A;  1WFV A;  2I0I A;  2OSG A;  2G5M B;  3E17 A;  4REY A;  2HGA A;  1X6D A;  5EYZ A;  1N6D A;  5G1E A;  2Z17 A;  3RLE A;  2KRG A;  1TP3 A;  1WFG A;  4Z33 A;  2EGO A;  3GSL A;  2EXG A;  2VPH A;  3RL7 A;  3RL8 A;  1KY9 A;  1UFX A;  2G2L A;  2OGP A;  3WKL A;  3PDZ A;  1UJV A;  3PDV A;  2REY A;  1L6O A;  4UU5 A;  1IU2 A;  3K82 A;  2IWP A;  1WG6 A;  1WF7 A;  1IHJ A;  1PDR A;  3SFJ A;  4Q6S A;  1V6B A;  2JOA A;  3KHF A;  1QAV B;  2VRF A;  4Q3H A;  5HFF A;  5D13 A;  1U39 A;  2LC6 A;  4NMP A;  3KZD A;  3HVQ C;  2EJY A;  2DAZ A;  5HDY A;  4JOR A;  3DOR A;  4LMM A;  2M10 A;  2CSS A;  4JOK A;  2HE4 A;  2KOJ A;  4Q6H A;  4E34 A;  3K1R A;  1V1T A;  2KJP A;  3PV5 A;  1X5R A;  2OCS A;  1RGW A;  2DB5 A;  2JRE A;  5EZ0 A;  2UZC A;  5HFE A;  5E21 A;  2IWN A;  5G1D A;  1VA8 A;  3EGG C;  4JOP A;  1N6F A;  3WKM A;  2KJK A;  2VZ5 A;  3ID4 A;  4Q2Q A;  3ID1 A;  2ZPL A;  4YDP A;  3KZE A;  4MPA A;  5JXB A;  2DC2 A;  2EGK A;  5B6L A;  1WJL A;  1N6E A;  2KQF A;  4K6Y A;  3QE1 A;  1GQ4 A;  1UM1 A;  1GM1 A;  2OMJ A;  2KOM A;  4OAJ A;  5HFD A;  2DM8 A;  3PV4 A;  1WI2 A;  1KEF A;  2PDZ A;  2F0A A;  2DJT A;  3GGE A;  2L97 A;  2L4S A;  1D5G A;  4GHN A;  2KBS A;  2CSJ A;  1WIF A;  3B76 A;  4NXR A;  2KOH A;  1UEP A;  3SOE A;  2P3W A;  2EEH A;  4YYX A;  3GCN A;  2YUB A;  5HF1 A;  1M5Z A;  3GDU A;  1Q3P A;  1U37 A;  2YUY A;  3QGL A;  2OQS A;  2O2T A;  4GVC A;  5HJ1 A;  3NFL A;  1OBX A;  1FC6 A;  2FE5 A;  3SHW A;  4L8N A;  2I04 A;  1V62 A;  3DJ1 A;  2PA1 A;  5H3J A;  3GDV A;  3LNX A;  2PKT A;  3VQG A;  1RY4 A;  2FNE A;  4K72 A;  1P1E A;  4KFW A;  5HET A;  4XHV A;  3PV2 A;  4NXQ A;  1X45 A;  1UJD A;  1VAE A;  1X5N A;  4H11 A;  2H3M A;  4JOF A;  2MHO A;  1QLC A;  1WF8 A;  3NFK A;  1W9E A;  5HEY A;  1ZUB A;  5HEB A;  1MC7 A;  3CH8 A;  5E11 A;  2EEJ A;  2EEI A;  2KYL A;  4JOE A;  2FN5 A;  4R2Z A;  1QAV A;  3LNY A;  3R68 A;  1KWA A;  2OZF A;  4IC6 A;  2EDV A;  1U3B A;  3L4F D;  4E3B A;  2V90 A;  2IWQ A;  1TP5 A;  2OS6 A;  5GND A;  2X7Z A;  4Q2N A;  1YBO A;  3QJN A;  5F3X A;  4JOJ A;  4RI0 A;  2VSP A;  3ZRT A;  4NMR A;  2V1W A;  2M0V A;  2D8I A;  1SOT A;  2ENO A;  2M0Z A;  1K32 A;  2EEG A;  3HPM A;  4K76 A;  1FC9 A;  3I4W A;  1R6J A;  1NF3 C;  2LOB A;  1N7F A;  2JIL A;  3MH6 A;  3CBX A;  3CYY A;  2EHR A;  2M0U A;  2H2C A;  2D90 A;  4NNM A;  1OBZ A;  1T2M A;  3CBY A;  2QG1 A;  1UJU A;  2JIK A;  1Y7N A;  2EDZ A;  4JL7 A;  2R4H A;  2DMZ A;  4P2A B;  5F67 A;  2I1N A;  2PZD A;  1V5Q A;  1SOZ A;  5E22 A;  1W9O A;  1WHA A;  3TSZ A;  4NMV A;  3ID2 A;  2Q3G A;  4K75 A;  4GVD A;  2YTW A;  5HF4 A;  3CC0 A;  3ID3 A;  2I4S A; 
#chains in the Genus database with same CATH topology
 4Q2P A;  3CBZ A;  2L4T A;  4HOP B;  3QO6 A;  1U38 A;  1OZI A;  1LCY A;  3DIW A;  2CS5 A;  1V5L A;  1N99 A;  2AIN A;  1X8S A;  1OBY A;  1BFE A;  2VWR A;  4OEP A;  1BE9 A;  3GJ9 A;  2GZV A;  1IU0 A;  1NTE A;  1RGR A;  2BYG A;  2QBW A;  4UU6 A;  4FLN A;  1I16 A;  4WYT A;  5DTH A;  4NMT A;  4NXP A;  3STJ A;  2K20 A;  1G9O A;  3K50 A;  2KJD A;  5E1Y A;  4F8K A;  3AXA A;  2I6V A;  3I18 A;  1UHP A;  1X5Q A;  2W7R A;  4NMQ A;  2LC7 A;  2DKR A;  3TSV A;  3O46 A;  1UIT A;  2FCF A;  3GDS A;  3GCO A;  2EAQ A;  1MFG A;  2KV8 A;  1VJ6 A;  1TQ3 A;  1VB7 A;  2D92 A;  1VCW A;  2H2B A;  2PNT A;  1TE0 A;  5HFC A;  1FCF A;  2MX6 A;  1W9Q A;  2M0T A;  3FY5 A;  1N7T A;  2RRM A;  3SUZ A;  1I92 A;  3NGH A;  2LA8 A;  1RZX A;  2JIN A;  3BPU A;  3PS4 A;  1WHD A;  5FHT A;  3KDG A;  4N6X A;  1WI4 A;  3TSW A;  3R0H A;  1ZOK A;  3OU0 A;  5E6P B;  5HFB A;  1WH1 A;  2DLS A;  1B8Q A;  2F5Y A;  2EDP A;  4AMH A;  3MH4 A;  2KL1 A;  2ZPM A;  3JXT A;  5FB8 C;  4WYU A;  5B42 A;  3R69 A;  2WL7 A;  5HED A;  2GEF A;  1Z87 A;  1FC7 A;  3QDO A;  1MFL A;  4JOG A;  2YT8 A;  2H3L A;  4KFV A;  2EV8 A;  1QAU A;  2VSV A;  3QIK A;  1Z86 A;  2KG2 A;  5I7Z A;  2EGN A;  1N7E A;  2JXO A;  4K78 A;  2KAW A;  2QKU A;  1UF1 A;  2DLU A;  1GQ5 A;  3CS0 A;  3O5N A;  1Q7X A;  5A2P A;  2AWU A;  3I1E A;  4EDJ A;  4JOH A;  2AWX A;  4NMO A;  2RCZ A;  4NMS A;  1X9Z A;  2E7K A;  2QT5 A;  3DJ3 A;  1UEZ A;  1UEQ A;  4NNL A;  3VQF A;  1XZ9 A;  5GLJ A;  3QJM A;  2OPG A;  3TMH A;  4O06 A;  2M3M A;  1Y8T A;  4HOP A;  4OEO A;  4Q2O A;  2Z9I A;  3HPK A;  4FGM A;  2K1Z A;  3DJA A;  2QKT A;  2KA9 A;  3SHU A;  1P1D A;  2I0L A;  2W4F A;  2Q9V A;  2LUI A;  3EGH C;  2IWO A;  1UM7 A;  4P0C A;  2QKV A;  2YT7 A;  1UEW A;  4Z8J A;  2PKU A;  2KPL A;  2HE2 A;  2R3Y A;  2AWW A;  4PQW A;  3MH7 A;  5IL9 A;  1Q3O A;  2JWE A;  3OTP A;  4E35 A;  2KPK A;  4G69 A;  1WFV A;  2I0I A;  2OSG A;  4JJ3 A;  2G5M B;  3E17 A;  4REY A;  2HGA A;  1X6D A;  5EYZ A;  1N6D A;  5G1E A;  2Z17 A;  3RLE A;  2KRG A;  1TP3 A;  1WFG A;  4Z33 A;  2EGO A;  3GSL A;  2EXG A;  2VPH A;  3RL7 A;  3RL8 A;  1KY9 A;  1UFX A;  2G2L A;  2OGP A;  3WKL A;  3PDZ A;  4JJ0 A;  1UJV A;  3PDV A;  2REY A;  1L6O A;  4UU5 A;  1IU2 A;  3K82 A;  2IWP A;  1WG6 A;  1WF7 A;  1IHJ A;  1PDR A;  3SFJ A;  4Q6S A;  1V6B A;  2JOA A;  3KHF A;  1QAV B;  2VRF A;  4Q3H A;  5HFF A;  3GAB A;  5D13 A;  1U39 A;  2LC6 A;  4NMP A;  3KZD A;  3HVQ C;  2EJY A;  2DAZ A;  5HDY A;  4JOR A;  3DOR A;  4LMM A;  2M10 A;  2CSS A;  4JOK A;  2HE4 A;  2KOJ A;  4Q6H A;  4E34 A;  3K1R A;  1V1T A;  2KJP A;  3PV5 A;  1X5R A;  2OCS A;  1RGW A;  2DB5 A;  2JRE A;  5EZ0 A;  2UZC A;  5HFE A;  5E21 A;  2IWN A;  5G1D A;  1VA8 A;  3EGG C;  4JOP A;  1N6F A;  3WKM A;  2KJK A;  2VZ5 A;  3ID4 A;  4Q2Q A;  3ID1 A;  2ZPL A;  4YDP A;  3KZE A;  4MPA A;  5JXB A;  2DC2 A;  2EGK A;  5B6L A;  1WJL A;  1N6E A;  2KQF A;  4K6Y A;  3QE1 A;  1GQ4 A;  1UM1 A;  1GM1 A;  2OMJ A;  2KOM A;  4OAJ A;  5HFD A;  2DM8 A;  3PV4 A;  1WI2 A;  1KEF A;  2PDZ A;  2F0A A;  2DJT A;  3GGE A;  2L97 A;  5ILB A;  3KDK A;  2L4S A;  1D5G A;  4GHN A;  2KBS A;  2CSJ A;  1WIF A;  3B76 A;  4NXR A;  2KOH A;  1UEP A;  3SOE A;  2P3W A;  2EEH A;  4YYX A;  3GCN A;  2YUB A;  5HF1 A;  1M5Z A;  3GDU A;  1Q3P A;  1U37 A;  2YUY A;  3QGL A;  2OQS A;  2O2T A;  4GVC A;  5HJ1 A;  3NFL A;  1OBX A;  1FC6 A;  2FE5 A;  3SHW A;  4L8N A;  2I04 A;  1V62 A;  3DJ1 A;  2PA1 A;  5H3J A;  3GDV A;  3LNX A;  2PKT A;  3VQG A;  1RY4 A;  2FNE A;  4K72 A;  1P1E A;  4KFW A;  5HET A;  4XHV A;  3PV2 A;  4NXQ A;  1X45 A;  1UJD A;  1VAE A;  1X5N A;  4H11 A;  2H3M A;  4JOF A;  2MHO A;  1QLC A;  1WF8 A;  3NFK A;  1W9E A;  5HEY A;  1ZUB A;  5HEB A;  1MC7 A;  3CH8 A;  5E11 A;  2EEJ A;  2EEI A;  2KYL A;  4JOE A;  2FN5 A;  4R2Z A;  1QAV A;  3LNY A;  3R68 A;  1KWA A;  2OZF A;  4IC6 A;  2EDV A;  1U3B A;  3L4F D;  4E3B A;  2V90 A;  2IWQ A;  1TP5 A;  2OS6 A;  5GND A;  2X7Z A;  4Q2N A;  1YBO A;  3QJN A;  3NCV A;  5F3X A;  4JOJ A;  4RI0 A;  2VSP A;  3ZRT A;  4NMR A;  2V1W A;  2M0V A;  2D8I A;  1SOT A;  2ENO A;  2M0Z A;  1K32 A;  2EEG A;  3HPM A;  4K76 A;  1FC9 A;  2JSN A;  3I4W A;  1R6J A;  1NF3 C;  2LOB A;  1N7F A;  2JIL A;  3MH6 A;  3CBX A;  3CYY A;  2EHR A;  2M0U A;  2H2C A;  2D90 A;  4NNM A;  1OBZ A;  1T2M A;  3CBY A;  2QG1 A;  1UJU A;  2JIK A;  1Y7N A;  2EDZ A;  4JL7 A;  2R4H A;  2DMZ A;  4P2A B;  5F67 A;  2I1N A;  2PZD A;  1V5Q A;  1SOZ A;  5E22 A;  1W9O A;  1WHA A;  3TSZ A;  4NMV A;  3ID2 A;  2Q3G A;  4K75 A;  4GVD A;  2YTW A;  5HF4 A;  3CC0 A;  3ID3 A;  2I4S A; 
#chains in the Genus database with same CATH homology
 4Q2P A;  3CBZ A;  2L4T A;  4HOP B;  3QO6 A;  1U38 A;  1OZI A;  1LCY A;  3DIW A;  2CS5 A;  1V5L A;  1N99 A;  2AIN A;  1X8S A;  1OBY A;  1BFE A;  2VWR A;  4OEP A;  1BE9 A;  3GJ9 A;  2GZV A;  1IU0 A;  1NTE A;  1RGR A;  2BYG A;  2QBW A;  4UU6 A;  4FLN A;  1I16 A;  4WYT A;  5DTH A;  4NMT A;  4NXP A;  3STJ A;  2K20 A;  1G9O A;  3K50 A;  2KJD A;  5E1Y A;  4F8K A;  3AXA A;  2I6V A;  3I18 A;  1UHP A;  1X5Q A;  2W7R A;  4NMQ A;  2LC7 A;  2DKR A;  3TSV A;  3O46 A;  1UIT A;  2FCF A;  3GDS A;  3GCO A;  2EAQ A;  1MFG A;  2KV8 A;  1VJ6 A;  1TQ3 A;  1VB7 A;  2D92 A;  1VCW A;  2H2B A;  2PNT A;  1TE0 A;  5HFC A;  1FCF A;  2MX6 A;  1W9Q A;  2M0T A;  3FY5 A;  1N7T A;  2RRM A;  3SUZ A;  1I92 A;  3NGH A;  2LA8 A;  1RZX A;  2JIN A;  3BPU A;  3PS4 A;  1WHD A;  5FHT A;  3KDG A;  4N6X A;  1WI4 A;  3TSW A;  3R0H A;  1ZOK A;  3OU0 A;  5E6P B;  5HFB A;  1WH1 A;  2DLS A;  1B8Q A;  2F5Y A;  2EDP A;  4AMH A;  3MH4 A;  2KL1 A;  2ZPM A;  3JXT A;  5FB8 C;  4WYU A;  5B42 A;  3R69 A;  2WL7 A;  5HED A;  2GEF A;  1Z87 A;  1FC7 A;  3QDO A;  1MFL A;  4JOG A;  2YT8 A;  2H3L A;  4KFV A;  2EV8 A;  1QAU A;  2VSV A;  3QIK A;  1Z86 A;  2KG2 A;  5I7Z A;  2EGN A;  1N7E A;  2JXO A;  4K78 A;  2KAW A;  2QKU A;  1UF1 A;  2DLU A;  1GQ5 A;  3CS0 A;  3O5N A;  1Q7X A;  5A2P A;  2AWU A;  3I1E A;  4EDJ A;  4JOH A;  2AWX A;  4NMO A;  2RCZ A;  4NMS A;  1X9Z A;  2E7K A;  2QT5 A;  3DJ3 A;  1UEZ A;  1UEQ A;  4NNL A;  3VQF A;  1XZ9 A;  5GLJ A;  3QJM A;  2OPG A;  3TMH A;  4O06 A;  2M3M A;  1Y8T A;  4HOP A;  4OEO A;  4Q2O A;  2Z9I A;  3HPK A;  4FGM A;  2K1Z A;  3DJA A;  2QKT A;  2KA9 A;  3SHU A;  1P1D A;  2I0L A;  2W4F A;  2Q9V A;  2LUI A;  3EGH C;  2IWO A;  1UM7 A;  4P0C A;  2QKV A;  2YT7 A;  1UEW A;  4Z8J A;  2PKU A;  2KPL A;  2HE2 A;  2R3Y A;  2AWW A;  4PQW A;  3MH7 A;  5IL9 A;  1Q3O A;  2JWE A;  3OTP A;  4E35 A;  2KPK A;  4G69 A;  1WFV A;  2I0I A;  2OSG A;  4JJ3 A;  2G5M B;  3E17 A;  4REY A;  2HGA A;  1X6D A;  5EYZ A;  1N6D A;  5G1E A;  2Z17 A;  3RLE A;  2KRG A;  1TP3 A;  1WFG A;  4Z33 A;  2EGO A;  3GSL A;  2EXG A;  2VPH A;  3RL7 A;  3RL8 A;  1KY9 A;  1UFX A;  2G2L A;  2OGP A;  3WKL A;  3PDZ A;  4JJ0 A;  1UJV A;  3PDV A;  2REY A;  1L6O A;  4UU5 A;  1IU2 A;  3K82 A;  2IWP A;  1WG6 A;  1WF7 A;  1IHJ A;  1PDR A;  3SFJ A;  4Q6S A;  1V6B A;  2JOA A;  3KHF A;  1QAV B;  2VRF A;  4Q3H A;  5HFF A;  3GAB A;  5D13 A;  1U39 A;  2LC6 A;  4NMP A;  3KZD A;  3HVQ C;  2EJY A;  2DAZ A;  5HDY A;  4JOR A;  3DOR A;  4LMM A;  2M10 A;  2CSS A;  4JOK A;  2HE4 A;  2KOJ A;  4Q6H A;  4E34 A;  3K1R A;  1V1T A;  2KJP A;  3PV5 A;  1X5R A;  2OCS A;  1RGW A;  2DB5 A;  2JRE A;  5EZ0 A;  2UZC A;  5HFE A;  5E21 A;  2IWN A;  5G1D A;  1VA8 A;  3EGG C;  4JOP A;  1N6F A;  3WKM A;  2KJK A;  2VZ5 A;  3ID4 A;  4Q2Q A;  3ID1 A;  2ZPL A;  4YDP A;  3KZE A;  4MPA A;  5JXB A;  2DC2 A;  2EGK A;  5B6L A;  1WJL A;  1N6E A;  2KQF A;  4K6Y A;  3QE1 A;  1GQ4 A;  1UM1 A;  1GM1 A;  2OMJ A;  2KOM A;  4OAJ A;  5HFD A;  2DM8 A;  3PV4 A;  1WI2 A;  1KEF A;  2PDZ A;  2F0A A;  2DJT A;  3GGE A;  2L97 A;  5ILB A;  3KDK A;  2L4S A;  1D5G A;  4GHN A;  2KBS A;  2CSJ A;  1WIF A;  3B76 A;  4NXR A;  2KOH A;  1UEP A;  3SOE A;  2P3W A;  2EEH A;  4YYX A;  3GCN A;  2YUB A;  5HF1 A;  1M5Z A;  3GDU A;  1Q3P A;  1U37 A;  2YUY A;  3QGL A;  2OQS A;  2O2T A;  4GVC A;  5HJ1 A;  3NFL A;  1OBX A;  1FC6 A;  2FE5 A;  3SHW A;  4L8N A;  2I04 A;  1V62 A;  3DJ1 A;  2PA1 A;  5H3J A;  3GDV A;  3LNX A;  2PKT A;  3VQG A;  1RY4 A;  2FNE A;  4K72 A;  1P1E A;  4KFW A;  5HET A;  4XHV A;  3PV2 A;  4NXQ A;  1X45 A;  1UJD A;  1VAE A;  1X5N A;  4H11 A;  2H3M A;  4JOF A;  2MHO A;  1QLC A;  1WF8 A;  3NFK A;  1W9E A;  5HEY A;  1ZUB A;  5HEB A;  1MC7 A;  3CH8 A;  5E11 A;  2EEJ A;  2EEI A;  2KYL A;  4JOE A;  2FN5 A;  4R2Z A;  1QAV A;  3LNY A;  3R68 A;  1KWA A;  2OZF A;  4IC6 A;  2EDV A;  1U3B A;  3L4F D;  4E3B A;  2V90 A;  2IWQ A;  1TP5 A;  2OS6 A;  5GND A;  2X7Z A;  4Q2N A;  1YBO A;  3QJN A;  3NCV A;  5F3X A;  4JOJ A;  4RI0 A;  2VSP A;  3ZRT A;  4NMR A;  2V1W A;  2M0V A;  2D8I A;  1SOT A;  2ENO A;  2M0Z A;  1K32 A;  2EEG A;  3HPM A;  4K76 A;  1FC9 A;  2JSN A;  3I4W A;  1R6J A;  1NF3 C;  2LOB A;  1N7F A;  2JIL A;  3MH6 A;  3CBX A;  3CYY A;  2EHR A;  2M0U A;  2H2C A;  2D90 A;  4NNM A;  1OBZ A;  1T2M A;  3CBY A;  2QG1 A;  1UJU A;  2JIK A;  1Y7N A;  2EDZ A;  4JL7 A;  2R4H A;  2DMZ A;  4P2A B;  5F67 A;  2I1N A;  2PZD A;  1V5Q A;  1SOZ A;  5E22 A;  1W9O A;  1WHA A;  3TSZ A;  4NMV A;  3ID2 A;  2Q3G A;  4K75 A;  4GVD A;  2YTW A;  5HF4 A;  3CC0 A;  3ID3 A;  2I4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...