3DJ3A

Crystal structure of c-terminal truncated tip-1 (6-113)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
b'VVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 3
publication title Structural Basis of beta-Catenin Recognition by Tax-interacting Protein-1
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 23
structure length 100
sequence length 100
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3dj3A00
4JORA 2CSSA 1KWAA 3ID2A 1X45A 2DLSA 5EZ0A 2VRFA 1V1TA 3K82A 3GCNA 4UU5A 3LNXA 2EDZA 1Q3OA 2EGOA 3QE1A 5F3XA 2BYGA 2M0TA 2DB5A 1MFGA 3QIKA 4GVCA 2FNEA 5HF1A 3WKMA 3K1RA 4YDPA 4NMTA 3CC0A 1WJLA 2EDPA 4NXRA 3CYYA 3CBXA 2HE2A 2WL7A 4E35A 3TSZA 2DM8A 3HVQC 4HOPA 5I7ZA 1RY4A 2FN5A 1FC7A 1RGWA 1UEPA 1YBOA 2KAWA 2YT8A 3NGHA 3GDVA 1X5NA 3KHFA 1GM1A 2AWXA 2OMJA 2VSVA 1QAVB 4Z8JA 1GQ5A 4WYTA 1N6FA 3AXAA 2ZPLA 2KQFA 1UITA 5D13A 2IWQA 4JOHA 4P0CA 5GNDA 2K1ZA 2OQSA 2REYA 3O46A 3GDUA 1WI2A 1UEWA 2VWRA 3PS4A 2PKTA 3GCOA 5FB8C 1N7TA 2I4SA 1WIFA 5HFDA 2R4HA 3SUZA 3PV4A 4NMVA 2H3LA 2OPGA 2EV8A 1I92A 3ID1A 2YT7A 1TP3A 3B76A 1UJUA 4JOFA 5HF4A 1G9OA 2R3YA 5JXBA 3OU0A 4JOJA 3I4WA 1WHDA 2LUIA 2I04A 1Z86A 4G69A 2LA8A 2IWPA 2YUYA 4XHVA 2UZCA 4RI0A 3VQGA 2W7RA 1D5GA 3STJA 2DKRA 3BPUA 2G2LA 3WKLA 5G1EA 1QAVA 4H11A 1Y8TA 2M10A 3CBYA 1NF3C 2EXGA 2KOHA 3HPKA 2EJYA 2MX6A 2E7KA 2DAZA 3SHWA 2Q9VA 4LMMA 2VPHA 4L8NA 1N7FA 1WI4A 1BFEA 4NMRA 1TE0A 1UHPA 2OGPA 3RL8A 1WH1A 3K50A 2L97A 4MPAA 1V6BA 2RRMA 3MH7A 2I0LA 2KOJA 1FC9A 1UJDA 3FY5A 2KL1A 4O06A 3R0HA 1U37A 2QKVA 5E11A 1RZXA 4EDJA 5HJ1A 3DIWA 3JXTA 2JOAA 2DJTA 4JOKA 2JREA 4NMQA 4REYA 2IWOA 1OBYA 5HEDA 1W9EA 4IC6A 1QAUA 4OEOA 5HEBA 2M0ZA 3PV2A 4GVDA 3CH8A 2P3WA 2JWEA 1V5LA 2HE4A 1N6EA 1WFGA 2KRGA 4NMSA 4KFVA 1N99A 3VQFA 1UFXA 4GHNA 4JOPA 5A2PA 2VZ5A 3PV5A 1Y7NA 4JL7A 4Q2PA 1LCYA 2L4SA 2JILA 2AINA 1X8SA 3PDVA 3QO6A 1W9OA 2KG2A 1X6DA 2O2TA 4K75A 2D8IA 3GJ9A 2LC7A 2MHOA 1P1EA 1OZIA 4UU6A 1OBZA 4Q6SA 1Z87A 3QGLA 2QBWA 4PQWA 4JOEA 1UM1A 3O5NA 2RCZA 2AWUA 3TSWA 1OBXA 2F5YA 5B6LA 2HGAA 3NFLA 3PDZA 3GDSA 2KJKA 2QT5A 4K72A 4YYXA 4NXPA 1UM7A 2QG1A 2KBSA 1WHAA 2EEGA 4NNMA 2YUBA 3DORA 2M0VA 1V5QA 2JXOA 4FGMA 2H2BA 3RLEA 2D90A 3MH4A 2PZDA 3SHUA 3CBZA 1KEFA 1NTEA 3KZDA 2OS6A 1Q7XA 2W4FA 1ZUBA 3QDOA 3TSVA 3GSLA 2PKUA 4HOPB 1XZ9A 4F8KA 4Q2QA 1B8QA 5HEYA 1ZOKA 2DLUA 3HPMA 1P1DA 2EEIA 3QJNA 4Q3HA 3GGEA 1SOTA 1X5QA 2EAQA 1R6JA 1V62A 3I1EA 3DJ3A 4Z33A 3DJAA 4K76A 3SOEA 1WF8A 2F0AA 1IU2A 4P2AB 1WG6A 1VA8A 5E1YA 2GZVA 3ID3A 2Z9IA 2KA9A 2OSGA 3TMHA 2ZPMA 3ID4A 2CSJA 2KOMA 2VSPA 4Q2NA 5EYZA 1PDRA 1VJ6A 1W9QA 2CS5A 3L4FD 2M3MA 4Q2OA 4E34A 2H3MA 5F67A 3LNYA 1X5RA 2Q3GA 2KJDA 5E22A 3ZRTA 1RGRA 2IWNA 2EGNA 2FCFA 1U39A 5HFFA 4NMOA 5E6PB 2G5MB 2QKUA 5HFEA 5HFBA 2EEHA 3I18A 4R2ZA 2LOBA 4NNLA 3KZEA 4NXQA 2LC6A 2H2CA 3R69A 2V90A 5GLJA 1L6OA 2ENOA 3EGHC 4KFWA 1TP5A 2I1NA 1M5ZA 1VB7A 2KJPA 1MFLA 1VCWA 3QJMA 3CS0A 1U3BA 1KY9A 4OEPA 2KYLA 2PA1A 1K32A 1I16A 4K6YA 1QLCA 3NFKA 5DTHA 2PDZA 4E3BA 1N6DA 4WYUA 3OTPA 4Q6HA 4AMHA 1UEQA 4K78A 2KPKA 2AWWA 1Q3PA 1U38A 2KPLA 4OAJA 4JOGA 1IHJA 2FE5A 2I6VA 1TQ3A 5G1DA 3EGGC 2I0IA 5FHTA 2V1WA 5HDYA 2QKTA 2YTWA 2EEJA 2DC2A 1GQ4A 1FC6A 3RL7A 1VAEA 3DJ1A 1IU0A 2M0UA 2EDVA 2DMZA 1WFVA 1MC7A 2EGKA 3E17A 2JINA 5HETA 2PNTA 3R68A 4NMPA 3SFJA 1FCFA 2D92A 1UJVA 2L4TA 2OCSA 2EHRA 4N6XA 3MH6A 5E21A 1BE9A 1T2MA 1UF1A 1WF7A 2JIKA 5H3JA 1SOZA 2K20A 2Z17A 5HFCA 2X7ZA 1UEZA 1N7EA 2OZFA 2KV8A
chains in the Genus database with same CATH superfamily
4JORA 2CSSA 1KWAA 3ID2A 1X45A 2DLSA 5EZ0A 2VRFA 1V1TA 3K82A 3GCNA 4UU5A 3LNXA 2EDZA 1Q3OA 2EGOA 3QE1A 5F3XA 2BYGA 2M0TA 2DB5A 1MFGA 3QIKA 4GVCA 2FNEA 5HF1A 3WKMA 3K1RA 4YDPA 4NMTA 3CC0A 1WJLA 2EDPA 4NXRA 3CYYA 3CBXA 2HE2A 2WL7A 4E35A 3TSZA 2DM8A 3HVQC 4HOPA 5I7ZA 4JJ3A 1RY4A 2FN5A 1FC7A 1RGWA 1UEPA 1YBOA 2KAWA 2YT8A 3NGHA 3GDVA 1X5NA 5ILBA 3KHFA 1GM1A 2AWXA 2OMJA 2VSVA 1QAVB 2GEFA 4Z8JA 1GQ5A 4WYTA 1N6FA 4FLNA 3AXAA 2ZPLA 2KQFA 1UITA 5D13A 2IWQA 4JOHA 4P0CA 5GNDA 2K1ZA 2OQSA 2REYA 3O46A 3GDUA 1WI2A 1UEWA 2VWRA 3PS4A 2PKTA 3GCOA 5FB8C 1N7TA 2I4SA 1WIFA 5HFDA 2R4HA 3SUZA 3PV4A 4NMVA 2H3LA 2OPGA 2EV8A 1I92A 3ID1A 2YT7A 1TP3A 3B76A 1UJUA 4JOFA 5HF4A 1G9OA 1X9ZA 2R3YA 5JXBA 3OU0A 4JOJA 3I4WA 1WHDA 2LUIA 2I04A 1Z86A 4G69A 2LA8A 2IWPA 2YUYA 4XHVA 2UZCA 4RI0A 3VQGA 2W7RA 1D5GA 3STJA 2DKRA 3BPUA 2G2LA 3WKLA 5G1EA 1QAVA 4H11A 1Y8TA 2M10A 3CBYA 1NF3C 2EXGA 2KOHA 3HPKA 2EJYA 2MX6A 2E7KA 2DAZA 4JJ0A 3SHWA 2Q9VA 4LMMA 2VPHA 4L8NA 1N7FA 1WI4A 1BFEA 4NMRA 1TE0A 1UHPA 2OGPA 3RL8A 1WH1A 3GABA 3K50A 2L97A 4MPAA 3NCVA 1V6BA 2RRMA 3MH7A 2I0LA 2KOJA 1FC9A 1UJDA 3FY5A 2KL1A 4O06A 3R0HA 1U37A 2QKVA 5E11A 1RZXA 4EDJA 5HJ1A 3DIWA 3JXTA 2JOAA 2DJTA 4JOKA 2JREA 4NMQA 4REYA 2IWOA 1OBYA 5HEDA 1W9EA 4IC6A 1QAUA 4OEOA 5HEBA 2M0ZA 3PV2A 4GVDA 3CH8A 2P3WA 2JWEA 1V5LA 2HE4A 1N6EA 1WFGA 2KRGA 4NMSA 4KFVA 1N99A 3VQFA 1UFXA 4GHNA 4JOPA 5A2PA 2VZ5A 3PV5A 1Y7NA 4JL7A 4Q2PA 1LCYA 2L4SA 2JILA 2AINA 1X8SA 3PDVA 3QO6A 1W9OA 2KG2A 1X6DA 2O2TA 4K75A 2D8IA 3GJ9A 2LC7A 2MHOA 1P1EA 1OZIA 4UU6A 1OBZA 4Q6SA 1Z87A 3QGLA 2QBWA 4PQWA 4JOEA 1UM1A 3O5NA 2RCZA 2AWUA 3TSWA 1OBXA 2F5YA 5B6LA 2HGAA 3NFLA 3PDZA 3GDSA 2KJKA 2QT5A 4K72A 4YYXA 4NXPA 1UM7A 2QG1A 2KBSA 1WHAA 2EEGA 4NNMA 2YUBA 2JSNA 3DORA 2M0VA 1V5QA 2JXOA 4FGMA 2H2BA 3RLEA 2D90A 3MH4A 2PZDA 3SHUA 3CBZA 1KEFA 1NTEA 3KZDA 2OS6A 1Q7XA 2W4FA 1ZUBA 3QDOA 3TSVA 3GSLA 2PKUA 4HOPB 1XZ9A 4F8KA 4Q2QA 1B8QA 5HEYA 1ZOKA 2DLUA 3HPMA 1P1DA 3KDGA 2EEIA 3QJNA 4Q3HA 3GGEA 1SOTA 1X5QA 2EAQA 1R6JA 1V62A 3I1EA 3DJ3A 4Z33A 3DJAA 4K76A 3SOEA 1WF8A 2F0AA 1IU2A 4P2AB 1WG6A 1VA8A 5E1YA 2GZVA 3ID3A 2Z9IA 2KA9A 2OSGA 3TMHA 2ZPMA 3ID4A 2CSJA 2KOMA 2VSPA 4Q2NA 5EYZA 1PDRA 1VJ6A 1W9QA 2CS5A 3L4FD 2M3MA 4Q2OA 4E34A 2H3MA 5F67A 3LNYA 1X5RA 2Q3GA 2KJDA 5E22A 3ZRTA 1RGRA 2IWNA 2EGNA 2FCFA 1U39A 5HFFA 4NMOA 5E6PB 2G5MB 2QKUA 5HFEA 5HFBA 2EEHA 3I18A 4R2ZA 2LOBA 4NNLA 3KZEA 4NXQA 2LC6A 2H2CA 3R69A 2V90A 5GLJA 1L6OA 2ENOA 3EGHC 4KFWA 1TP5A 2I1NA 1M5ZA 3KDKA 1VB7A 2KJPA 1MFLA 1VCWA 3QJMA 3CS0A 1U3BA 1KY9A 4OEPA 2KYLA 2PA1A 1K32A 1I16A 4K6YA 1QLCA 5B42A 3NFKA 5DTHA 2PDZA 4E3BA 1N6DA 4WYUA 5IL9A 3OTPA 4Q6HA 4AMHA 1UEQA 4K78A 2KPKA 2AWWA 1Q3PA 1U38A 2KPLA 4OAJA 4JOGA 1IHJA 2FE5A 2I6VA 1TQ3A 5G1DA 3EGGC 2I0IA 5FHTA 2V1WA 5HDYA 2QKTA 2YTWA 2EEJA 2DC2A 1GQ4A 1FC6A 3RL7A 1VAEA 3DJ1A 1IU0A 2M0UA 2EDVA 2DMZA 1WFVA 1MC7A 2EGKA 3E17A 2JINA 5HETA 2PNTA 3R68A 4NMPA 3SFJA 1FCFA 2D92A 1UJVA 2L4TA 2OCSA 2EHRA 4N6XA 3MH6A 5E21A 1BE9A 1T2MA 1UF1A 1WF7A 2JIKA 5H3JA 1SOZA 2K20A 2Z17A 5HFCA 2X7ZA 1UEZA 1N7EA 2OZFA 2KV8A
chains in the Genus database with same CATH topology
4JORA 2CSSA 1KWAA 3ID2A 1X45A 2DLSA 5EZ0A 2VRFA 1V1TA 3K82A 3GCNA 4UU5A 3LNXA 2EDZA 1Q3OA 2EGOA 3QE1A 5F3XA 2BYGA 2M0TA 2DB5A 1MFGA 3QIKA 4GVCA 2FNEA 5HF1A 3WKMA 3K1RA 4YDPA 4NMTA 3CC0A 1WJLA 2EDPA 4NXRA 3CYYA 3CBXA 2HE2A 2WL7A 4E35A 3TSZA 2DM8A 3HVQC 4HOPA 5I7ZA 4JJ3A 1RY4A 2FN5A 1FC7A 1RGWA 1UEPA 1YBOA 2KAWA 2YT8A 3NGHA 3GDVA 1X5NA 5ILBA 3KHFA 1GM1A 2AWXA 2OMJA 2VSVA 1QAVB 2GEFA 4Z8JA 1GQ5A 4WYTA 1N6FA 4FLNA 3AXAA 2ZPLA 2KQFA 1UITA 5D13A 2IWQA 4JOHA 4P0CA 5GNDA 2K1ZA 2OQSA 2REYA 3O46A 3GDUA 1WI2A 1UEWA 2VWRA 3PS4A 2PKTA 3GCOA 5FB8C 1N7TA 2I4SA 1WIFA 5HFDA 2R4HA 3SUZA 3PV4A 4NMVA 2H3LA 2OPGA 2EV8A 1I92A 3ID1A 2YT7A 1TP3A 3B76A 1UJUA 4JOFA 5HF4A 1G9OA 1X9ZA 2R3YA 5JXBA 3OU0A 4JOJA 3I4WA 1WHDA 2LUIA 2I04A 1Z86A 4G69A 2LA8A 2IWPA 2YUYA 4XHVA 2UZCA 4RI0A 3VQGA 2W7RA 1D5GA 3STJA 2DKRA 3BPUA 2G2LA 3WKLA 5G1EA 1QAVA 4H11A 1Y8TA 2M10A 3CBYA 1NF3C 2EXGA 2KOHA 3HPKA 2EJYA 2MX6A 2E7KA 2DAZA 4JJ0A 3SHWA 2Q9VA 4LMMA 2VPHA 4L8NA 1N7FA 1WI4A 1BFEA 4NMRA 1TE0A 1UHPA 2OGPA 3RL8A 1WH1A 3GABA 3K50A 2L97A 4MPAA 3NCVA 1V6BA 2RRMA 3MH7A 2I0LA 2KOJA 1FC9A 1UJDA 3FY5A 2KL1A 4O06A 3R0HA 1U37A 2QKVA 5E11A 1RZXA 4EDJA 5HJ1A 3DIWA 3JXTA 2JOAA 2DJTA 4JOKA 2JREA 4NMQA 4REYA 2IWOA 1OBYA 5HEDA 1W9EA 4IC6A 1QAUA 4OEOA 5HEBA 2M0ZA 3PV2A 4GVDA 3CH8A 2P3WA 2JWEA 1V5LA 2HE4A 1N6EA 1WFGA 2KRGA 4NMSA 4KFVA 1N99A 3VQFA 1UFXA 4GHNA 4JOPA 5A2PA 2VZ5A 3PV5A 1Y7NA 4JL7A 4Q2PA 1LCYA 2L4SA 2JILA 2AINA 1X8SA 3PDVA 3QO6A 1W9OA 2KG2A 1X6DA 2O2TA 4K75A 2D8IA 3GJ9A 2LC7A 2MHOA 1P1EA 1OZIA 4UU6A 1OBZA 4Q6SA 1Z87A 3QGLA 2QBWA 4PQWA 4JOEA 1UM1A 3O5NA 2RCZA 2AWUA 3TSWA 1OBXA 2F5YA 5B6LA 2HGAA 3NFLA 3PDZA 3GDSA 2KJKA 2QT5A 4K72A 4YYXA 4NXPA 1UM7A 2QG1A 2KBSA 1WHAA 2EEGA 4NNMA 2YUBA 2JSNA 3DORA 2M0VA 1V5QA 2JXOA 4FGMA 2H2BA 3RLEA 2D90A 3MH4A 2PZDA 3SHUA 3CBZA 1KEFA 1NTEA 3KZDA 2OS6A 1Q7XA 2W4FA 1ZUBA 3QDOA 3TSVA 3GSLA 2PKUA 4HOPB 1XZ9A 4F8KA 4Q2QA 1B8QA 5HEYA 1ZOKA 2DLUA 3HPMA 1P1DA 3KDGA 2EEIA 3QJNA 4Q3HA 3GGEA 1SOTA 1X5QA 2EAQA 1R6JA 1V62A 3I1EA 3DJ3A 4Z33A 3DJAA 4K76A 3SOEA 1WF8A 2F0AA 1IU2A 4P2AB 1WG6A 1VA8A 5E1YA 2GZVA 3ID3A 2Z9IA 2KA9A 2OSGA 3TMHA 2ZPMA 3ID4A 2CSJA 2KOMA 2VSPA 4Q2NA 5EYZA 1PDRA 1VJ6A 1W9QA 2CS5A 3L4FD 2M3MA 4Q2OA 4E34A 2H3MA 5F67A 3LNYA 1X5RA 2Q3GA 2KJDA 5E22A 3ZRTA 1RGRA 2IWNA 2EGNA 2FCFA 1U39A 5HFFA 4NMOA 5E6PB 2G5MB 2QKUA 5HFEA 5HFBA 2EEHA 3I18A 4R2ZA 2LOBA 4NNLA 3KZEA 4NXQA 2LC6A 2H2CA 3R69A 2V90A 5GLJA 1L6OA 2ENOA 3EGHC 4KFWA 1TP5A 2I1NA 1M5ZA 3KDKA 1VB7A 2KJPA 1MFLA 1VCWA 3QJMA 3CS0A 1U3BA 1KY9A 4OEPA 2KYLA 2PA1A 1K32A 1I16A 4K6YA 1QLCA 5B42A 3NFKA 5DTHA 2PDZA 4E3BA 1N6DA 4WYUA 5IL9A 3OTPA 4Q6HA 4AMHA 1UEQA 4K78A 2KPKA 2AWWA 1Q3PA 1U38A 2KPLA 4OAJA 4JOGA 1IHJA 2FE5A 2I6VA 1TQ3A 5G1DA 3EGGC 2I0IA 5FHTA 2V1WA 5HDYA 2QKTA 2YTWA 2EEJA 2DC2A 1GQ4A 1FC6A 3RL7A 1VAEA 3DJ1A 1IU0A 2M0UA 2EDVA 2DMZA 1WFVA 1MC7A 2EGKA 3E17A 2JINA 5HETA 2PNTA 3R68A 4NMPA 3SFJA 1FCFA 2D92A 1UJVA 2L4TA 2OCSA 2EHRA 4N6XA 3MH6A 5E21A 1BE9A 1T2MA 1UF1A 1WF7A 2JIKA 5H3JA 1SOZA 2K20A 2Z17A 5HFCA 2X7ZA 1UEZA 1N7EA 2OZFA 2KV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOR A;  2CSS A;  1KWA A;  3ID2 A;  1X45 A;  2DLS A;  5EZ0 A;  2VRF A;  1V1T A;  3K82 A;  3GCN A;  4UU5 A;  3LNX A;  2EDZ A;  1Q3O A;  2EGO A;  3QE1 A;  5F3X A;  2BYG A;  2M0T A;  2DB5 A;  1MFG A;  3QIK A;  4GVC A;  2FNE A;  5HF1 A;  3WKM A;  3K1R A;  4YDP A;  4NMT A;  3CC0 A;  1WJL A;  2EDP A;  4NXR A;  3CYY A;  3CBX A;  2HE2 A;  2WL7 A;  4E35 A;  3TSZ A;  2DM8 A;  3HVQ C;  4HOP A;  5I7Z A;  1RY4 A;  2FN5 A;  1FC7 A;  1RGW A;  1UEP A;  1YBO A;  2KAW A;  2YT8 A;  3NGH A;  3GDV A;  1X5N A;  3KHF A;  1GM1 A;  2AWX A;  2OMJ A;  2VSV A;  1QAV B;  4Z8J A;  1GQ5 A;  4WYT A;  1N6F A;  3AXA A;  2ZPL A;  2KQF A;  1UIT A;  5D13 A;  2IWQ A;  4JOH A;  4P0C A;  5GND A;  2K1Z A;  2OQS A;  2REY A;  3O46 A;  3GDU A;  1WI2 A;  1UEW A;  2VWR A;  3PS4 A;  2PKT A;  3GCO A;  5FB8 C;  1N7T A;  2I4S A;  1WIF A;  5HFD A;  2R4H A;  3SUZ A;  3PV4 A;  4NMV A;  2H3L A;  2OPG A;  2EV8 A;  1I92 A;  3ID1 A;  2YT7 A;  1TP3 A;  3B76 A;  1UJU A;  4JOF A;  5HF4 A;  1G9O A;  2R3Y A;  5JXB A;  3OU0 A;  4JOJ A;  3I4W A;  1WHD A;  2LUI A;  2I04 A;  1Z86 A;  4G69 A;  2LA8 A;  2IWP A;  2YUY A;  4XHV A;  2UZC A;  4RI0 A;  3VQG A;  2W7R A;  1D5G A;  3STJ A;  2DKR A;  3BPU A;  2G2L A;  3WKL A;  5G1E A;  1QAV A;  4H11 A;  1Y8T A;  2M10 A;  3CBY A;  1NF3 C;  2EXG A;  2KOH A;  3HPK A;  2EJY A;  2MX6 A;  2E7K A;  2DAZ A;  3SHW A;  2Q9V A;  4LMM A;  2VPH A;  4L8N A;  1N7F A;  1WI4 A;  1BFE A;  4NMR A;  1TE0 A;  1UHP A;  2OGP A;  3RL8 A;  1WH1 A;  3K50 A;  2L97 A;  4MPA A;  1V6B A;  2RRM A;  3MH7 A;  2I0L A;  2KOJ A;  1FC9 A;  1UJD A;  3FY5 A;  2KL1 A;  4O06 A;  3R0H A;  1U37 A;  2QKV A;  5E11 A;  1RZX A;  4EDJ A;  5HJ1 A;  3DIW A;  3JXT A;  2JOA A;  2DJT A;  4JOK A;  2JRE A;  4NMQ A;  4REY A;  2IWO A;  1OBY A;  5HED A;  1W9E A;  4IC6 A;  1QAU A;  4OEO A;  5HEB A;  2M0Z A;  3PV2 A;  4GVD A;  3CH8 A;  2P3W A;  2JWE A;  1V5L A;  2HE4 A;  1N6E A;  1WFG A;  2KRG A;  4NMS A;  4KFV A;  1N99 A;  3VQF A;  1UFX A;  4GHN A;  4JOP A;  5A2P A;  2VZ5 A;  3PV5 A;  1Y7N A;  4JL7 A;  4Q2P A;  1LCY A;  2L4S A;  2JIL A;  2AIN A;  1X8S A;  3PDV A;  3QO6 A;  1W9O A;  2KG2 A;  1X6D A;  2O2T A;  4K75 A;  2D8I A;  3GJ9 A;  2LC7 A;  2MHO A;  1P1E A;  1OZI A;  4UU6 A;  1OBZ A;  4Q6S A;  1Z87 A;  3QGL A;  2QBW A;  4PQW A;  4JOE A;  1UM1 A;  3O5N A;  2RCZ A;  2AWU A;  3TSW A;  1OBX A;  2F5Y A;  5B6L A;  2HGA A;  3NFL A;  3PDZ A;  3GDS A;  2KJK A;  2QT5 A;  4K72 A;  4YYX A;  4NXP A;  1UM7 A;  2QG1 A;  2KBS A;  1WHA A;  2EEG A;  4NNM A;  2YUB A;  3DOR A;  2M0V A;  1V5Q A;  2JXO A;  4FGM A;  2H2B A;  3RLE A;  2D90 A;  3MH4 A;  2PZD A;  3SHU A;  3CBZ A;  1KEF A;  1NTE A;  3KZD A;  2OS6 A;  1Q7X A;  2W4F A;  1ZUB A;  3QDO A;  3TSV A;  3GSL A;  2PKU A;  4HOP B;  1XZ9 A;  4F8K A;  4Q2Q A;  1B8Q A;  5HEY A;  1ZOK A;  2DLU A;  3HPM A;  1P1D A;  2EEI A;  3QJN A;  4Q3H A;  3GGE A;  1SOT A;  1X5Q A;  2EAQ A;  1R6J A;  1V62 A;  3I1E A;  3DJ3 A;  4Z33 A;  3DJA A;  4K76 A;  3SOE A;  1WF8 A;  2F0A A;  1IU2 A;  4P2A B;  1WG6 A;  1VA8 A;  5E1Y A;  2GZV A;  3ID3 A;  2Z9I A;  2KA9 A;  2OSG A;  3TMH A;  2ZPM A;  3ID4 A;  2CSJ A;  2KOM A;  2VSP A;  4Q2N A;  5EYZ A;  1PDR A;  1VJ6 A;  1W9Q A;  2CS5 A;  3L4F D;  2M3M A;  4Q2O A;  4E34 A;  2H3M A;  5F67 A;  3LNY A;  1X5R A;  2Q3G A;  2KJD A;  5E22 A;  3ZRT A;  1RGR A;  2IWN A;  2EGN A;  2FCF A;  1U39 A;  5HFF A;  4NMO A;  5E6P B;  2G5M B;  2QKU A;  5HFE A;  5HFB A;  2EEH A;  3I18 A;  4R2Z A;  2LOB A;  4NNL A;  3KZE A;  4NXQ A;  2LC6 A;  2H2C A;  3R69 A;  2V90 A;  5GLJ A;  1L6O A;  2ENO A;  3EGH C;  4KFW A;  1TP5 A;  2I1N A;  1M5Z A;  1VB7 A;  2KJP A;  1MFL A;  1VCW A;  3QJM A;  3CS0 A;  1U3B A;  1KY9 A;  4OEP A;  2KYL A;  2PA1 A;  1K32 A;  1I16 A;  4K6Y A;  1QLC A;  3NFK A;  5DTH A;  2PDZ A;  4E3B A;  1N6D A;  4WYU A;  3OTP A;  4Q6H A;  4AMH A;  1UEQ A;  4K78 A;  2KPK A;  2AWW A;  1Q3P A;  1U38 A;  2KPL A;  4OAJ A;  4JOG A;  1IHJ A;  2FE5 A;  2I6V A;  1TQ3 A;  5G1D A;  3EGG C;  2I0I A;  5FHT A;  2V1W A;  5HDY A;  2QKT A;  2YTW A;  2EEJ A;  2DC2 A;  1GQ4 A;  1FC6 A;  3RL7 A;  1VAE A;  3DJ1 A;  1IU0 A;  2M0U A;  2EDV A;  2DMZ A;  1WFV A;  1MC7 A;  2EGK A;  3E17 A;  2JIN A;  5HET A;  2PNT A;  3R68 A;  4NMP A;  3SFJ A;  1FCF A;  2D92 A;  1UJV A;  2L4T A;  2OCS A;  2EHR A;  4N6X A;  3MH6 A;  5E21 A;  1BE9 A;  1T2M A;  1UF1 A;  1WF7 A;  2JIK A;  5H3J A;  1SOZ A;  2K20 A;  2Z17 A;  5HFC A;  2X7Z A;  1UEZ A;  1N7E A;  2OZF A;  2KV8 A; 
#chains in the Genus database with same CATH topology
 4JOR A;  2CSS A;  1KWA A;  3ID2 A;  1X45 A;  2DLS A;  5EZ0 A;  2VRF A;  1V1T A;  3K82 A;  3GCN A;  4UU5 A;  3LNX A;  2EDZ A;  1Q3O A;  2EGO A;  3QE1 A;  5F3X A;  2BYG A;  2M0T A;  2DB5 A;  1MFG A;  3QIK A;  4GVC A;  2FNE A;  5HF1 A;  3WKM A;  3K1R A;  4YDP A;  4NMT A;  3CC0 A;  1WJL A;  2EDP A;  4NXR A;  3CYY A;  3CBX A;  2HE2 A;  2WL7 A;  4E35 A;  3TSZ A;  2DM8 A;  3HVQ C;  4HOP A;  5I7Z A;  4JJ3 A;  1RY4 A;  2FN5 A;  1FC7 A;  1RGW A;  1UEP A;  1YBO A;  2KAW A;  2YT8 A;  3NGH A;  3GDV A;  1X5N A;  5ILB A;  3KHF A;  1GM1 A;  2AWX A;  2OMJ A;  2VSV A;  1QAV B;  2GEF A;  4Z8J A;  1GQ5 A;  4WYT A;  1N6F A;  4FLN A;  3AXA A;  2ZPL A;  2KQF A;  1UIT A;  5D13 A;  2IWQ A;  4JOH A;  4P0C A;  5GND A;  2K1Z A;  2OQS A;  2REY A;  3O46 A;  3GDU A;  1WI2 A;  1UEW A;  2VWR A;  3PS4 A;  2PKT A;  3GCO A;  5FB8 C;  1N7T A;  2I4S A;  1WIF A;  5HFD A;  2R4H A;  3SUZ A;  3PV4 A;  4NMV A;  2H3L A;  2OPG A;  2EV8 A;  1I92 A;  3ID1 A;  2YT7 A;  1TP3 A;  3B76 A;  1UJU A;  4JOF A;  5HF4 A;  1G9O A;  1X9Z A;  2R3Y A;  5JXB A;  3OU0 A;  4JOJ A;  3I4W A;  1WHD A;  2LUI A;  2I04 A;  1Z86 A;  4G69 A;  2LA8 A;  2IWP A;  2YUY A;  4XHV A;  2UZC A;  4RI0 A;  3VQG A;  2W7R A;  1D5G A;  3STJ A;  2DKR A;  3BPU A;  2G2L A;  3WKL A;  5G1E A;  1QAV A;  4H11 A;  1Y8T A;  2M10 A;  3CBY A;  1NF3 C;  2EXG A;  2KOH A;  3HPK A;  2EJY A;  2MX6 A;  2E7K A;  2DAZ A;  4JJ0 A;  3SHW A;  2Q9V A;  4LMM A;  2VPH A;  4L8N A;  1N7F A;  1WI4 A;  1BFE A;  4NMR A;  1TE0 A;  1UHP A;  2OGP A;  3RL8 A;  1WH1 A;  3GAB A;  3K50 A;  2L97 A;  4MPA A;  3NCV A;  1V6B A;  2RRM A;  3MH7 A;  2I0L A;  2KOJ A;  1FC9 A;  1UJD A;  3FY5 A;  2KL1 A;  4O06 A;  3R0H A;  1U37 A;  2QKV A;  5E11 A;  1RZX A;  4EDJ A;  5HJ1 A;  3DIW A;  3JXT A;  2JOA A;  2DJT A;  4JOK A;  2JRE A;  4NMQ A;  4REY A;  2IWO A;  1OBY A;  5HED A;  1W9E A;  4IC6 A;  1QAU A;  4OEO A;  5HEB A;  2M0Z A;  3PV2 A;  4GVD A;  3CH8 A;  2P3W A;  2JWE A;  1V5L A;  2HE4 A;  1N6E A;  1WFG A;  2KRG A;  4NMS A;  4KFV A;  1N99 A;  3VQF A;  1UFX A;  4GHN A;  4JOP A;  5A2P A;  2VZ5 A;  3PV5 A;  1Y7N A;  4JL7 A;  4Q2P A;  1LCY A;  2L4S A;  2JIL A;  2AIN A;  1X8S A;  3PDV A;  3QO6 A;  1W9O A;  2KG2 A;  1X6D A;  2O2T A;  4K75 A;  2D8I A;  3GJ9 A;  2LC7 A;  2MHO A;  1P1E A;  1OZI A;  4UU6 A;  1OBZ A;  4Q6S A;  1Z87 A;  3QGL A;  2QBW A;  4PQW A;  4JOE A;  1UM1 A;  3O5N A;  2RCZ A;  2AWU A;  3TSW A;  1OBX A;  2F5Y A;  5B6L A;  2HGA A;  3NFL A;  3PDZ A;  3GDS A;  2KJK A;  2QT5 A;  4K72 A;  4YYX A;  4NXP A;  1UM7 A;  2QG1 A;  2KBS A;  1WHA A;  2EEG A;  4NNM A;  2YUB A;  2JSN A;  3DOR A;  2M0V A;  1V5Q A;  2JXO A;  4FGM A;  2H2B A;  3RLE A;  2D90 A;  3MH4 A;  2PZD A;  3SHU A;  3CBZ A;  1KEF A;  1NTE A;  3KZD A;  2OS6 A;  1Q7X A;  2W4F A;  1ZUB A;  3QDO A;  3TSV A;  3GSL A;  2PKU A;  4HOP B;  1XZ9 A;  4F8K A;  4Q2Q A;  1B8Q A;  5HEY A;  1ZOK A;  2DLU A;  3HPM A;  1P1D A;  3KDG A;  2EEI A;  3QJN A;  4Q3H A;  3GGE A;  1SOT A;  1X5Q A;  2EAQ A;  1R6J A;  1V62 A;  3I1E A;  3DJ3 A;  4Z33 A;  3DJA A;  4K76 A;  3SOE A;  1WF8 A;  2F0A A;  1IU2 A;  4P2A B;  1WG6 A;  1VA8 A;  5E1Y A;  2GZV A;  3ID3 A;  2Z9I A;  2KA9 A;  2OSG A;  3TMH A;  2ZPM A;  3ID4 A;  2CSJ A;  2KOM A;  2VSP A;  4Q2N A;  5EYZ A;  1PDR A;  1VJ6 A;  1W9Q A;  2CS5 A;  3L4F D;  2M3M A;  4Q2O A;  4E34 A;  2H3M A;  5F67 A;  3LNY A;  1X5R A;  2Q3G A;  2KJD A;  5E22 A;  3ZRT A;  1RGR A;  2IWN A;  2EGN A;  2FCF A;  1U39 A;  5HFF A;  4NMO A;  5E6P B;  2G5M B;  2QKU A;  5HFE A;  5HFB A;  2EEH A;  3I18 A;  4R2Z A;  2LOB A;  4NNL A;  3KZE A;  4NXQ A;  2LC6 A;  2H2C A;  3R69 A;  2V90 A;  5GLJ A;  1L6O A;  2ENO A;  3EGH C;  4KFW A;  1TP5 A;  2I1N A;  1M5Z A;  3KDK A;  1VB7 A;  2KJP A;  1MFL A;  1VCW A;  3QJM A;  3CS0 A;  1U3B A;  1KY9 A;  4OEP A;  2KYL A;  2PA1 A;  1K32 A;  1I16 A;  4K6Y A;  1QLC A;  5B42 A;  3NFK A;  5DTH A;  2PDZ A;  4E3B A;  1N6D A;  4WYU A;  5IL9 A;  3OTP A;  4Q6H A;  4AMH A;  1UEQ A;  4K78 A;  2KPK A;  2AWW A;  1Q3P A;  1U38 A;  2KPL A;  4OAJ A;  4JOG A;  1IHJ A;  2FE5 A;  2I6V A;  1TQ3 A;  5G1D A;  3EGG C;  2I0I A;  5FHT A;  2V1W A;  5HDY A;  2QKT A;  2YTW A;  2EEJ A;  2DC2 A;  1GQ4 A;  1FC6 A;  3RL7 A;  1VAE A;  3DJ1 A;  1IU0 A;  2M0U A;  2EDV A;  2DMZ A;  1WFV A;  1MC7 A;  2EGK A;  3E17 A;  2JIN A;  5HET A;  2PNT A;  3R68 A;  4NMP A;  3SFJ A;  1FCF A;  2D92 A;  1UJV A;  2L4T A;  2OCS A;  2EHR A;  4N6X A;  3MH6 A;  5E21 A;  1BE9 A;  1T2M A;  1UF1 A;  1WF7 A;  2JIK A;  5H3J A;  1SOZ A;  2K20 A;  2Z17 A;  5HFC A;  2X7Z A;  1UEZ A;  1N7E A;  2OZF A;  2KV8 A; 
#chains in the Genus database with same CATH homology
 4JOR A;  2CSS A;  1KWA A;  3ID2 A;  1X45 A;  2DLS A;  5EZ0 A;  2VRF A;  1V1T A;  3K82 A;  3GCN A;  4UU5 A;  3LNX A;  2EDZ A;  1Q3O A;  2EGO A;  3QE1 A;  5F3X A;  2BYG A;  2M0T A;  2DB5 A;  1MFG A;  3QIK A;  4GVC A;  2FNE A;  5HF1 A;  3WKM A;  3K1R A;  4YDP A;  4NMT A;  3CC0 A;  1WJL A;  2EDP A;  4NXR A;  3CYY A;  3CBX A;  2HE2 A;  2WL7 A;  4E35 A;  3TSZ A;  2DM8 A;  3HVQ C;  4HOP A;  5I7Z A;  4JJ3 A;  1RY4 A;  2FN5 A;  1FC7 A;  1RGW A;  1UEP A;  1YBO A;  2KAW A;  2YT8 A;  3NGH A;  3GDV A;  1X5N A;  5ILB A;  3KHF A;  1GM1 A;  2AWX A;  2OMJ A;  2VSV A;  1QAV B;  2GEF A;  4Z8J A;  1GQ5 A;  4WYT A;  1N6F A;  4FLN A;  3AXA A;  2ZPL A;  2KQF A;  1UIT A;  5D13 A;  2IWQ A;  4JOH A;  4P0C A;  5GND A;  2K1Z A;  2OQS A;  2REY A;  3O46 A;  3GDU A;  1WI2 A;  1UEW A;  2VWR A;  3PS4 A;  2PKT A;  3GCO A;  5FB8 C;  1N7T A;  2I4S A;  1WIF A;  5HFD A;  2R4H A;  3SUZ A;  3PV4 A;  4NMV A;  2H3L A;  2OPG A;  2EV8 A;  1I92 A;  3ID1 A;  2YT7 A;  1TP3 A;  3B76 A;  1UJU A;  4JOF A;  5HF4 A;  1G9O A;  1X9Z A;  2R3Y A;  5JXB A;  3OU0 A;  4JOJ A;  3I4W A;  1WHD A;  2LUI A;  2I04 A;  1Z86 A;  4G69 A;  2LA8 A;  2IWP A;  2YUY A;  4XHV A;  2UZC A;  4RI0 A;  3VQG A;  2W7R A;  1D5G A;  3STJ A;  2DKR A;  3BPU A;  2G2L A;  3WKL A;  5G1E A;  1QAV A;  4H11 A;  1Y8T A;  2M10 A;  3CBY A;  1NF3 C;  2EXG A;  2KOH A;  3HPK A;  2EJY A;  2MX6 A;  2E7K A;  2DAZ A;  4JJ0 A;  3SHW A;  2Q9V A;  4LMM A;  2VPH A;  4L8N A;  1N7F A;  1WI4 A;  1BFE A;  4NMR A;  1TE0 A;  1UHP A;  2OGP A;  3RL8 A;  1WH1 A;  3GAB A;  3K50 A;  2L97 A;  4MPA A;  3NCV A;  1V6B A;  2RRM A;  3MH7 A;  2I0L A;  2KOJ A;  1FC9 A;  1UJD A;  3FY5 A;  2KL1 A;  4O06 A;  3R0H A;  1U37 A;  2QKV A;  5E11 A;  1RZX A;  4EDJ A;  5HJ1 A;  3DIW A;  3JXT A;  2JOA A;  2DJT A;  4JOK A;  2JRE A;  4NMQ A;  4REY A;  2IWO A;  1OBY A;  5HED A;  1W9E A;  4IC6 A;  1QAU A;  4OEO A;  5HEB A;  2M0Z A;  3PV2 A;  4GVD A;  3CH8 A;  2P3W A;  2JWE A;  1V5L A;  2HE4 A;  1N6E A;  1WFG A;  2KRG A;  4NMS A;  4KFV A;  1N99 A;  3VQF A;  1UFX A;  4GHN A;  4JOP A;  5A2P A;  2VZ5 A;  3PV5 A;  1Y7N A;  4JL7 A;  4Q2P A;  1LCY A;  2L4S A;  2JIL A;  2AIN A;  1X8S A;  3PDV A;  3QO6 A;  1W9O A;  2KG2 A;  1X6D A;  2O2T A;  4K75 A;  2D8I A;  3GJ9 A;  2LC7 A;  2MHO A;  1P1E A;  1OZI A;  4UU6 A;  1OBZ A;  4Q6S A;  1Z87 A;  3QGL A;  2QBW A;  4PQW A;  4JOE A;  1UM1 A;  3O5N A;  2RCZ A;  2AWU A;  3TSW A;  1OBX A;  2F5Y A;  5B6L A;  2HGA A;  3NFL A;  3PDZ A;  3GDS A;  2KJK A;  2QT5 A;  4K72 A;  4YYX A;  4NXP A;  1UM7 A;  2QG1 A;  2KBS A;  1WHA A;  2EEG A;  4NNM A;  2YUB A;  2JSN A;  3DOR A;  2M0V A;  1V5Q A;  2JXO A;  4FGM A;  2H2B A;  3RLE A;  2D90 A;  3MH4 A;  2PZD A;  3SHU A;  3CBZ A;  1KEF A;  1NTE A;  3KZD A;  2OS6 A;  1Q7X A;  2W4F A;  1ZUB A;  3QDO A;  3TSV A;  3GSL A;  2PKU A;  4HOP B;  1XZ9 A;  4F8K A;  4Q2Q A;  1B8Q A;  5HEY A;  1ZOK A;  2DLU A;  3HPM A;  1P1D A;  3KDG A;  2EEI A;  3QJN A;  4Q3H A;  3GGE A;  1SOT A;  1X5Q A;  2EAQ A;  1R6J A;  1V62 A;  3I1E A;  3DJ3 A;  4Z33 A;  3DJA A;  4K76 A;  3SOE A;  1WF8 A;  2F0A A;  1IU2 A;  4P2A B;  1WG6 A;  1VA8 A;  5E1Y A;  2GZV A;  3ID3 A;  2Z9I A;  2KA9 A;  2OSG A;  3TMH A;  2ZPM A;  3ID4 A;  2CSJ A;  2KOM A;  2VSP A;  4Q2N A;  5EYZ A;  1PDR A;  1VJ6 A;  1W9Q A;  2CS5 A;  3L4F D;  2M3M A;  4Q2O A;  4E34 A;  2H3M A;  5F67 A;  3LNY A;  1X5R A;  2Q3G A;  2KJD A;  5E22 A;  3ZRT A;  1RGR A;  2IWN A;  2EGN A;  2FCF A;  1U39 A;  5HFF A;  4NMO A;  5E6P B;  2G5M B;  2QKU A;  5HFE A;  5HFB A;  2EEH A;  3I18 A;  4R2Z A;  2LOB A;  4NNL A;  3KZE A;  4NXQ A;  2LC6 A;  2H2C A;  3R69 A;  2V90 A;  5GLJ A;  1L6O A;  2ENO A;  3EGH C;  4KFW A;  1TP5 A;  2I1N A;  1M5Z A;  3KDK A;  1VB7 A;  2KJP A;  1MFL A;  1VCW A;  3QJM A;  3CS0 A;  1U3B A;  1KY9 A;  4OEP A;  2KYL A;  2PA1 A;  1K32 A;  1I16 A;  4K6Y A;  1QLC A;  5B42 A;  3NFK A;  5DTH A;  2PDZ A;  4E3B A;  1N6D A;  4WYU A;  5IL9 A;  3OTP A;  4Q6H A;  4AMH A;  1UEQ A;  4K78 A;  2KPK A;  2AWW A;  1Q3P A;  1U38 A;  2KPL A;  4OAJ A;  4JOG A;  1IHJ A;  2FE5 A;  2I6V A;  1TQ3 A;  5G1D A;  3EGG C;  2I0I A;  5FHT A;  2V1W A;  5HDY A;  2QKT A;  2YTW A;  2EEJ A;  2DC2 A;  1GQ4 A;  1FC6 A;  3RL7 A;  1VAE A;  3DJ1 A;  1IU0 A;  2M0U A;  2EDV A;  2DMZ A;  1WFV A;  1MC7 A;  2EGK A;  3E17 A;  2JIN A;  5HET A;  2PNT A;  3R68 A;  4NMP A;  3SFJ A;  1FCF A;  2D92 A;  1UJV A;  2L4T A;  2OCS A;  2EHR A;  4N6X A;  3MH6 A;  5E21 A;  1BE9 A;  1T2M A;  1UF1 A;  1WF7 A;  2JIK A;  5H3J A;  1SOZ A;  2K20 A;  2Z17 A;  5HFC A;  2X7Z A;  1UEZ A;  1N7E A;  2OZF A;  2KV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...