3DJ3A

Crystal structure of c-terminal truncated tip-1 (6-113)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
VVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 3
publication title Structural Basis of beta-Catenin Recognition by Tax-interacting Protein-1
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 23
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3dj3A00
4JOJA 3I18A 3RLEA 4Q2NA 1UJDA 2M0UA 4NXRA 2KL1A 1G9OA 1UFXA 2EHRA 2M10A 2W7RA 4Q6HA 2EEGA 1FC7A 4L8NA 1TP3A 1WF7A 3TMHA 3GSLA 4NMRA 2EXGA 1W9OA 3QJNA 1KWAA 2Q3GA 5GLJA 1R6JA 3O5NA 5EYZA 5D13A 2QKUA 1QAUA 1P1DA 3OTPA 2FN5A 3ID4A 5HEDA 3EGHC 3NGHA 4K75A 4IC6A 2KRGA 2KG2A 2KOHA 2L97A 4H11A 2ZPMA 1Q3PA 2OGPA 3PS4A 3SUZA 1XZ9A 4E34A 3ID3A 4KFVA 1GQ5A 1RGRA 4Q6SA 3I4WA 2KA9A 3GCOA 4NMSA 2IWNA 2Z17A 1QAVA 3K1RA 1VCWA 2MX6A 2G5MB 5F67A 4NMVA 2YUBA 1WIFA 2EEIA 2KYLA 1MC7A 3R0HA 1V62A 2H3MA 3RL7A 4GHNA 2VZ5A 2K1ZA 4NMQA 3K82A 3MH6A 4G69A 4AMHA 2DKRA 5F3XA 4JOFA 3DJ1A 4NNMA 3GDSA 3KZEA 3OU0A 1X5NA 1GQ4A 1BFEA 3STJA 4LMMA 1L6OA 2PNTA 2OCSA 3L4FD 3DORA 1Y7NA 4MPAA 2QBWA 2I0LA 3BPUA 1UJVA 3HVQC 3CS0A 4YYXA 4E3BA 2V90A 3SHWA 5E6PB 2OSGA 1X5RA 2LC7A 1Q7XA 3PDVA 2KQFA 1WFGA 2OMJA 1QAVB 2EV8A 1VA8A 1N99A 4K76A 5JXBA 2Z9IA 3R68A 5HJ1A 2KOMA 1X45A 4K72A 2O2TA 3RL8A 2JIKA 5HFCA 1Y8TA 5E11A 1WFVA 2FCFA 2KJDA 1N7TA 2QKTA 4JOKA 3ID1A 5HEYA 1WHAA 1Q3OA 2D92A 2HE4A 3HPMA 1UEZA 1KY9A 1V6BA 1WH1A 1WHDA 2D8IA 2QG1A 2DM8A 2FE5A 1M5ZA 2CSSA 2HGAA 2KJKA 5HEBA 1OBYA 5H3JA 1WJLA 1WI2A 2EGOA 1UEPA 3HPKA 2YTWA 5E21A 3QGLA 2X7ZA 1UF1A 2DMZA 2G2LA 4JOPA 2DAZA 3CH8A 1U38A 1OBZA 2I0IA 2EDPA 2WL7A 4O06A 3FY5A 2EGKA 2M0TA 2FNEA 1N6DA 1U3BA 2UZCA 2PZDA 4K6YA 2KAWA 1WG6A 2I1NA 4JL7A 1IU0A 1NTEA 2E7KA 3CYYA 4NXPA 3E17A 3DJ3A 4Q3HA 2OS6A 5E22A 4FGMA 3SOEA 2JREA 1OBXA 3NFLA 2LA8A 2EEHA 1UJUA 3TSVA 4P0CA 2BYGA 2PKUA 1P1EA 3PV2A 2PKTA 3KHFA 2D90A 1V5QA 5HDYA 3CC0A 1YBOA 2I6VA 2RRMA 3VQGA 2F0AA 2ZPLA 1FCFA 4GVCA 2VWRA 2Q9VA 3JXTA 3O46A 3KZDA 4Q2OA 1RY4A 2YUYA 1TQ3A 1MFGA 3CBYA 3TSZA 4XHVA 4OEPA 2M0VA 2P3WA 1ZOKA 4OEOA 3DJAA 1NF3C 5FHTA 1W9EA 5EZ0A 2YT7A 4HOPA 3SFJA 3PDZA 2CSJA 2AWWA 5I7ZA 2EJYA 1X5QA 2R4HA 2VRFA 2PA1A 2I04A 1K32A 1T2MA 5G1DA 3LNYA 4Q2QA 5DTHA 3QE1A 1GM1A 3QDOA 5HF4A 1SOTA 2KPLA 1N6EA 2W4FA 5HETA 1U37A 3NFKA 1SOZA 4GVDA 3CBZA 2L4TA 4RI0A 2I4SA 1VB7A 3QIKA 2PDZA 1OZIA 1U39A 3R69A 2AWXA 2CS5A 5B6LA 1TE0A 2R3YA 2EDVA 4YDPA 2MHOA 3K50A 4E35A 1VJ6A 3CBXA 2YT8A 2QT5A 4JORA 4NMPA 4UU6A 2DLUA 4REYA 4HOPB 1KEFA 2OZFA 1IU2A 1N6FA 2LOBA 4Z33A 2KOJA 4K78A 3TSWA 1UEWA 2HE2A 2KBSA 2JWEA 3GDUA 4JOGA 5FB8C 5E1YA 2JXOA 1B8QA 1Z86A 2KJPA 1I16A 1UM1A 1WI4A 1W9QA 3GCNA 4NXQA 2M3MA 2OPGA 3MH4A 2F5YA 1D5GA 2H3LA 4OAJA 3GDVA 2IWQA 1LCYA 3AXAA 4KFWA 2REYA 5HFBA 2ENOA 4EDJA 2OQSA 2K20A 2DB5A 1UHPA 1N7FA 2VSPA 2EEJA 3GJ9A 1V5LA 2JOAA 3PV5A 4WYTA 3WKMA 5A2PA 2JINA 4Q2PA 1UITA 2RCZA 4Z8JA 1RZXA 1UEQA 2EDZA 3ID2A 1Z87A 2KPKA 3I1EA 2IWPA 2EGNA 2AWUA 4R2ZA 1V1TA 5HFEA 1RGWA 1I92A 2KV8A 4NNLA 4UU5A 2QKVA 2EAQA 1BE9A 2V1WA 3QJMA 3GGEA 1FC9A 2M0ZA 3PV4A 4JOEA 3LNXA 4F8KA 2DLSA 2IWOA 2DJTA 1X8SA 5HF1A 1IHJA 5HFFA 4PQWA 3WKLA 3DIWA 2H2BA 4P2AB 2LUIA 5G1EA 1FC6A 5GNDA 2AINA 2DC2A 2GZVA 1MFLA 2JILA 4N6XA 1ZUBA 1N7EA 3QO6A 4NMOA 3VQFA 4NMTA 2L4SA 2VSVA 1UM7A 1X6DA 1QLCA 1WF8A 3MH7A 2VPHA 4JOHA 4WYUA 5HFDA 1VAEA 1TP5A 2LC6A 3EGGC 3ZRTA 3B76A 2H2CA 3SHUA 1PDRA
chains in the Genus database with same CATH superfamily
4JOJA 3I18A 3RLEA 4Q2NA 1UJDA 2M0UA 4NXRA 2KL1A 1G9OA 1UFXA 2EHRA 2M10A 2W7RA 4Q6HA 2EEGA 1FC7A 4L8NA 1TP3A 1WF7A 3TMHA 3GSLA 4NMRA 2EXGA 1W9OA 3QJNA 1KWAA 2Q3GA 5GLJA 1R6JA 3O5NA 5EYZA 5D13A 2QKUA 1QAUA 4JJ3A 1P1DA 3OTPA 4JJ0A 2FN5A 3ID4A 5HEDA 3EGHC 3NGHA 4K75A 4IC6A 2KRGA 2KG2A 2KOHA 2L97A 4H11A 2ZPMA 1Q3PA 2OGPA 3PS4A 3SUZA 1XZ9A 4E34A 3ID3A 4KFVA 1GQ5A 1RGRA 4Q6SA 3I4WA 2KA9A 3GCOA 4NMSA 2IWNA 2Z17A 1QAVA 3K1RA 1VCWA 2MX6A 2G5MB 5F67A 4NMVA 2YUBA 1WIFA 2EEIA 2KYLA 1MC7A 3R0HA 1V62A 2H3MA 3RL7A 4GHNA 2VZ5A 2K1ZA 4NMQA 3K82A 3MH6A 4G69A 4AMHA 2DKRA 5F3XA 4JOFA 3DJ1A 3NCVA 4NNMA 3GDSA 3KZEA 3OU0A 1X5NA 1GQ4A 1BFEA 3STJA 4LMMA 1L6OA 2PNTA 2OCSA 3L4FD 3DORA 1Y7NA 4MPAA 2QBWA 2I0LA 3BPUA 1UJVA 3HVQC 3CS0A 4YYXA 4E3BA 2V90A 3SHWA 5E6PB 2OSGA 1X5RA 2LC7A 1Q7XA 3PDVA 2KQFA 1WFGA 2OMJA 1QAVB 2EV8A 1VA8A 1N99A 4K76A 5JXBA 2Z9IA 3R68A 5HJ1A 2KOMA 1X45A 4K72A 2O2TA 3RL8A 1X9ZA 2JIKA 5HFCA 1Y8TA 5E11A 1WFVA 2FCFA 2KJDA 1N7TA 2QKTA 4JOKA 3ID1A 5HEYA 1WHAA 1Q3OA 2D92A 2HE4A 3HPMA 1UEZA 1KY9A 1V6BA 1WH1A 1WHDA 2D8IA 2QG1A 2DM8A 2FE5A 1M5ZA 2CSSA 2HGAA 2KJKA 5HEBA 1OBYA 5H3JA 1WJLA 1WI2A 2EGOA 1UEPA 3HPKA 2YTWA 5E21A 3QGLA 2X7ZA 1UF1A 2DMZA 2G2LA 4JOPA 2DAZA 3CH8A 1U38A 1OBZA 2I0IA 2EDPA 2WL7A 4O06A 3FY5A 2EGKA 2M0TA 2FNEA 1N6DA 1U3BA 2UZCA 2PZDA 4K6YA 2KAWA 1WG6A 2I1NA 4JL7A 1IU0A 1NTEA 2E7KA 3CYYA 4NXPA 3E17A 3DJ3A 4Q3HA 2OS6A 5E22A 4FGMA 3SOEA 2JREA 1OBXA 3NFLA 2LA8A 2EEHA 1UJUA 3TSVA 4P0CA 2BYGA 2PKUA 1P1EA 3PV2A 2PKTA 3KHFA 2D90A 1V5QA 5HDYA 3CC0A 1YBOA 2I6VA 2RRMA 3VQGA 2F0AA 2ZPLA 1FCFA 4GVCA 2VWRA 2Q9VA 3JXTA 3O46A 3KZDA 4Q2OA 1RY4A 2YUYA 1TQ3A 3KDKA 1MFGA 3CBYA 3TSZA 4XHVA 4OEPA 2M0VA 2P3WA 5ILBA 1ZOKA 4OEOA 3DJAA 1NF3C 5FHTA 1W9EA 5EZ0A 2YT7A 4HOPA 3SFJA 3PDZA 2CSJA 2AWWA 5I7ZA 2EJYA 1X5QA 2R4HA 2VRFA 2PA1A 2I04A 1K32A 1T2MA 5G1DA 3LNYA 4Q2QA 5DTHA 3QE1A 1GM1A 3QDOA 5HF4A 1SOTA 2KPLA 1N6EA 2W4FA 5HETA 1U37A 3NFKA 1SOZA 4GVDA 3CBZA 2L4TA 4RI0A 2I4SA 1VB7A 3QIKA 2PDZA 2GEFA 1OZIA 1U39A 3R69A 2AWXA 2CS5A 5B6LA 1TE0A 2R3YA 2EDVA 4YDPA 2MHOA 3K50A 4E35A 1VJ6A 3CBXA 2YT8A 2QT5A 4JORA 4NMPA 4UU6A 2JSNA 2DLUA 4REYA 4HOPB 1KEFA 2OZFA 1IU2A 1N6FA 2LOBA 4Z33A 2KOJA 4K78A 3TSWA 1UEWA 2HE2A 2KBSA 5IL9A 2JWEA 3GDUA 4JOGA 5FB8C 5E1YA 2JXOA 1B8QA 1Z86A 2KJPA 1I16A 1UM1A 1WI4A 1W9QA 3GCNA 4NXQA 2M3MA 2OPGA 3KDGA 3MH4A 2F5YA 1D5GA 2H3LA 4OAJA 3GDVA 2IWQA 1LCYA 3AXAA 4KFWA 2REYA 4FLNA 5HFBA 2ENOA 4EDJA 2OQSA 2K20A 2DB5A 1UHPA 1N7FA 2VSPA 2EEJA 3GJ9A 1V5LA 2JOAA 3PV5A 4WYTA 3WKMA 5A2PA 2JINA 4Q2PA 1UITA 2RCZA 4Z8JA 1RZXA 1UEQA 2EDZA 3ID2A 1Z87A 2KPKA 3I1EA 2IWPA 2EGNA 2AWUA 4R2ZA 1V1TA 5HFEA 1RGWA 1I92A 2KV8A 4NNLA 4UU5A 2QKVA 2EAQA 1BE9A 2V1WA 3QJMA 3GGEA 1FC9A 2M0ZA 3GABA 3PV4A 4JOEA 3LNXA 4F8KA 2DLSA 2IWOA 5B42A 2DJTA 1X8SA 5HF1A 1IHJA 5HFFA 4PQWA 3WKLA 3DIWA 2H2BA 4P2AB 2LUIA 5G1EA 1FC6A 5GNDA 2AINA 2DC2A 2GZVA 1MFLA 2JILA 4N6XA 1ZUBA 1N7EA 3QO6A 4NMOA 3VQFA 4NMTA 2L4SA 2VSVA 1UM7A 1X6DA 1QLCA 1WF8A 3MH7A 2VPHA 4JOHA 4WYUA 5HFDA 1VAEA 1TP5A 2LC6A 3EGGC 3ZRTA 3B76A 2H2CA 3SHUA 1PDRA
chains in the Genus database with same CATH topology
4JOJA 3I18A 3RLEA 4Q2NA 1UJDA 2M0UA 4NXRA 2KL1A 1G9OA 1UFXA 2EHRA 2M10A 2W7RA 4Q6HA 2EEGA 1FC7A 4L8NA 1TP3A 1WF7A 3TMHA 3GSLA 4NMRA 2EXGA 1W9OA 3QJNA 1KWAA 2Q3GA 5GLJA 1R6JA 3O5NA 5EYZA 5D13A 2QKUA 1QAUA 4JJ3A 1P1DA 3OTPA 4JJ0A 2FN5A 3ID4A 5HEDA 3EGHC 3NGHA 4K75A 4IC6A 2KRGA 2KG2A 2KOHA 2L97A 4H11A 2ZPMA 1Q3PA 2OGPA 3PS4A 3SUZA 1XZ9A 4E34A 3ID3A 4KFVA 1GQ5A 1RGRA 4Q6SA 3I4WA 2KA9A 3GCOA 4NMSA 2IWNA 2Z17A 1QAVA 3K1RA 1VCWA 2MX6A 2G5MB 5F67A 4NMVA 2YUBA 1WIFA 2EEIA 2KYLA 1MC7A 3R0HA 1V62A 2H3MA 3RL7A 4GHNA 2VZ5A 2K1ZA 4NMQA 3K82A 3MH6A 4G69A 4AMHA 2DKRA 5F3XA 4JOFA 3DJ1A 3NCVA 4NNMA 3GDSA 3KZEA 3OU0A 1X5NA 1GQ4A 1BFEA 3STJA 4LMMA 1L6OA 2PNTA 2OCSA 3L4FD 3DORA 1Y7NA 4MPAA 2QBWA 2I0LA 3BPUA 1UJVA 3HVQC 3CS0A 4YYXA 4E3BA 2V90A 3SHWA 5E6PB 2OSGA 1X5RA 2LC7A 1Q7XA 3PDVA 2KQFA 1WFGA 2OMJA 1QAVB 2EV8A 1VA8A 1N99A 4K76A 5JXBA 2Z9IA 3R68A 5HJ1A 2KOMA 1X45A 4K72A 2O2TA 3RL8A 1X9ZA 2JIKA 5HFCA 1Y8TA 5E11A 1WFVA 2FCFA 2KJDA 1N7TA 2QKTA 4JOKA 3ID1A 5HEYA 1WHAA 1Q3OA 2D92A 2HE4A 3HPMA 1UEZA 1KY9A 1V6BA 1WH1A 1WHDA 2D8IA 2QG1A 2DM8A 2FE5A 1M5ZA 2CSSA 2HGAA 2KJKA 5HEBA 1OBYA 5H3JA 1WJLA 1WI2A 2EGOA 1UEPA 3HPKA 2YTWA 5E21A 3QGLA 2X7ZA 1UF1A 2DMZA 2G2LA 4JOPA 2DAZA 3CH8A 1U38A 1OBZA 2I0IA 2EDPA 2WL7A 4O06A 3FY5A 2EGKA 2M0TA 2FNEA 1N6DA 1U3BA 2UZCA 2PZDA 4K6YA 2KAWA 1WG6A 2I1NA 4JL7A 1IU0A 1NTEA 2E7KA 3CYYA 4NXPA 3E17A 3DJ3A 4Q3HA 2OS6A 5E22A 4FGMA 3SOEA 2JREA 1OBXA 3NFLA 2LA8A 2EEHA 1UJUA 3TSVA 4P0CA 2BYGA 2PKUA 1P1EA 3PV2A 2PKTA 3KHFA 2D90A 1V5QA 5HDYA 3CC0A 1YBOA 2I6VA 2RRMA 3VQGA 2F0AA 2ZPLA 1FCFA 4GVCA 2VWRA 2Q9VA 3JXTA 3O46A 3KZDA 4Q2OA 1RY4A 2YUYA 1TQ3A 3KDKA 1MFGA 3CBYA 3TSZA 4XHVA 4OEPA 2M0VA 2P3WA 5ILBA 1ZOKA 4OEOA 3DJAA 1NF3C 5FHTA 1W9EA 5EZ0A 2YT7A 4HOPA 3SFJA 3PDZA 2CSJA 2AWWA 5I7ZA 2EJYA 1X5QA 2R4HA 2VRFA 2PA1A 2I04A 1K32A 1T2MA 5G1DA 3LNYA 4Q2QA 5DTHA 3QE1A 1GM1A 3QDOA 5HF4A 1SOTA 2KPLA 1N6EA 2W4FA 5HETA 1U37A 3NFKA 1SOZA 4GVDA 3CBZA 2L4TA 4RI0A 2I4SA 1VB7A 3QIKA 2PDZA 2GEFA 1OZIA 1U39A 3R69A 2AWXA 2CS5A 5B6LA 1TE0A 2R3YA 2EDVA 4YDPA 2MHOA 3K50A 4E35A 1VJ6A 3CBXA 2YT8A 2QT5A 4JORA 4NMPA 4UU6A 2JSNA 2DLUA 4REYA 4HOPB 1KEFA 2OZFA 1IU2A 1N6FA 2LOBA 4Z33A 2KOJA 4K78A 3TSWA 1UEWA 2HE2A 2KBSA 5IL9A 2JWEA 3GDUA 4JOGA 5FB8C 5E1YA 2JXOA 1B8QA 1Z86A 2KJPA 1I16A 1UM1A 1WI4A 1W9QA 3GCNA 4NXQA 2M3MA 2OPGA 3KDGA 3MH4A 2F5YA 1D5GA 2H3LA 4OAJA 3GDVA 2IWQA 1LCYA 3AXAA 4KFWA 2REYA 4FLNA 5HFBA 2ENOA 4EDJA 2OQSA 2K20A 2DB5A 1UHPA 1N7FA 2VSPA 2EEJA 3GJ9A 1V5LA 2JOAA 3PV5A 4WYTA 3WKMA 5A2PA 2JINA 4Q2PA 1UITA 2RCZA 4Z8JA 1RZXA 1UEQA 2EDZA 3ID2A 1Z87A 2KPKA 3I1EA 2IWPA 2EGNA 2AWUA 4R2ZA 1V1TA 5HFEA 1RGWA 1I92A 2KV8A 4NNLA 4UU5A 2QKVA 2EAQA 1BE9A 2V1WA 3QJMA 3GGEA 1FC9A 2M0ZA 3GABA 3PV4A 4JOEA 3LNXA 4F8KA 2DLSA 2IWOA 5B42A 2DJTA 1X8SA 5HF1A 1IHJA 5HFFA 4PQWA 3WKLA 3DIWA 2H2BA 4P2AB 2LUIA 5G1EA 1FC6A 5GNDA 2AINA 2DC2A 2GZVA 1MFLA 2JILA 4N6XA 1ZUBA 1N7EA 3QO6A 4NMOA 3VQFA 4NMTA 2L4SA 2VSVA 1UM7A 1X6DA 1QLCA 1WF8A 3MH7A 2VPHA 4JOHA 4WYUA 5HFDA 1VAEA 1TP5A 2LC6A 3EGGC 3ZRTA 3B76A 2H2CA 3SHUA 1PDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOJ A;  3I18 A;  3RLE A;  4Q2N A;  1UJD A;  2M0U A;  4NXR A;  2KL1 A;  1G9O A;  1UFX A;  2EHR A;  2M10 A;  2W7R A;  4Q6H A;  2EEG A;  1FC7 A;  4L8N A;  1TP3 A;  1WF7 A;  3TMH A;  3GSL A;  4NMR A;  2EXG A;  1W9O A;  3QJN A;  1KWA A;  2Q3G A;  5GLJ A;  1R6J A;  3O5N A;  5EYZ A;  5D13 A;  2QKU A;  1QAU A;  1P1D A;  3OTP A;  2FN5 A;  3ID4 A;  5HED A;  3EGH C;  3NGH A;  4K75 A;  4IC6 A;  2KRG A;  2KG2 A;  2KOH A;  2L97 A;  4H11 A;  2ZPM A;  1Q3P A;  2OGP A;  3PS4 A;  3SUZ A;  1XZ9 A;  4E34 A;  3ID3 A;  4KFV A;  1GQ5 A;  1RGR A;  4Q6S A;  3I4W A;  2KA9 A;  3GCO A;  4NMS A;  2IWN A;  2Z17 A;  1QAV A;  3K1R A;  1VCW A;  2MX6 A;  2G5M B;  5F67 A;  4NMV A;  2YUB A;  1WIF A;  2EEI A;  2KYL A;  1MC7 A;  3R0H A;  1V62 A;  2H3M A;  3RL7 A;  4GHN A;  2VZ5 A;  2K1Z A;  4NMQ A;  3K82 A;  3MH6 A;  4G69 A;  4AMH A;  2DKR A;  5F3X A;  4JOF A;  3DJ1 A;  4NNM A;  3GDS A;  3KZE A;  3OU0 A;  1X5N A;  1GQ4 A;  1BFE A;  3STJ A;  4LMM A;  1L6O A;  2PNT A;  2OCS A;  3L4F D;  3DOR A;  1Y7N A;  4MPA A;  2QBW A;  2I0L A;  3BPU A;  1UJV A;  3HVQ C;  3CS0 A;  4YYX A;  4E3B A;  2V90 A;  3SHW A;  5E6P B;  2OSG A;  1X5R A;  2LC7 A;  1Q7X A;  3PDV A;  2KQF A;  1WFG A;  2OMJ A;  1QAV B;  2EV8 A;  1VA8 A;  1N99 A;  4K76 A;  5JXB A;  2Z9I A;  3R68 A;  5HJ1 A;  2KOM A;  1X45 A;  4K72 A;  2O2T A;  3RL8 A;  2JIK A;  5HFC A;  1Y8T A;  5E11 A;  1WFV A;  2FCF A;  2KJD A;  1N7T A;  2QKT A;  4JOK A;  3ID1 A;  5HEY A;  1WHA A;  1Q3O A;  2D92 A;  2HE4 A;  3HPM A;  1UEZ A;  1KY9 A;  1V6B A;  1WH1 A;  1WHD A;  2D8I A;  2QG1 A;  2DM8 A;  2FE5 A;  1M5Z A;  2CSS A;  2HGA A;  2KJK A;  5HEB A;  1OBY A;  5H3J A;  1WJL A;  1WI2 A;  2EGO A;  1UEP A;  3HPK A;  2YTW A;  5E21 A;  3QGL A;  2X7Z A;  1UF1 A;  2DMZ A;  2G2L A;  4JOP A;  2DAZ A;  3CH8 A;  1U38 A;  1OBZ A;  2I0I A;  2EDP A;  2WL7 A;  4O06 A;  3FY5 A;  2EGK A;  2M0T A;  2FNE A;  1N6D A;  1U3B A;  2UZC A;  2PZD A;  4K6Y A;  2KAW A;  1WG6 A;  2I1N A;  4JL7 A;  1IU0 A;  1NTE A;  2E7K A;  3CYY A;  4NXP A;  3E17 A;  3DJ3 A;  4Q3H A;  2OS6 A;  5E22 A;  4FGM A;  3SOE A;  2JRE A;  1OBX A;  3NFL A;  2LA8 A;  2EEH A;  1UJU A;  3TSV A;  4P0C A;  2BYG A;  2PKU A;  1P1E A;  3PV2 A;  2PKT A;  3KHF A;  2D90 A;  1V5Q A;  5HDY A;  3CC0 A;  1YBO A;  2I6V A;  2RRM A;  3VQG A;  2F0A A;  2ZPL A;  1FCF A;  4GVC A;  2VWR A;  2Q9V A;  3JXT A;  3O46 A;  3KZD A;  4Q2O A;  1RY4 A;  2YUY A;  1TQ3 A;  1MFG A;  3CBY A;  3TSZ A;  4XHV A;  4OEP A;  2M0V A;  2P3W A;  1ZOK A;  4OEO A;  3DJA A;  1NF3 C;  5FHT A;  1W9E A;  5EZ0 A;  2YT7 A;  4HOP A;  3SFJ A;  3PDZ A;  2CSJ A;  2AWW A;  5I7Z A;  2EJY A;  1X5Q A;  2R4H A;  2VRF A;  2PA1 A;  2I04 A;  1K32 A;  1T2M A;  5G1D A;  3LNY A;  4Q2Q A;  5DTH A;  3QE1 A;  1GM1 A;  3QDO A;  5HF4 A;  1SOT A;  2KPL A;  1N6E A;  2W4F A;  5HET A;  1U37 A;  3NFK A;  1SOZ A;  4GVD A;  3CBZ A;  2L4T A;  4RI0 A;  2I4S A;  1VB7 A;  3QIK A;  2PDZ A;  1OZI A;  1U39 A;  3R69 A;  2AWX A;  2CS5 A;  5B6L A;  1TE0 A;  2R3Y A;  2EDV A;  4YDP A;  2MHO A;  3K50 A;  4E35 A;  1VJ6 A;  3CBX A;  2YT8 A;  2QT5 A;  4JOR A;  4NMP A;  4UU6 A;  2DLU A;  4REY A;  4HOP B;  1KEF A;  2OZF A;  1IU2 A;  1N6F A;  2LOB A;  4Z33 A;  2KOJ A;  4K78 A;  3TSW A;  1UEW A;  2HE2 A;  2KBS A;  2JWE A;  3GDU A;  4JOG A;  5FB8 C;  5E1Y A;  2JXO A;  1B8Q A;  1Z86 A;  2KJP A;  1I16 A;  1UM1 A;  1WI4 A;  1W9Q A;  3GCN A;  4NXQ A;  2M3M A;  2OPG A;  3MH4 A;  2F5Y A;  1D5G A;  2H3L A;  4OAJ A;  3GDV A;  2IWQ A;  1LCY A;  3AXA A;  4KFW A;  2REY A;  5HFB A;  2ENO A;  4EDJ A;  2OQS A;  2K20 A;  2DB5 A;  1UHP A;  1N7F A;  2VSP A;  2EEJ A;  3GJ9 A;  1V5L A;  2JOA A;  3PV5 A;  4WYT A;  3WKM A;  5A2P A;  2JIN A;  4Q2P A;  1UIT A;  2RCZ A;  4Z8J A;  1RZX A;  1UEQ A;  2EDZ A;  3ID2 A;  1Z87 A;  2KPK A;  3I1E A;  2IWP A;  2EGN A;  2AWU A;  4R2Z A;  1V1T A;  5HFE A;  1RGW A;  1I92 A;  2KV8 A;  4NNL A;  4UU5 A;  2QKV A;  2EAQ A;  1BE9 A;  2V1W A;  3QJM A;  3GGE A;  1FC9 A;  2M0Z A;  3PV4 A;  4JOE A;  3LNX A;  4F8K A;  2DLS A;  2IWO A;  2DJT A;  1X8S A;  5HF1 A;  1IHJ A;  5HFF A;  4PQW A;  3WKL A;  3DIW A;  2H2B A;  4P2A B;  2LUI A;  5G1E A;  1FC6 A;  5GND A;  2AIN A;  2DC2 A;  2GZV A;  1MFL A;  2JIL A;  4N6X A;  1ZUB A;  1N7E A;  3QO6 A;  4NMO A;  3VQF A;  4NMT A;  2L4S A;  2VSV A;  1UM7 A;  1X6D A;  1QLC A;  1WF8 A;  3MH7 A;  2VPH A;  4JOH A;  4WYU A;  5HFD A;  1VAE A;  1TP5 A;  2LC6 A;  3EGG C;  3ZRT A;  3B76 A;  2H2C A;  3SHU A;  1PDR A; 
#chains in the Genus database with same CATH topology
 4JOJ A;  3I18 A;  3RLE A;  4Q2N A;  1UJD A;  2M0U A;  4NXR A;  2KL1 A;  1G9O A;  1UFX A;  2EHR A;  2M10 A;  2W7R A;  4Q6H A;  2EEG A;  1FC7 A;  4L8N A;  1TP3 A;  1WF7 A;  3TMH A;  3GSL A;  4NMR A;  2EXG A;  1W9O A;  3QJN A;  1KWA A;  2Q3G A;  5GLJ A;  1R6J A;  3O5N A;  5EYZ A;  5D13 A;  2QKU A;  1QAU A;  4JJ3 A;  1P1D A;  3OTP A;  4JJ0 A;  2FN5 A;  3ID4 A;  5HED A;  3EGH C;  3NGH A;  4K75 A;  4IC6 A;  2KRG A;  2KG2 A;  2KOH A;  2L97 A;  4H11 A;  2ZPM A;  1Q3P A;  2OGP A;  3PS4 A;  3SUZ A;  1XZ9 A;  4E34 A;  3ID3 A;  4KFV A;  1GQ5 A;  1RGR A;  4Q6S A;  3I4W A;  2KA9 A;  3GCO A;  4NMS A;  2IWN A;  2Z17 A;  1QAV A;  3K1R A;  1VCW A;  2MX6 A;  2G5M B;  5F67 A;  4NMV A;  2YUB A;  1WIF A;  2EEI A;  2KYL A;  1MC7 A;  3R0H A;  1V62 A;  2H3M A;  3RL7 A;  4GHN A;  2VZ5 A;  2K1Z A;  4NMQ A;  3K82 A;  3MH6 A;  4G69 A;  4AMH A;  2DKR A;  5F3X A;  4JOF A;  3DJ1 A;  3NCV A;  4NNM A;  3GDS A;  3KZE A;  3OU0 A;  1X5N A;  1GQ4 A;  1BFE A;  3STJ A;  4LMM A;  1L6O A;  2PNT A;  2OCS A;  3L4F D;  3DOR A;  1Y7N A;  4MPA A;  2QBW A;  2I0L A;  3BPU A;  1UJV A;  3HVQ C;  3CS0 A;  4YYX A;  4E3B A;  2V90 A;  3SHW A;  5E6P B;  2OSG A;  1X5R A;  2LC7 A;  1Q7X A;  3PDV A;  2KQF A;  1WFG A;  2OMJ A;  1QAV B;  2EV8 A;  1VA8 A;  1N99 A;  4K76 A;  5JXB A;  2Z9I A;  3R68 A;  5HJ1 A;  2KOM A;  1X45 A;  4K72 A;  2O2T A;  3RL8 A;  1X9Z A;  2JIK A;  5HFC A;  1Y8T A;  5E11 A;  1WFV A;  2FCF A;  2KJD A;  1N7T A;  2QKT A;  4JOK A;  3ID1 A;  5HEY A;  1WHA A;  1Q3O A;  2D92 A;  2HE4 A;  3HPM A;  1UEZ A;  1KY9 A;  1V6B A;  1WH1 A;  1WHD A;  2D8I A;  2QG1 A;  2DM8 A;  2FE5 A;  1M5Z A;  2CSS A;  2HGA A;  2KJK A;  5HEB A;  1OBY A;  5H3J A;  1WJL A;  1WI2 A;  2EGO A;  1UEP A;  3HPK A;  2YTW A;  5E21 A;  3QGL A;  2X7Z A;  1UF1 A;  2DMZ A;  2G2L A;  4JOP A;  2DAZ A;  3CH8 A;  1U38 A;  1OBZ A;  2I0I A;  2EDP A;  2WL7 A;  4O06 A;  3FY5 A;  2EGK A;  2M0T A;  2FNE A;  1N6D A;  1U3B A;  2UZC A;  2PZD A;  4K6Y A;  2KAW A;  1WG6 A;  2I1N A;  4JL7 A;  1IU0 A;  1NTE A;  2E7K A;  3CYY A;  4NXP A;  3E17 A;  3DJ3 A;  4Q3H A;  2OS6 A;  5E22 A;  4FGM A;  3SOE A;  2JRE A;  1OBX A;  3NFL A;  2LA8 A;  2EEH A;  1UJU A;  3TSV A;  4P0C A;  2BYG A;  2PKU A;  1P1E A;  3PV2 A;  2PKT A;  3KHF A;  2D90 A;  1V5Q A;  5HDY A;  3CC0 A;  1YBO A;  2I6V A;  2RRM A;  3VQG A;  2F0A A;  2ZPL A;  1FCF A;  4GVC A;  2VWR A;  2Q9V A;  3JXT A;  3O46 A;  3KZD A;  4Q2O A;  1RY4 A;  2YUY A;  1TQ3 A;  3KDK A;  1MFG A;  3CBY A;  3TSZ A;  4XHV A;  4OEP A;  2M0V A;  2P3W A;  5ILB A;  1ZOK A;  4OEO A;  3DJA A;  1NF3 C;  5FHT A;  1W9E A;  5EZ0 A;  2YT7 A;  4HOP A;  3SFJ A;  3PDZ A;  2CSJ A;  2AWW A;  5I7Z A;  2EJY A;  1X5Q A;  2R4H A;  2VRF A;  2PA1 A;  2I04 A;  1K32 A;  1T2M A;  5G1D A;  3LNY A;  4Q2Q A;  5DTH A;  3QE1 A;  1GM1 A;  3QDO A;  5HF4 A;  1SOT A;  2KPL A;  1N6E A;  2W4F A;  5HET A;  1U37 A;  3NFK A;  1SOZ A;  4GVD A;  3CBZ A;  2L4T A;  4RI0 A;  2I4S A;  1VB7 A;  3QIK A;  2PDZ A;  2GEF A;  1OZI A;  1U39 A;  3R69 A;  2AWX A;  2CS5 A;  5B6L A;  1TE0 A;  2R3Y A;  2EDV A;  4YDP A;  2MHO A;  3K50 A;  4E35 A;  1VJ6 A;  3CBX A;  2YT8 A;  2QT5 A;  4JOR A;  4NMP A;  4UU6 A;  2JSN A;  2DLU A;  4REY A;  4HOP B;  1KEF A;  2OZF A;  1IU2 A;  1N6F A;  2LOB A;  4Z33 A;  2KOJ A;  4K78 A;  3TSW A;  1UEW A;  2HE2 A;  2KBS A;  5IL9 A;  2JWE A;  3GDU A;  4JOG A;  5FB8 C;  5E1Y A;  2JXO A;  1B8Q A;  1Z86 A;  2KJP A;  1I16 A;  1UM1 A;  1WI4 A;  1W9Q A;  3GCN A;  4NXQ A;  2M3M A;  2OPG A;  3KDG A;  3MH4 A;  2F5Y A;  1D5G A;  2H3L A;  4OAJ A;  3GDV A;  2IWQ A;  1LCY A;  3AXA A;  4KFW A;  2REY A;  4FLN A;  5HFB A;  2ENO A;  4EDJ A;  2OQS A;  2K20 A;  2DB5 A;  1UHP A;  1N7F A;  2VSP A;  2EEJ A;  3GJ9 A;  1V5L A;  2JOA A;  3PV5 A;  4WYT A;  3WKM A;  5A2P A;  2JIN A;  4Q2P A;  1UIT A;  2RCZ A;  4Z8J A;  1RZX A;  1UEQ A;  2EDZ A;  3ID2 A;  1Z87 A;  2KPK A;  3I1E A;  2IWP A;  2EGN A;  2AWU A;  4R2Z A;  1V1T A;  5HFE A;  1RGW A;  1I92 A;  2KV8 A;  4NNL A;  4UU5 A;  2QKV A;  2EAQ A;  1BE9 A;  2V1W A;  3QJM A;  3GGE A;  1FC9 A;  2M0Z A;  3GAB A;  3PV4 A;  4JOE A;  3LNX A;  4F8K A;  2DLS A;  2IWO A;  5B42 A;  2DJT A;  1X8S A;  5HF1 A;  1IHJ A;  5HFF A;  4PQW A;  3WKL A;  3DIW A;  2H2B A;  4P2A B;  2LUI A;  5G1E A;  1FC6 A;  5GND A;  2AIN A;  2DC2 A;  2GZV A;  1MFL A;  2JIL A;  4N6X A;  1ZUB A;  1N7E A;  3QO6 A;  4NMO A;  3VQF A;  4NMT A;  2L4S A;  2VSV A;  1UM7 A;  1X6D A;  1QLC A;  1WF8 A;  3MH7 A;  2VPH A;  4JOH A;  4WYU A;  5HFD A;  1VAE A;  1TP5 A;  2LC6 A;  3EGG C;  3ZRT A;  3B76 A;  2H2C A;  3SHU A;  1PDR A; 
#chains in the Genus database with same CATH homology
 4JOJ A;  3I18 A;  3RLE A;  4Q2N A;  1UJD A;  2M0U A;  4NXR A;  2KL1 A;  1G9O A;  1UFX A;  2EHR A;  2M10 A;  2W7R A;  4Q6H A;  2EEG A;  1FC7 A;  4L8N A;  1TP3 A;  1WF7 A;  3TMH A;  3GSL A;  4NMR A;  2EXG A;  1W9O A;  3QJN A;  1KWA A;  2Q3G A;  5GLJ A;  1R6J A;  3O5N A;  5EYZ A;  5D13 A;  2QKU A;  1QAU A;  4JJ3 A;  1P1D A;  3OTP A;  4JJ0 A;  2FN5 A;  3ID4 A;  5HED A;  3EGH C;  3NGH A;  4K75 A;  4IC6 A;  2KRG A;  2KG2 A;  2KOH A;  2L97 A;  4H11 A;  2ZPM A;  1Q3P A;  2OGP A;  3PS4 A;  3SUZ A;  1XZ9 A;  4E34 A;  3ID3 A;  4KFV A;  1GQ5 A;  1RGR A;  4Q6S A;  3I4W A;  2KA9 A;  3GCO A;  4NMS A;  2IWN A;  2Z17 A;  1QAV A;  3K1R A;  1VCW A;  2MX6 A;  2G5M B;  5F67 A;  4NMV A;  2YUB A;  1WIF A;  2EEI A;  2KYL A;  1MC7 A;  3R0H A;  1V62 A;  2H3M A;  3RL7 A;  4GHN A;  2VZ5 A;  2K1Z A;  4NMQ A;  3K82 A;  3MH6 A;  4G69 A;  4AMH A;  2DKR A;  5F3X A;  4JOF A;  3DJ1 A;  3NCV A;  4NNM A;  3GDS A;  3KZE A;  3OU0 A;  1X5N A;  1GQ4 A;  1BFE A;  3STJ A;  4LMM A;  1L6O A;  2PNT A;  2OCS A;  3L4F D;  3DOR A;  1Y7N A;  4MPA A;  2QBW A;  2I0L A;  3BPU A;  1UJV A;  3HVQ C;  3CS0 A;  4YYX A;  4E3B A;  2V90 A;  3SHW A;  5E6P B;  2OSG A;  1X5R A;  2LC7 A;  1Q7X A;  3PDV A;  2KQF A;  1WFG A;  2OMJ A;  1QAV B;  2EV8 A;  1VA8 A;  1N99 A;  4K76 A;  5JXB A;  2Z9I A;  3R68 A;  5HJ1 A;  2KOM A;  1X45 A;  4K72 A;  2O2T A;  3RL8 A;  1X9Z A;  2JIK A;  5HFC A;  1Y8T A;  5E11 A;  1WFV A;  2FCF A;  2KJD A;  1N7T A;  2QKT A;  4JOK A;  3ID1 A;  5HEY A;  1WHA A;  1Q3O A;  2D92 A;  2HE4 A;  3HPM A;  1UEZ A;  1KY9 A;  1V6B A;  1WH1 A;  1WHD A;  2D8I A;  2QG1 A;  2DM8 A;  2FE5 A;  1M5Z A;  2CSS A;  2HGA A;  2KJK A;  5HEB A;  1OBY A;  5H3J A;  1WJL A;  1WI2 A;  2EGO A;  1UEP A;  3HPK A;  2YTW A;  5E21 A;  3QGL A;  2X7Z A;  1UF1 A;  2DMZ A;  2G2L A;  4JOP A;  2DAZ A;  3CH8 A;  1U38 A;  1OBZ A;  2I0I A;  2EDP A;  2WL7 A;  4O06 A;  3FY5 A;  2EGK A;  2M0T A;  2FNE A;  1N6D A;  1U3B A;  2UZC A;  2PZD A;  4K6Y A;  2KAW A;  1WG6 A;  2I1N A;  4JL7 A;  1IU0 A;  1NTE A;  2E7K A;  3CYY A;  4NXP A;  3E17 A;  3DJ3 A;  4Q3H A;  2OS6 A;  5E22 A;  4FGM A;  3SOE A;  2JRE A;  1OBX A;  3NFL A;  2LA8 A;  2EEH A;  1UJU A;  3TSV A;  4P0C A;  2BYG A;  2PKU A;  1P1E A;  3PV2 A;  2PKT A;  3KHF A;  2D90 A;  1V5Q A;  5HDY A;  3CC0 A;  1YBO A;  2I6V A;  2RRM A;  3VQG A;  2F0A A;  2ZPL A;  1FCF A;  4GVC A;  2VWR A;  2Q9V A;  3JXT A;  3O46 A;  3KZD A;  4Q2O A;  1RY4 A;  2YUY A;  1TQ3 A;  3KDK A;  1MFG A;  3CBY A;  3TSZ A;  4XHV A;  4OEP A;  2M0V A;  2P3W A;  5ILB A;  1ZOK A;  4OEO A;  3DJA A;  1NF3 C;  5FHT A;  1W9E A;  5EZ0 A;  2YT7 A;  4HOP A;  3SFJ A;  3PDZ A;  2CSJ A;  2AWW A;  5I7Z A;  2EJY A;  1X5Q A;  2R4H A;  2VRF A;  2PA1 A;  2I04 A;  1K32 A;  1T2M A;  5G1D A;  3LNY A;  4Q2Q A;  5DTH A;  3QE1 A;  1GM1 A;  3QDO A;  5HF4 A;  1SOT A;  2KPL A;  1N6E A;  2W4F A;  5HET A;  1U37 A;  3NFK A;  1SOZ A;  4GVD A;  3CBZ A;  2L4T A;  4RI0 A;  2I4S A;  1VB7 A;  3QIK A;  2PDZ A;  2GEF A;  1OZI A;  1U39 A;  3R69 A;  2AWX A;  2CS5 A;  5B6L A;  1TE0 A;  2R3Y A;  2EDV A;  4YDP A;  2MHO A;  3K50 A;  4E35 A;  1VJ6 A;  3CBX A;  2YT8 A;  2QT5 A;  4JOR A;  4NMP A;  4UU6 A;  2JSN A;  2DLU A;  4REY A;  4HOP B;  1KEF A;  2OZF A;  1IU2 A;  1N6F A;  2LOB A;  4Z33 A;  2KOJ A;  4K78 A;  3TSW A;  1UEW A;  2HE2 A;  2KBS A;  5IL9 A;  2JWE A;  3GDU A;  4JOG A;  5FB8 C;  5E1Y A;  2JXO A;  1B8Q A;  1Z86 A;  2KJP A;  1I16 A;  1UM1 A;  1WI4 A;  1W9Q A;  3GCN A;  4NXQ A;  2M3M A;  2OPG A;  3KDG A;  3MH4 A;  2F5Y A;  1D5G A;  2H3L A;  4OAJ A;  3GDV A;  2IWQ A;  1LCY A;  3AXA A;  4KFW A;  2REY A;  4FLN A;  5HFB A;  2ENO A;  4EDJ A;  2OQS A;  2K20 A;  2DB5 A;  1UHP A;  1N7F A;  2VSP A;  2EEJ A;  3GJ9 A;  1V5L A;  2JOA A;  3PV5 A;  4WYT A;  3WKM A;  5A2P A;  2JIN A;  4Q2P A;  1UIT A;  2RCZ A;  4Z8J A;  1RZX A;  1UEQ A;  2EDZ A;  3ID2 A;  1Z87 A;  2KPK A;  3I1E A;  2IWP A;  2EGN A;  2AWU A;  4R2Z A;  1V1T A;  5HFE A;  1RGW A;  1I92 A;  2KV8 A;  4NNL A;  4UU5 A;  2QKV A;  2EAQ A;  1BE9 A;  2V1W A;  3QJM A;  3GGE A;  1FC9 A;  2M0Z A;  3GAB A;  3PV4 A;  4JOE A;  3LNX A;  4F8K A;  2DLS A;  2IWO A;  5B42 A;  2DJT A;  1X8S A;  5HF1 A;  1IHJ A;  5HFF A;  4PQW A;  3WKL A;  3DIW A;  2H2B A;  4P2A B;  2LUI A;  5G1E A;  1FC6 A;  5GND A;  2AIN A;  2DC2 A;  2GZV A;  1MFL A;  2JIL A;  4N6X A;  1ZUB A;  1N7E A;  3QO6 A;  4NMO A;  3VQF A;  4NMT A;  2L4S A;  2VSV A;  1UM7 A;  1X6D A;  1QLC A;  1WF8 A;  3MH7 A;  2VPH A;  4JOH A;  4WYU A;  5HFD A;  1VAE A;  1TP5 A;  2LC6 A;  3EGG C;  3ZRT A;  3B76 A;  2H2C A;  3SHU A;  1PDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...