2GZVA

The cystal structure of the pdz domain of human pick1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
91
Chain Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRKCA-binding protein
publication title Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 91
sequence length 93
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2gzvA01
2CSJA 2KPLA 1WFGA 2IWPA 4FGMA 4JOHA 3K82A 4E3BA 4L8NA 2KG2A 1UEWA 4Z8JA 2OCSA 2LA8A 2M0VA 5HEDA 1QAUA 2KBSA 3PV4A 1IU2A 2AINA 4HOPA 3KZDA 5E22A 2QT5A 4WYUA 4E35A 2QKVA 4NXPA 4GVDA 3ID2A 2VRFA 1OBYA 4NMSA 3WKMA 3OU0A 1Q3PA 1UJUA 4HOPB 5D13A 2QG1A 4XHVA 1GM1A 2YUBA 2PKUA 2VSPA 5G1EA 1M5ZA 1QLCA 3E17A 1GQ4A 2H2CA 4EDJA 1BFEA 1W9OA 2IWOA 1IHJA 4Q2QA 4KFVA 1WIFA 4GVCA 1FC9A 2DKRA 2KRGA 5HFEA 4P0CA 3DJAA 2EGOA 3B76A 1UEZA 2KJDA 5HEYA 5EYZA 2REYA 4JL7A 2OQSA 2VSVA 4Q2OA 2IWNA 5HF4A 2DB5A 4O06A 2Q9VA 1WFVA 1WI4A 2V1WA 3TMHA 3PV2A 2JIKA 4G69A 3JXTA 1SOTA 2I0LA 5GLJA 3GJ9A 2ENOA 5E21A 4UU5A 2JXOA 4JOEA 2OGPA 1U38A 3GSLA 5DTHA 1N7EA 1Q7XA 1WHAA 3QJNA 1RGWA 4IC6A 1TP5A 2G5MB 3CS0A 3NGHA 1NTEA 1N6EA 2D8IA 1Y8TA 4Q3HA 3SOEA 2QKUA 3GDSA 1SOZA 3L4FD 5HETA 3LNYA 1UM1A 4JORA 4Z33A 1R6JA 2DC2A 2KPKA 2LC6A 2W7RA 4NMRA 1VJ6A 2FE5A 4R2ZA 2D90A 2JINA 2WL7A 1V5LA 2Z17A 4K76A 4AMHA 2PNTA 1W9QA 4UU6A 1Z87A 3CC0A 2RCZA 5G1DA 2MX6A 2YT8A 1VCWA 2OZFA 1UF1A 3QO6A 1X5NA 1N6DA 3PDZA 3QJMA 3LNXA 1MFGA 1U37A 3STJA 3BPUA 4K75A 2EV8A 4LMMA 5HFFA 2P3WA 1WH1A 2EEHA 2ZPLA 3I18A 1XZ9A 2PA1A 1P1EA 2M0ZA 4NXRA 4YDPA 4JOFA 1UFXA 3O46A 2DJTA 4N6XA 2D92A 2R3YA 3EGHC 1KEFA 2EXGA 4OEPA 2EAQA 3PS4A 4H11A 2EEGA 4NNLA 2L97A 4WYTA 2QKTA 3CH8A 2EDPA 1V5QA 3HVQC 4E34A 3GCOA 1RZXA 5HFBA 2KA9A 3MH6A 1UITA 3CBZA 3RL8A 2AWWA 2EEIA 2HE2A 2JILA 4KFWA 1IU0A 3ID4A 4NMVA 1Q3OA 3FY5A 5JXBA 2M3MA 1B8QA 1UHPA 4Q6HA 1TP3A 3SUZA 3SHWA 2F0AA 5GNDA 4Q6SA 5B6LA 2JWEA 3K50A 2DLUA 2CSSA 2YTWA 3QGLA 4NNMA 3GDVA 1V62A 2EJYA 3DIWA 2I6VA 2X7ZA 1WJLA 1TQ3A 1ZOKA 3CBXA 4YYXA 3ID1A 2ZPMA 4NMOA 1UM7A 3AXAA 3HPKA 4NMTA 3ZRTA 5I7ZA 4F8KA 2PDZA 1KWAA 3HPMA 2KOJA 3SFJA 1FC6A 2FCFA 2KAWA 2R4HA 2GZVA 4JOJA 2PZDA 1N99A 1N6FA 4OEOA 1U39A 1WG6A 2K1ZA 1QAVA 4PQWA 3NFKA 2MHOA 3QDOA 5HF1A 2DMZA 1LCYA 3DORA 2KV8A 5H3JA 1RY4A 2EEJA 3MH4A 1V1TA 1QAVB 3R68A 4REYA 1I16A 1VA8A 3R69A 4K6YA 5E1YA 1V6BA 1OBXA 4NMPA 1GQ5A 3TSZA 2DAZA 2OSGA 2W4FA 5FB8C 3VQFA 1WF7A 2KOMA 1UEPA 4K78A 3I4WA 3KZEA 2L4SA 3EGGC 2EHRA 2I1NA 1X6DA 2OPGA 3I1EA 1Z86A 4Q2NA 3OTPA 3TSVA 1W9EA 1K32A 5HJ1A 5HFCA 1U3BA 1T2MA 2AWXA 3GGEA 2V90A 2EGNA 2BYGA 2RRMA 3K1RA 2EDZA 1OBZA 3CYYA 4K72A 2JOAA 2LOBA 2OMJA 1ZUBA 5HDYA 2LUIA 2IWQA 1UJVA 1WI2A 1VB7A 2Z9IA 1N7TA 2UZCA 1X45A 4Q2PA 2G2LA 3VQGA 2O2TA 2FNEA 3KHFA 1L6OA 5E11A 2FN5A 2HE4A 2M0TA 1OZIA 4JOKA 3GCNA 5FHTA 3R0HA 3DJ3A 3NFLA 2EDVA 5F3XA 5HFDA 2KJPA 1N7FA 5HEBA 2I04A 2CS5A 2KL1A 1X5QA 1VAEA 2QBWA 1UEQA 2DLSA 3CBYA 1YBOA 4P2AB 4JOGA 1WF8A 2HGAA 3GDUA 4GHNA 5F67A 4JOPA 3TSWA 1X8SA 1FC7A 2E7KA 2Q3GA 3PDVA 1WHDA 5A2PA 1PDRA 3WKLA 2KYLA 1KY9A 1X5RA 1MC7A 1BE9A 1TE0A 3QE1A 2M10A 1NF3C 2I0IA 2YUYA 2VWRA 2VZ5A 3ID3A 3SHUA 3DJ1A 1RGRA 1I92A 2JREA 1FCFA 2OS6A 2VPHA 4MPAA 2KQFA 3PV5A 3RLEA 3MH7A 2AWUA 1MFLA 2H3MA 5E6PB 5EZ0A 2YT7A 2KOHA 2I4SA 2PKTA 1Y7NA 2L4TA 2DM8A 2KJKA 1UJDA 2H3LA 3RL7A 1G9OA 4NXQA 2H2BA 2K20A 2M0UA 3QIKA 2EGKA 3O5NA 4RI0A 1P1DA 2F5YA 2LC7A 4OAJA 1D5GA 4NMQA
chains in the Genus database with same CATH superfamily
2CSJA 2KPLA 1WFGA 2IWPA 4FGMA 4JOHA 3K82A 4E3BA 4L8NA 2KG2A 1UEWA 4Z8JA 2OCSA 2LA8A 2M0VA 5HEDA 1QAUA 2KBSA 3PV4A 1IU2A 2AINA 4HOPA 3KZDA 5E22A 2QT5A 4WYUA 4E35A 2QKVA 4NXPA 4GVDA 3ID2A 2VRFA 1OBYA 4NMSA 3WKMA 3OU0A 1Q3PA 1UJUA 4HOPB 5D13A 2QG1A 4XHVA 1GM1A 2YUBA 2PKUA 2VSPA 5G1EA 1M5ZA 1QLCA 3E17A 1GQ4A 2H2CA 4EDJA 1BFEA 1W9OA 2IWOA 1IHJA 4Q2QA 4KFVA 1WIFA 4GVCA 1FC9A 2DKRA 2KRGA 5HFEA 4P0CA 3DJAA 2EGOA 3B76A 1UEZA 4FLNA 2KJDA 5HEYA 5EYZA 2REYA 4JL7A 2OQSA 2VSVA 4Q2OA 2IWNA 5HF4A 2DB5A 4O06A 2Q9VA 1WFVA 1WI4A 2V1WA 3TMHA 3PV2A 2JIKA 4G69A 3JXTA 1SOTA 3GABA 2I0LA 5GLJA 2GEFA 3GJ9A 2ENOA 5E21A 4UU5A 2JXOA 4JOEA 2OGPA 1U38A 5B42A 3GSLA 5DTHA 1N7EA 1Q7XA 1WHAA 3QJNA 1RGWA 4IC6A 1TP5A 2G5MB 3CS0A 3NGHA 1NTEA 1N6EA 2D8IA 1Y8TA 4Q3HA 3SOEA 2QKUA 3GDSA 1SOZA 3L4FD 5HETA 3LNYA 1UM1A 4JORA 4Z33A 1R6JA 2DC2A 2KPKA 2LC6A 2W7RA 4NMRA 1VJ6A 2FE5A 4R2ZA 2D90A 2JINA 2WL7A 1V5LA 2Z17A 4K76A 4AMHA 2PNTA 1W9QA 4UU6A 1Z87A 3CC0A 2RCZA 5G1DA 2MX6A 2YT8A 1VCWA 2OZFA 1UF1A 3QO6A 1X5NA 1N6DA 3PDZA 3QJMA 3LNXA 1MFGA 1U37A 3STJA 3BPUA 4K75A 2EV8A 4LMMA 5HFFA 2P3WA 1WH1A 2EEHA 2ZPLA 3I18A 1XZ9A 2PA1A 1P1EA 2M0ZA 4NXRA 4YDPA 4JOFA 1UFXA 3O46A 2DJTA 4N6XA 2D92A 2R3YA 3EGHC 3KDKA 1KEFA 2EXGA 4OEPA 2EAQA 3PS4A 4H11A 2EEGA 4NNLA 2L97A 4WYTA 2QKTA 3CH8A 2EDPA 1V5QA 3HVQC 4E34A 3GCOA 1RZXA 5HFBA 2KA9A 3MH6A 1UITA 3CBZA 3RL8A 2AWWA 2EEIA 2HE2A 2JILA 4KFWA 1IU0A 3ID4A 4NMVA 1Q3OA 3FY5A 5JXBA 2M3MA 1B8QA 1UHPA 4Q6HA 1TP3A 3SUZA 3SHWA 2F0AA 5GNDA 4Q6SA 5B6LA 2JWEA 3K50A 2DLUA 2CSSA 2YTWA 3QGLA 4NNMA 3GDVA 1V62A 2EJYA 3DIWA 2I6VA 2X7ZA 1WJLA 1TQ3A 1ZOKA 3CBXA 4YYXA 3ID1A 2ZPMA 4NMOA 1UM7A 3AXAA 3HPKA 4NMTA 3ZRTA 5I7ZA 4F8KA 2PDZA 1KWAA 3HPMA 2KOJA 3SFJA 1FC6A 2FCFA 2KAWA 2R4HA 2GZVA 4JOJA 2PZDA 1N99A 1N6FA 4OEOA 1U39A 1WG6A 2K1ZA 1QAVA 4PQWA 3NFKA 2MHOA 3QDOA 5HF1A 2DMZA 1LCYA 3DORA 2KV8A 5H3JA 1RY4A 2EEJA 3MH4A 1V1TA 1QAVB 3R68A 3NCVA 4REYA 1I16A 1VA8A 3R69A 4K6YA 5E1YA 1V6BA 1OBXA 4NMPA 1GQ5A 3TSZA 2DAZA 2OSGA 2W4FA 5FB8C 3VQFA 1WF7A 2KOMA 1UEPA 4K78A 3I4WA 3KZEA 2L4SA 3EGGC 2EHRA 2I1NA 1X6DA 2OPGA 3I1EA 1Z86A 4Q2NA 3OTPA 3TSVA 1W9EA 1K32A 5HJ1A 5HFCA 1U3BA 1T2MA 2AWXA 3GGEA 2V90A 2EGNA 2BYGA 2RRMA 3K1RA 2EDZA 1OBZA 3CYYA 4K72A 2JOAA 2LOBA 2OMJA 1ZUBA 5HDYA 2LUIA 2IWQA 1UJVA 1WI2A 1VB7A 2Z9IA 1N7TA 2UZCA 1X45A 4Q2PA 2G2LA 3VQGA 2O2TA 2FNEA 5ILBA 3KHFA 1L6OA 5E11A 2FN5A 2HE4A 2M0TA 1OZIA 4JOKA 3GCNA 5FHTA 3R0HA 3DJ3A 3NFLA 1X9ZA 2EDVA 5F3XA 5HFDA 2KJPA 1N7FA 5HEBA 2I04A 2CS5A 2KL1A 1X5QA 1VAEA 3KDGA 2QBWA 1UEQA 2DLSA 4JJ0A 3CBYA 1YBOA 4P2AB 4JOGA 1WF8A 2HGAA 3GDUA 4GHNA 5F67A 2JSNA 4JOPA 3TSWA 1X8SA 1FC7A 2E7KA 2Q3GA 3PDVA 1WHDA 5A2PA 1PDRA 3WKLA 2KYLA 1KY9A 1X5RA 1MC7A 1BE9A 1TE0A 3QE1A 2M10A 1NF3C 2I0IA 2YUYA 2VWRA 2VZ5A 3ID3A 3SHUA 3DJ1A 1RGRA 1I92A 2JREA 1FCFA 5IL9A 2OS6A 2VPHA 4JJ3A 4MPAA 2KQFA 3PV5A 3RLEA 3MH7A 2AWUA 1MFLA 2H3MA 5E6PB 5EZ0A 2YT7A 2KOHA 2I4SA 2PKTA 1Y7NA 2L4TA 2DM8A 2KJKA 1UJDA 2H3LA 3RL7A 1G9OA 4NXQA 2H2BA 2K20A 2M0UA 3QIKA 2EGKA 3O5NA 4RI0A 1P1DA 2F5YA 2LC7A 4OAJA 1D5GA 4NMQA
chains in the Genus database with same CATH topology
2CSJA 2KPLA 1WFGA 2IWPA 4FGMA 4JOHA 3K82A 4E3BA 4L8NA 2KG2A 1UEWA 4Z8JA 2OCSA 2LA8A 2M0VA 5HEDA 1QAUA 2KBSA 3PV4A 1IU2A 2AINA 4HOPA 3KZDA 5E22A 2QT5A 4WYUA 4E35A 2QKVA 4NXPA 4GVDA 3ID2A 2VRFA 1OBYA 4NMSA 3WKMA 3OU0A 1Q3PA 1UJUA 4HOPB 5D13A 2QG1A 4XHVA 1GM1A 2YUBA 2PKUA 2VSPA 5G1EA 1M5ZA 1QLCA 3E17A 1GQ4A 2H2CA 4EDJA 1BFEA 1W9OA 2IWOA 1IHJA 4Q2QA 4KFVA 1WIFA 4GVCA 1FC9A 2DKRA 2KRGA 5HFEA 4P0CA 3DJAA 2EGOA 3B76A 1UEZA 4FLNA 2KJDA 5HEYA 5EYZA 2REYA 4JL7A 2OQSA 2VSVA 4Q2OA 2IWNA 5HF4A 2DB5A 4O06A 2Q9VA 1WFVA 1WI4A 2V1WA 3TMHA 3PV2A 2JIKA 4G69A 3JXTA 1SOTA 3GABA 2I0LA 5GLJA 2GEFA 3GJ9A 2ENOA 5E21A 4UU5A 2JXOA 4JOEA 2OGPA 1U38A 5B42A 3GSLA 5DTHA 1N7EA 1Q7XA 1WHAA 3QJNA 1RGWA 4IC6A 1TP5A 2G5MB 3CS0A 3NGHA 1NTEA 1N6EA 2D8IA 1Y8TA 4Q3HA 3SOEA 2QKUA 3GDSA 1SOZA 3L4FD 5HETA 3LNYA 1UM1A 4JORA 4Z33A 1R6JA 2DC2A 2KPKA 2LC6A 2W7RA 4NMRA 1VJ6A 2FE5A 4R2ZA 2D90A 2JINA 2WL7A 1V5LA 2Z17A 4K76A 4AMHA 2PNTA 1W9QA 4UU6A 1Z87A 3CC0A 2RCZA 5G1DA 2MX6A 2YT8A 1VCWA 2OZFA 1UF1A 3QO6A 1X5NA 1N6DA 3PDZA 3QJMA 3LNXA 1MFGA 1U37A 3STJA 3BPUA 4K75A 2EV8A 4LMMA 5HFFA 2P3WA 1WH1A 2EEHA 2ZPLA 3I18A 1XZ9A 2PA1A 1P1EA 2M0ZA 4NXRA 4YDPA 4JOFA 1UFXA 3O46A 2DJTA 4N6XA 2D92A 2R3YA 3EGHC 3KDKA 1KEFA 2EXGA 4OEPA 2EAQA 3PS4A 4H11A 2EEGA 4NNLA 2L97A 4WYTA 2QKTA 3CH8A 2EDPA 1V5QA 3HVQC 4E34A 3GCOA 1RZXA 5HFBA 2KA9A 3MH6A 1UITA 3CBZA 3RL8A 2AWWA 2EEIA 2HE2A 2JILA 4KFWA 1IU0A 3ID4A 4NMVA 1Q3OA 3FY5A 5JXBA 2M3MA 1B8QA 1UHPA 4Q6HA 1TP3A 3SUZA 3SHWA 2F0AA 5GNDA 4Q6SA 5B6LA 2JWEA 3K50A 2DLUA 2CSSA 2YTWA 3QGLA 4NNMA 3GDVA 1V62A 2EJYA 3DIWA 2I6VA 2X7ZA 1WJLA 1TQ3A 1ZOKA 3CBXA 4YYXA 3ID1A 2ZPMA 4NMOA 1UM7A 3AXAA 3HPKA 4NMTA 3ZRTA 5I7ZA 4F8KA 2PDZA 1KWAA 3HPMA 2KOJA 3SFJA 1FC6A 2FCFA 2KAWA 2R4HA 2GZVA 4JOJA 2PZDA 1N99A 1N6FA 4OEOA 1U39A 1WG6A 2K1ZA 1QAVA 4PQWA 3NFKA 2MHOA 3QDOA 5HF1A 2DMZA 1LCYA 3DORA 2KV8A 5H3JA 1RY4A 2EEJA 3MH4A 1V1TA 1QAVB 3R68A 3NCVA 4REYA 1I16A 1VA8A 3R69A 4K6YA 5E1YA 1V6BA 1OBXA 4NMPA 1GQ5A 3TSZA 2DAZA 2OSGA 2W4FA 5FB8C 3VQFA 1WF7A 2KOMA 1UEPA 4K78A 3I4WA 3KZEA 2L4SA 3EGGC 2EHRA 2I1NA 1X6DA 2OPGA 3I1EA 1Z86A 4Q2NA 3OTPA 3TSVA 1W9EA 1K32A 5HJ1A 5HFCA 1U3BA 1T2MA 2AWXA 3GGEA 2V90A 2EGNA 2BYGA 2RRMA 3K1RA 2EDZA 1OBZA 3CYYA 4K72A 2JOAA 2LOBA 2OMJA 1ZUBA 5HDYA 2LUIA 2IWQA 1UJVA 1WI2A 1VB7A 2Z9IA 1N7TA 2UZCA 1X45A 4Q2PA 2G2LA 3VQGA 2O2TA 2FNEA 5ILBA 3KHFA 1L6OA 5E11A 2FN5A 2HE4A 2M0TA 1OZIA 4JOKA 3GCNA 5FHTA 3R0HA 3DJ3A 3NFLA 1X9ZA 2EDVA 5F3XA 5HFDA 2KJPA 1N7FA 5HEBA 2I04A 2CS5A 2KL1A 1X5QA 1VAEA 3KDGA 2QBWA 1UEQA 2DLSA 4JJ0A 3CBYA 1YBOA 4P2AB 4JOGA 1WF8A 2HGAA 3GDUA 4GHNA 5F67A 2JSNA 4JOPA 3TSWA 1X8SA 1FC7A 2E7KA 2Q3GA 3PDVA 1WHDA 5A2PA 1PDRA 3WKLA 2KYLA 1KY9A 1X5RA 1MC7A 1BE9A 1TE0A 3QE1A 2M10A 1NF3C 2I0IA 2YUYA 2VWRA 2VZ5A 3ID3A 3SHUA 3DJ1A 1RGRA 1I92A 2JREA 1FCFA 5IL9A 2OS6A 2VPHA 4JJ3A 4MPAA 2KQFA 3PV5A 3RLEA 3MH7A 2AWUA 1MFLA 2H3MA 5E6PB 5EZ0A 2YT7A 2KOHA 2I4SA 2PKTA 1Y7NA 2L4TA 2DM8A 2KJKA 1UJDA 2H3LA 3RL7A 1G9OA 4NXQA 2H2BA 2K20A 2M0UA 3QIKA 2EGKA 3O5NA 4RI0A 1P1DA 2F5YA 2LC7A 4OAJA 1D5GA 4NMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSJ A;  2KPL A;  1WFG A;  2IWP A;  4FGM A;  4JOH A;  3K82 A;  4E3B A;  4L8N A;  2KG2 A;  1UEW A;  4Z8J A;  2OCS A;  2LA8 A;  2M0V A;  5HED A;  1QAU A;  2KBS A;  3PV4 A;  1IU2 A;  2AIN A;  4HOP A;  3KZD A;  5E22 A;  2QT5 A;  4WYU A;  4E35 A;  2QKV A;  4NXP A;  4GVD A;  3ID2 A;  2VRF A;  1OBY A;  4NMS A;  3WKM A;  3OU0 A;  1Q3P A;  1UJU A;  4HOP B;  5D13 A;  2QG1 A;  4XHV A;  1GM1 A;  2YUB A;  2PKU A;  2VSP A;  5G1E A;  1M5Z A;  1QLC A;  3E17 A;  1GQ4 A;  2H2C A;  4EDJ A;  1BFE A;  1W9O A;  2IWO A;  1IHJ A;  4Q2Q A;  4KFV A;  1WIF A;  4GVC A;  1FC9 A;  2DKR A;  2KRG A;  5HFE A;  4P0C A;  3DJA A;  2EGO A;  3B76 A;  1UEZ A;  2KJD A;  5HEY A;  5EYZ A;  2REY A;  4JL7 A;  2OQS A;  2VSV A;  4Q2O A;  2IWN A;  5HF4 A;  2DB5 A;  4O06 A;  2Q9V A;  1WFV A;  1WI4 A;  2V1W A;  3TMH A;  3PV2 A;  2JIK A;  4G69 A;  3JXT A;  1SOT A;  2I0L A;  5GLJ A;  3GJ9 A;  2ENO A;  5E21 A;  4UU5 A;  2JXO A;  4JOE A;  2OGP A;  1U38 A;  3GSL A;  5DTH A;  1N7E A;  1Q7X A;  1WHA A;  3QJN A;  1RGW A;  4IC6 A;  1TP5 A;  2G5M B;  3CS0 A;  3NGH A;  1NTE A;  1N6E A;  2D8I A;  1Y8T A;  4Q3H A;  3SOE A;  2QKU A;  3GDS A;  1SOZ A;  3L4F D;  5HET A;  3LNY A;  1UM1 A;  4JOR A;  4Z33 A;  1R6J A;  2DC2 A;  2KPK A;  2LC6 A;  2W7R A;  4NMR A;  1VJ6 A;  2FE5 A;  4R2Z A;  2D90 A;  2JIN A;  2WL7 A;  1V5L A;  2Z17 A;  4K76 A;  4AMH A;  2PNT A;  1W9Q A;  4UU6 A;  1Z87 A;  3CC0 A;  2RCZ A;  5G1D A;  2MX6 A;  2YT8 A;  1VCW A;  2OZF A;  1UF1 A;  3QO6 A;  1X5N A;  1N6D A;  3PDZ A;  3QJM A;  3LNX A;  1MFG A;  1U37 A;  3STJ A;  3BPU A;  4K75 A;  2EV8 A;  4LMM A;  5HFF A;  2P3W A;  1WH1 A;  2EEH A;  2ZPL A;  3I18 A;  1XZ9 A;  2PA1 A;  1P1E A;  2M0Z A;  4NXR A;  4YDP A;  4JOF A;  1UFX A;  3O46 A;  2DJT A;  4N6X A;  2D92 A;  2R3Y A;  3EGH C;  1KEF A;  2EXG A;  4OEP A;  2EAQ A;  3PS4 A;  4H11 A;  2EEG A;  4NNL A;  2L97 A;  4WYT A;  2QKT A;  3CH8 A;  2EDP A;  1V5Q A;  3HVQ C;  4E34 A;  3GCO A;  1RZX A;  5HFB A;  2KA9 A;  3MH6 A;  1UIT A;  3CBZ A;  3RL8 A;  2AWW A;  2EEI A;  2HE2 A;  2JIL A;  4KFW A;  1IU0 A;  3ID4 A;  4NMV A;  1Q3O A;  3FY5 A;  5JXB A;  2M3M A;  1B8Q A;  1UHP A;  4Q6H A;  1TP3 A;  3SUZ A;  3SHW A;  2F0A A;  5GND A;  4Q6S A;  5B6L A;  2JWE A;  3K50 A;  2DLU A;  2CSS A;  2YTW A;  3QGL A;  4NNM A;  3GDV A;  1V62 A;  2EJY A;  3DIW A;  2I6V A;  2X7Z A;  1WJL A;  1TQ3 A;  1ZOK A;  3CBX A;  4YYX A;  3ID1 A;  2ZPM A;  4NMO A;  1UM7 A;  3AXA A;  3HPK A;  4NMT A;  3ZRT A;  5I7Z A;  4F8K A;  2PDZ A;  1KWA A;  3HPM A;  2KOJ A;  3SFJ A;  1FC6 A;  2FCF A;  2KAW A;  2R4H A;  2GZV A;  4JOJ A;  2PZD A;  1N99 A;  1N6F A;  4OEO A;  1U39 A;  1WG6 A;  2K1Z A;  1QAV A;  4PQW A;  3NFK A;  2MHO A;  3QDO A;  5HF1 A;  2DMZ A;  1LCY A;  3DOR A;  2KV8 A;  5H3J A;  1RY4 A;  2EEJ A;  3MH4 A;  1V1T A;  1QAV B;  3R68 A;  4REY A;  1I16 A;  1VA8 A;  3R69 A;  4K6Y A;  5E1Y A;  1V6B A;  1OBX A;  4NMP A;  1GQ5 A;  3TSZ A;  2DAZ A;  2OSG A;  2W4F A;  5FB8 C;  3VQF A;  1WF7 A;  2KOM A;  1UEP A;  4K78 A;  3I4W A;  3KZE A;  2L4S A;  3EGG C;  2EHR A;  2I1N A;  1X6D A;  2OPG A;  3I1E A;  1Z86 A;  4Q2N A;  3OTP A;  3TSV A;  1W9E A;  1K32 A;  5HJ1 A;  5HFC A;  1U3B A;  1T2M A;  2AWX A;  3GGE A;  2V90 A;  2EGN A;  2BYG A;  2RRM A;  3K1R A;  2EDZ A;  1OBZ A;  3CYY A;  4K72 A;  2JOA A;  2LOB A;  2OMJ A;  1ZUB A;  5HDY A;  2LUI A;  2IWQ A;  1UJV A;  1WI2 A;  1VB7 A;  2Z9I A;  1N7T A;  2UZC A;  1X45 A;  4Q2P A;  2G2L A;  3VQG A;  2O2T A;  2FNE A;  3KHF A;  1L6O A;  5E11 A;  2FN5 A;  2HE4 A;  2M0T A;  1OZI A;  4JOK A;  3GCN A;  5FHT A;  3R0H A;  3DJ3 A;  3NFL A;  2EDV A;  5F3X A;  5HFD A;  2KJP A;  1N7F A;  5HEB A;  2I04 A;  2CS5 A;  2KL1 A;  1X5Q A;  1VAE A;  2QBW A;  1UEQ A;  2DLS A;  3CBY A;  1YBO A;  4P2A B;  4JOG A;  1WF8 A;  2HGA A;  3GDU A;  4GHN A;  5F67 A;  4JOP A;  3TSW A;  1X8S A;  1FC7 A;  2E7K A;  2Q3G A;  3PDV A;  1WHD A;  5A2P A;  1PDR A;  3WKL A;  2KYL A;  1KY9 A;  1X5R A;  1MC7 A;  1BE9 A;  1TE0 A;  3QE1 A;  2M10 A;  1NF3 C;  2I0I A;  2YUY A;  2VWR A;  2VZ5 A;  3ID3 A;  3SHU A;  3DJ1 A;  1RGR A;  1I92 A;  2JRE A;  1FCF A;  2OS6 A;  2VPH A;  4MPA A;  2KQF A;  3PV5 A;  3RLE A;  3MH7 A;  2AWU A;  1MFL A;  2H3M A;  5E6P B;  5EZ0 A;  2YT7 A;  2KOH A;  2I4S A;  2PKT A;  1Y7N A;  2L4T A;  2DM8 A;  2KJK A;  1UJD A;  2H3L A;  3RL7 A;  1G9O A;  4NXQ A;  2H2B A;  2K20 A;  2M0U A;  3QIK A;  2EGK A;  3O5N A;  4RI0 A;  1P1D A;  2F5Y A;  2LC7 A;  4OAJ A;  1D5G A;  4NMQ A; 
#chains in the Genus database with same CATH topology
 2CSJ A;  2KPL A;  1WFG A;  2IWP A;  4FGM A;  4JOH A;  3K82 A;  4E3B A;  4L8N A;  2KG2 A;  1UEW A;  4Z8J A;  2OCS A;  2LA8 A;  2M0V A;  5HED A;  1QAU A;  2KBS A;  3PV4 A;  1IU2 A;  2AIN A;  4HOP A;  3KZD A;  5E22 A;  2QT5 A;  4WYU A;  4E35 A;  2QKV A;  4NXP A;  4GVD A;  3ID2 A;  2VRF A;  1OBY A;  4NMS A;  3WKM A;  3OU0 A;  1Q3P A;  1UJU A;  4HOP B;  5D13 A;  2QG1 A;  4XHV A;  1GM1 A;  2YUB A;  2PKU A;  2VSP A;  5G1E A;  1M5Z A;  1QLC A;  3E17 A;  1GQ4 A;  2H2C A;  4EDJ A;  1BFE A;  1W9O A;  2IWO A;  1IHJ A;  4Q2Q A;  4KFV A;  1WIF A;  4GVC A;  1FC9 A;  2DKR A;  2KRG A;  5HFE A;  4P0C A;  3DJA A;  2EGO A;  3B76 A;  1UEZ A;  4FLN A;  2KJD A;  5HEY A;  5EYZ A;  2REY A;  4JL7 A;  2OQS A;  2VSV A;  4Q2O A;  2IWN A;  5HF4 A;  2DB5 A;  4O06 A;  2Q9V A;  1WFV A;  1WI4 A;  2V1W A;  3TMH A;  3PV2 A;  2JIK A;  4G69 A;  3JXT A;  1SOT A;  3GAB A;  2I0L A;  5GLJ A;  2GEF A;  3GJ9 A;  2ENO A;  5E21 A;  4UU5 A;  2JXO A;  4JOE A;  2OGP A;  1U38 A;  5B42 A;  3GSL A;  5DTH A;  1N7E A;  1Q7X A;  1WHA A;  3QJN A;  1RGW A;  4IC6 A;  1TP5 A;  2G5M B;  3CS0 A;  3NGH A;  1NTE A;  1N6E A;  2D8I A;  1Y8T A;  4Q3H A;  3SOE A;  2QKU A;  3GDS A;  1SOZ A;  3L4F D;  5HET A;  3LNY A;  1UM1 A;  4JOR A;  4Z33 A;  1R6J A;  2DC2 A;  2KPK A;  2LC6 A;  2W7R A;  4NMR A;  1VJ6 A;  2FE5 A;  4R2Z A;  2D90 A;  2JIN A;  2WL7 A;  1V5L A;  2Z17 A;  4K76 A;  4AMH A;  2PNT A;  1W9Q A;  4UU6 A;  1Z87 A;  3CC0 A;  2RCZ A;  5G1D A;  2MX6 A;  2YT8 A;  1VCW A;  2OZF A;  1UF1 A;  3QO6 A;  1X5N A;  1N6D A;  3PDZ A;  3QJM A;  3LNX A;  1MFG A;  1U37 A;  3STJ A;  3BPU A;  4K75 A;  2EV8 A;  4LMM A;  5HFF A;  2P3W A;  1WH1 A;  2EEH A;  2ZPL A;  3I18 A;  1XZ9 A;  2PA1 A;  1P1E A;  2M0Z A;  4NXR A;  4YDP A;  4JOF A;  1UFX A;  3O46 A;  2DJT A;  4N6X A;  2D92 A;  2R3Y A;  3EGH C;  3KDK A;  1KEF A;  2EXG A;  4OEP A;  2EAQ A;  3PS4 A;  4H11 A;  2EEG A;  4NNL A;  2L97 A;  4WYT A;  2QKT A;  3CH8 A;  2EDP A;  1V5Q A;  3HVQ C;  4E34 A;  3GCO A;  1RZX A;  5HFB A;  2KA9 A;  3MH6 A;  1UIT A;  3CBZ A;  3RL8 A;  2AWW A;  2EEI A;  2HE2 A;  2JIL A;  4KFW A;  1IU0 A;  3ID4 A;  4NMV A;  1Q3O A;  3FY5 A;  5JXB A;  2M3M A;  1B8Q A;  1UHP A;  4Q6H A;  1TP3 A;  3SUZ A;  3SHW A;  2F0A A;  5GND A;  4Q6S A;  5B6L A;  2JWE A;  3K50 A;  2DLU A;  2CSS A;  2YTW A;  3QGL A;  4NNM A;  3GDV A;  1V62 A;  2EJY A;  3DIW A;  2I6V A;  2X7Z A;  1WJL A;  1TQ3 A;  1ZOK A;  3CBX A;  4YYX A;  3ID1 A;  2ZPM A;  4NMO A;  1UM7 A;  3AXA A;  3HPK A;  4NMT A;  3ZRT A;  5I7Z A;  4F8K A;  2PDZ A;  1KWA A;  3HPM A;  2KOJ A;  3SFJ A;  1FC6 A;  2FCF A;  2KAW A;  2R4H A;  2GZV A;  4JOJ A;  2PZD A;  1N99 A;  1N6F A;  4OEO A;  1U39 A;  1WG6 A;  2K1Z A;  1QAV A;  4PQW A;  3NFK A;  2MHO A;  3QDO A;  5HF1 A;  2DMZ A;  1LCY A;  3DOR A;  2KV8 A;  5H3J A;  1RY4 A;  2EEJ A;  3MH4 A;  1V1T A;  1QAV B;  3R68 A;  3NCV A;  4REY A;  1I16 A;  1VA8 A;  3R69 A;  4K6Y A;  5E1Y A;  1V6B A;  1OBX A;  4NMP A;  1GQ5 A;  3TSZ A;  2DAZ A;  2OSG A;  2W4F A;  5FB8 C;  3VQF A;  1WF7 A;  2KOM A;  1UEP A;  4K78 A;  3I4W A;  3KZE A;  2L4S A;  3EGG C;  2EHR A;  2I1N A;  1X6D A;  2OPG A;  3I1E A;  1Z86 A;  4Q2N A;  3OTP A;  3TSV A;  1W9E A;  1K32 A;  5HJ1 A;  5HFC A;  1U3B A;  1T2M A;  2AWX A;  3GGE A;  2V90 A;  2EGN A;  2BYG A;  2RRM A;  3K1R A;  2EDZ A;  1OBZ A;  3CYY A;  4K72 A;  2JOA A;  2LOB A;  2OMJ A;  1ZUB A;  5HDY A;  2LUI A;  2IWQ A;  1UJV A;  1WI2 A;  1VB7 A;  2Z9I A;  1N7T A;  2UZC A;  1X45 A;  4Q2P A;  2G2L A;  3VQG A;  2O2T A;  2FNE A;  5ILB A;  3KHF A;  1L6O A;  5E11 A;  2FN5 A;  2HE4 A;  2M0T A;  1OZI A;  4JOK A;  3GCN A;  5FHT A;  3R0H A;  3DJ3 A;  3NFL A;  1X9Z A;  2EDV A;  5F3X A;  5HFD A;  2KJP A;  1N7F A;  5HEB A;  2I04 A;  2CS5 A;  2KL1 A;  1X5Q A;  1VAE A;  3KDG A;  2QBW A;  1UEQ A;  2DLS A;  4JJ0 A;  3CBY A;  1YBO A;  4P2A B;  4JOG A;  1WF8 A;  2HGA A;  3GDU A;  4GHN A;  5F67 A;  2JSN A;  4JOP A;  3TSW A;  1X8S A;  1FC7 A;  2E7K A;  2Q3G A;  3PDV A;  1WHD A;  5A2P A;  1PDR A;  3WKL A;  2KYL A;  1KY9 A;  1X5R A;  1MC7 A;  1BE9 A;  1TE0 A;  3QE1 A;  2M10 A;  1NF3 C;  2I0I A;  2YUY A;  2VWR A;  2VZ5 A;  3ID3 A;  3SHU A;  3DJ1 A;  1RGR A;  1I92 A;  2JRE A;  1FCF A;  5IL9 A;  2OS6 A;  2VPH A;  4JJ3 A;  4MPA A;  2KQF A;  3PV5 A;  3RLE A;  3MH7 A;  2AWU A;  1MFL A;  2H3M A;  5E6P B;  5EZ0 A;  2YT7 A;  2KOH A;  2I4S A;  2PKT A;  1Y7N A;  2L4T A;  2DM8 A;  2KJK A;  1UJD A;  2H3L A;  3RL7 A;  1G9O A;  4NXQ A;  2H2B A;  2K20 A;  2M0U A;  3QIK A;  2EGK A;  3O5N A;  4RI0 A;  1P1D A;  2F5Y A;  2LC7 A;  4OAJ A;  1D5G A;  4NMQ A; 
#chains in the Genus database with same CATH homology
 2CSJ A;  2KPL A;  1WFG A;  2IWP A;  4FGM A;  4JOH A;  3K82 A;  4E3B A;  4L8N A;  2KG2 A;  1UEW A;  4Z8J A;  2OCS A;  2LA8 A;  2M0V A;  5HED A;  1QAU A;  2KBS A;  3PV4 A;  1IU2 A;  2AIN A;  4HOP A;  3KZD A;  5E22 A;  2QT5 A;  4WYU A;  4E35 A;  2QKV A;  4NXP A;  4GVD A;  3ID2 A;  2VRF A;  1OBY A;  4NMS A;  3WKM A;  3OU0 A;  1Q3P A;  1UJU A;  4HOP B;  5D13 A;  2QG1 A;  4XHV A;  1GM1 A;  2YUB A;  2PKU A;  2VSP A;  5G1E A;  1M5Z A;  1QLC A;  3E17 A;  1GQ4 A;  2H2C A;  4EDJ A;  1BFE A;  1W9O A;  2IWO A;  1IHJ A;  4Q2Q A;  4KFV A;  1WIF A;  4GVC A;  1FC9 A;  2DKR A;  2KRG A;  5HFE A;  4P0C A;  3DJA A;  2EGO A;  3B76 A;  1UEZ A;  4FLN A;  2KJD A;  5HEY A;  5EYZ A;  2REY A;  4JL7 A;  2OQS A;  2VSV A;  4Q2O A;  2IWN A;  5HF4 A;  2DB5 A;  4O06 A;  2Q9V A;  1WFV A;  1WI4 A;  2V1W A;  3TMH A;  3PV2 A;  2JIK A;  4G69 A;  3JXT A;  1SOT A;  3GAB A;  2I0L A;  5GLJ A;  2GEF A;  3GJ9 A;  2ENO A;  5E21 A;  4UU5 A;  2JXO A;  4JOE A;  2OGP A;  1U38 A;  5B42 A;  3GSL A;  5DTH A;  1N7E A;  1Q7X A;  1WHA A;  3QJN A;  1RGW A;  4IC6 A;  1TP5 A;  2G5M B;  3CS0 A;  3NGH A;  1NTE A;  1N6E A;  2D8I A;  1Y8T A;  4Q3H A;  3SOE A;  2QKU A;  3GDS A;  1SOZ A;  3L4F D;  5HET A;  3LNY A;  1UM1 A;  4JOR A;  4Z33 A;  1R6J A;  2DC2 A;  2KPK A;  2LC6 A;  2W7R A;  4NMR A;  1VJ6 A;  2FE5 A;  4R2Z A;  2D90 A;  2JIN A;  2WL7 A;  1V5L A;  2Z17 A;  4K76 A;  4AMH A;  2PNT A;  1W9Q A;  4UU6 A;  1Z87 A;  3CC0 A;  2RCZ A;  5G1D A;  2MX6 A;  2YT8 A;  1VCW A;  2OZF A;  1UF1 A;  3QO6 A;  1X5N A;  1N6D A;  3PDZ A;  3QJM A;  3LNX A;  1MFG A;  1U37 A;  3STJ A;  3BPU A;  4K75 A;  2EV8 A;  4LMM A;  5HFF A;  2P3W A;  1WH1 A;  2EEH A;  2ZPL A;  3I18 A;  1XZ9 A;  2PA1 A;  1P1E A;  2M0Z A;  4NXR A;  4YDP A;  4JOF A;  1UFX A;  3O46 A;  2DJT A;  4N6X A;  2D92 A;  2R3Y A;  3EGH C;  3KDK A;  1KEF A;  2EXG A;  4OEP A;  2EAQ A;  3PS4 A;  4H11 A;  2EEG A;  4NNL A;  2L97 A;  4WYT A;  2QKT A;  3CH8 A;  2EDP A;  1V5Q A;  3HVQ C;  4E34 A;  3GCO A;  1RZX A;  5HFB A;  2KA9 A;  3MH6 A;  1UIT A;  3CBZ A;  3RL8 A;  2AWW A;  2EEI A;  2HE2 A;  2JIL A;  4KFW A;  1IU0 A;  3ID4 A;  4NMV A;  1Q3O A;  3FY5 A;  5JXB A;  2M3M A;  1B8Q A;  1UHP A;  4Q6H A;  1TP3 A;  3SUZ A;  3SHW A;  2F0A A;  5GND A;  4Q6S A;  5B6L A;  2JWE A;  3K50 A;  2DLU A;  2CSS A;  2YTW A;  3QGL A;  4NNM A;  3GDV A;  1V62 A;  2EJY A;  3DIW A;  2I6V A;  2X7Z A;  1WJL A;  1TQ3 A;  1ZOK A;  3CBX A;  4YYX A;  3ID1 A;  2ZPM A;  4NMO A;  1UM7 A;  3AXA A;  3HPK A;  4NMT A;  3ZRT A;  5I7Z A;  4F8K A;  2PDZ A;  1KWA A;  3HPM A;  2KOJ A;  3SFJ A;  1FC6 A;  2FCF A;  2KAW A;  2R4H A;  2GZV A;  4JOJ A;  2PZD A;  1N99 A;  1N6F A;  4OEO A;  1U39 A;  1WG6 A;  2K1Z A;  1QAV A;  4PQW A;  3NFK A;  2MHO A;  3QDO A;  5HF1 A;  2DMZ A;  1LCY A;  3DOR A;  2KV8 A;  5H3J A;  1RY4 A;  2EEJ A;  3MH4 A;  1V1T A;  1QAV B;  3R68 A;  3NCV A;  4REY A;  1I16 A;  1VA8 A;  3R69 A;  4K6Y A;  5E1Y A;  1V6B A;  1OBX A;  4NMP A;  1GQ5 A;  3TSZ A;  2DAZ A;  2OSG A;  2W4F A;  5FB8 C;  3VQF A;  1WF7 A;  2KOM A;  1UEP A;  4K78 A;  3I4W A;  3KZE A;  2L4S A;  3EGG C;  2EHR A;  2I1N A;  1X6D A;  2OPG A;  3I1E A;  1Z86 A;  4Q2N A;  3OTP A;  3TSV A;  1W9E A;  1K32 A;  5HJ1 A;  5HFC A;  1U3B A;  1T2M A;  2AWX A;  3GGE A;  2V90 A;  2EGN A;  2BYG A;  2RRM A;  3K1R A;  2EDZ A;  1OBZ A;  3CYY A;  4K72 A;  2JOA A;  2LOB A;  2OMJ A;  1ZUB A;  5HDY A;  2LUI A;  2IWQ A;  1UJV A;  1WI2 A;  1VB7 A;  2Z9I A;  1N7T A;  2UZC A;  1X45 A;  4Q2P A;  2G2L A;  3VQG A;  2O2T A;  2FNE A;  5ILB A;  3KHF A;  1L6O A;  5E11 A;  2FN5 A;  2HE4 A;  2M0T A;  1OZI A;  4JOK A;  3GCN A;  5FHT A;  3R0H A;  3DJ3 A;  3NFL A;  1X9Z A;  2EDV A;  5F3X A;  5HFD A;  2KJP A;  1N7F A;  5HEB A;  2I04 A;  2CS5 A;  2KL1 A;  1X5Q A;  1VAE A;  3KDG A;  2QBW A;  1UEQ A;  2DLS A;  4JJ0 A;  3CBY A;  1YBO A;  4P2A B;  4JOG A;  1WF8 A;  2HGA A;  3GDU A;  4GHN A;  5F67 A;  2JSN A;  4JOP A;  3TSW A;  1X8S A;  1FC7 A;  2E7K A;  2Q3G A;  3PDV A;  1WHD A;  5A2P A;  1PDR A;  3WKL A;  2KYL A;  1KY9 A;  1X5R A;  1MC7 A;  1BE9 A;  1TE0 A;  3QE1 A;  2M10 A;  1NF3 C;  2I0I A;  2YUY A;  2VWR A;  2VZ5 A;  3ID3 A;  3SHU A;  3DJ1 A;  1RGR A;  1I92 A;  2JRE A;  1FCF A;  5IL9 A;  2OS6 A;  2VPH A;  4JJ3 A;  4MPA A;  2KQF A;  3PV5 A;  3RLE A;  3MH7 A;  2AWU A;  1MFL A;  2H3M A;  5E6P B;  5EZ0 A;  2YT7 A;  2KOH A;  2I4S A;  2PKT A;  1Y7N A;  2L4T A;  2DM8 A;  2KJK A;  1UJD A;  2H3L A;  3RL7 A;  1G9O A;  4NXQ A;  2H2B A;  2K20 A;  2M0U A;  3QIK A;  2EGK A;  3O5N A;  4RI0 A;  1P1D A;  2F5Y A;  2LC7 A;  4OAJ A;  1D5G A;  4NMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...