4JOKA

Cftr associated ligand (cal) pdz domain bound to peptide y-ical36 (ansryptsii)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 24
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4jokA00
4Q2QA 2OSGA 4HOPA 1N6FA 1WH1A 2LUIA 3VQGA 4NXQA 1QAUA 1ZUBA 3PDVA 2BYGA 1Z87A 4NMVA 2E7KA 3DIWA 2AINA 3EGGC 4K6YA 3CYYA 4JOEA 3PV2A 3HVQC 3O46A 1I92A 3SOEA 4JORA 4OEOA 3KZDA 2JIKA 3B76A 3NGHA 2VSVA 4K76A 3SHUA 1TP3A 1GM1A 1UFXA 2YUYA 2KL1A 2L4TA 1RGWA 4Q6SA 2YT7A 2Z9IA 1UHPA 4WYTA 2M0UA 4K78A 2HE4A 2DB5A 2KA9A 3HPKA 1U3BA 2EDVA 1Q7XA 2H2CA 2LC6A 4O06A 5I7ZA 4XHVA 1W9QA 2MHOA 2QKVA 3K50A 5E6PB 1FCFA 1UEQA 1RZXA 1WI4A 1V5QA 2R3YA 4P2AB 2KG2A 4GVDA 1W9OA 2AWUA 2EGOA 2UZCA 2M0VA 5HFDA 1UM1A 1QLCA 1WHAA 2EGNA 1KEFA 4N6XA 4JOKA 2YUBA 3OU0A 1XZ9A 2K20A 4NMTA 2F5YA 3L4FD 5FHTA 5H3JA 3MH7A 2H2BA 1PDRA 2P3WA 4R2ZA 1RY4A 5HEDA 1K32A 1TQ3A 2VRFA 2CSSA 2FE5A 3CBYA 3BPUA 3KZEA 3O5NA 5HFFA 5FB8C 2I0IA 1R6JA 2EDZA 5B6LA 5GNDA 1TP5A 2L4SA 4UU5A 5HEYA 2I6VA 4IC6A 1WI2A 1MFLA 1V62A 2PDZA 3GJ9A 1IHJA 2OGPA 4Q2PA 2IWQA 2G5MB 2I1NA 1V1TA 2W4FA 3DJ3A 3TMHA 1GQ4A 3DORA 1I16A 3RL8A 5HDYA 1W9EA 1Q3PA 4MPAA 2AWXA 2HE2A 1UEWA 3GDUA 3QGLA 2KOHA 2L97A 1MC7A 1P1EA 3DJ1A 3ZRTA 3GCOA 1FC9A 2VWRA 2ENOA 1M5ZA 3PV4A 1BFEA 2H3MA 1UF1A 5HF1A 5HFBA 4NMPA 2KOMA 2D8IA 2EXGA 5G1EA 2DC2A 3QJNA 1IU2A 4Q6HA 2EAQA 2D90A 1ZOKA 3R0HA 3OTPA 5G1DA 5HJ1A 1X45A 2M0TA 1SOTA 1V6BA 4KFWA 2DLSA 3QE1A 3NFKA 2QT5A 2ZPLA 3RLEA 1U37A 2OQSA 2HGAA 4LMMA 3I1EA 2G2LA 5E22A 1Z86A 1N99A 3LNXA 2KAWA 2PKTA 2KPLA 1VA8A 3K1RA 3RL7A 1L6OA 2Q3GA 1B8QA 1OBYA 4JOHA 2FCFA 2I0LA 1N6DA 2LC7A 4EDJA 2IWPA 2KYLA 3QDOA 4NMQA 4JL7A 1WG6A 1VCWA 4NNMA 4WYUA 3MH4A 5JXBA 1X8SA 2KRGA 2EDPA 1FC6A 2JINA 1UEZA 2JXOA 1FC7A 2I04A 5E1YA 2QKUA 3PS4A 4Q2OA 2KJKA 2EEHA 4REYA 4F8KA 4Z8JA 2JWEA 4E35A 2KJDA 4GHNA 1GQ5A 1KY9A 2VSPA 3GDSA 3E17A 3MH6A 1OBXA 4NMOA 1WF8A 2M3MA 2KQFA 2KPKA 5EZ0A 3I4WA 3PV5A 4NXRA 2O2TA 1U39A 1UITA 1UJDA 4UU6A 4YDPA 3HPMA 5HF4A 2VPHA 2DKRA 1P1DA 3STJA 2W7RA 2DMZA 3ID3A 4K72A 4FGMA 4JOFA 5HFCA 1U38A 2EEJA 3TSVA 1WHDA 2M10A 1Q3OA 2PZDA 1WFVA 2DJTA 4G69A 3AXAA 2JOAA 2KV8A 3PDZA 1T2MA 3ID1A 1Y7NA 3JXTA 2QKTA 2ZPMA 3GSLA 3QIKA 4P0CA 2JILA 3GDVA 1TE0A 3R69A 4AMHA 2KBSA 2CS5A 2JREA 3WKMA 4NNLA 4RI0A 1WJLA 1N6EA 1Y8TA 2EEIA 4JOPA 1UEPA 5F67A 2AWWA 1SOZA 3R68A 2PNTA 3CS0A 5EYZA 4OAJA 2OS6A 4JOGA 1OZIA 2RCZA 2QBWA 2YT8A 1X5RA 5D13A 2R4HA 2EV8A 4E3BA 2DLUA 3SHWA 2M0ZA 3SUZA 4NMSA 4NXPA 2PKUA 2YTWA 3TSZA 2IWOA 2F0AA 2OPGA 2FNEA 3QO6A 2EJYA 4H11A 1BE9A 5HFEA 3VQFA 1WFGA 1D5GA 1NF3C 4HOPB 2PA1A 5E21A 1N7EA 2CSJA 4PQWA 3NFLA 3GCNA 5E11A 1QAVA 4L8NA 2GZVA 1WF7A 1N7FA 1KWAA 3FY5A 1VJ6A 2REYA 2KJPA 5DTHA 2OCSA 2K1ZA 3CBXA 2LA8A 4E34A 5A2PA 1V5LA 4NMRA 1UM7A 1MFGA 4KFVA 2WL7A 1OBZA 2OZFA 1X5NA 2MX6A 4GVCA 4K75A 2V90A 1LCYA 2Z17A 3K82A 1UJUA 3CH8A 3EGHC 3LNYA 2DAZA 4Q3HA 1UJVA 3GGEA 1WIFA 2KOJA 1G9OA 4JOJA 5HEBA 2H3LA 3TSWA 2Q9VA 1VAEA 2QG1A 3WKLA 3I18A 5F3XA 3CC0A 1QAVB 1IU0A 1YBOA 2VZ5A 4Q2NA 2LOBA 2OMJA 2RRMA 1VB7A 1X6DA 2X7ZA 1N7TA 2FN5A 2EEGA 2EGKA 1RGRA 3DJAA 5HETA 4YYXA 1NTEA 2D92A 1X5QA 5GLJA 2IWNA 2DM8A 3ID4A 3ID2A 3KHFA 2V1WA 3CBZA 4OEPA 3QJMA 2I4SA 4Z33A 2EHRA 3SFJA
chains in the Genus database with same CATH superfamily
4Q2QA 2OSGA 4HOPA 1N6FA 1WH1A 2LUIA 3VQGA 4NXQA 1QAUA 1ZUBA 3PDVA 2GEFA 2BYGA 1X9ZA 1Z87A 4NMVA 2E7KA 3DIWA 2AINA 3EGGC 4K6YA 3CYYA 4JOEA 3PV2A 3HVQC 3O46A 1I92A 3SOEA 4JORA 4OEOA 3KZDA 2JIKA 3B76A 3NGHA 2VSVA 4K76A 3SHUA 1TP3A 1GM1A 1UFXA 2YUYA 2KL1A 2L4TA 1RGWA 4Q6SA 2YT7A 2Z9IA 1UHPA 4WYTA 2M0UA 4K78A 2HE4A 2DB5A 2KA9A 3HPKA 1U3BA 2EDVA 1Q7XA 2H2CA 2LC6A 4O06A 5I7ZA 4XHVA 1W9QA 2MHOA 2QKVA 3K50A 5E6PB 1FCFA 1UEQA 1RZXA 1WI4A 1V5QA 2R3YA 4P2AB 5IL9A 2KG2A 4GVDA 1W9OA 2AWUA 2EGOA 2UZCA 2M0VA 5HFDA 1UM1A 1QLCA 1WHAA 2EGNA 1KEFA 4N6XA 4JOKA 2YUBA 3OU0A 1XZ9A 2K20A 4NMTA 2F5YA 3L4FD 5FHTA 5H3JA 3MH7A 2H2BA 1PDRA 2P3WA 4R2ZA 1RY4A 5HEDA 1K32A 1TQ3A 2VRFA 2CSSA 2FE5A 3CBYA 3BPUA 3KZEA 3O5NA 5HFFA 5FB8C 2I0IA 1R6JA 2EDZA 5B6LA 5GNDA 1TP5A 2L4SA 4UU5A 5HEYA 2I6VA 4IC6A 1WI2A 1MFLA 1V62A 2PDZA 3GJ9A 1IHJA 2OGPA 4Q2PA 2IWQA 2G5MB 2I1NA 1V1TA 2W4FA 3DJ3A 3TMHA 1GQ4A 3DORA 1I16A 3RL8A 5HDYA 1W9EA 1Q3PA 4MPAA 2AWXA 2HE2A 1UEWA 3GDUA 3QGLA 2KOHA 2L97A 1MC7A 1P1EA 3DJ1A 3ZRTA 3GCOA 1FC9A 2VWRA 2ENOA 1M5ZA 3PV4A 1BFEA 2H3MA 1UF1A 5HF1A 5HFBA 4NMPA 2KOMA 2D8IA 2EXGA 3NCVA 5G1EA 2DC2A 3QJNA 1IU2A 4Q6HA 2EAQA 2D90A 1ZOKA 3R0HA 3OTPA 5G1DA 5HJ1A 1X45A 2M0TA 1SOTA 1V6BA 3KDGA 4KFWA 2DLSA 3QE1A 4JJ0A 3NFKA 3KDKA 2QT5A 2ZPLA 3RLEA 1U37A 2OQSA 2HGAA 4LMMA 3I1EA 2G2LA 5E22A 1Z86A 1N99A 3LNXA 2KAWA 2PKTA 2KPLA 1VA8A 4JJ3A 3K1RA 3RL7A 1L6OA 2Q3GA 1B8QA 1OBYA 4JOHA 2FCFA 2I0LA 1N6DA 2LC7A 4EDJA 2IWPA 2KYLA 3QDOA 4NMQA 4JL7A 1WG6A 1VCWA 4NNMA 4WYUA 3MH4A 5JXBA 1X8SA 2KRGA 2EDPA 1FC6A 2JINA 1UEZA 5B42A 2JXOA 1FC7A 2I04A 5E1YA 2QKUA 3PS4A 4Q2OA 2KJKA 2EEHA 4REYA 4F8KA 4Z8JA 2JWEA 4E35A 2KJDA 4GHNA 1GQ5A 1KY9A 2VSPA 3GDSA 3E17A 3MH6A 1OBXA 4NMOA 1WF8A 2M3MA 2KQFA 2KPKA 5EZ0A 3I4WA 3PV5A 4NXRA 2O2TA 1U39A 1UITA 1UJDA 4UU6A 4YDPA 3HPMA 5HF4A 2VPHA 2DKRA 1P1DA 3STJA 2W7RA 2DMZA 3ID3A 3GABA 4K72A 4FGMA 4JOFA 5HFCA 1U38A 2EEJA 3TSVA 1WHDA 2M10A 2JSNA 1Q3OA 2PZDA 1WFVA 2DJTA 4G69A 3AXAA 2JOAA 2KV8A 3PDZA 1T2MA 3ID1A 1Y7NA 3JXTA 2QKTA 2ZPMA 3GSLA 3QIKA 4P0CA 2JILA 3GDVA 1TE0A 3R69A 4AMHA 2KBSA 2CS5A 2JREA 3WKMA 4NNLA 4RI0A 1WJLA 1N6EA 1Y8TA 2EEIA 4JOPA 1UEPA 5F67A 2AWWA 1SOZA 3R68A 2PNTA 3CS0A 5EYZA 4OAJA 2OS6A 4JOGA 1OZIA 2RCZA 2QBWA 2YT8A 1X5RA 5D13A 2R4HA 2EV8A 4E3BA 2DLUA 3SHWA 2M0ZA 3SUZA 4NMSA 4NXPA 2PKUA 2YTWA 3TSZA 2IWOA 2F0AA 2OPGA 2FNEA 3QO6A 2EJYA 4H11A 1BE9A 5HFEA 3VQFA 1WFGA 1D5GA 1NF3C 4HOPB 2PA1A 5E21A 1N7EA 2CSJA 4PQWA 3NFLA 3GCNA 5E11A 1QAVA 4L8NA 2GZVA 1WF7A 1N7FA 1KWAA 3FY5A 1VJ6A 2REYA 2KJPA 5DTHA 2OCSA 2K1ZA 3CBXA 2LA8A 4E34A 5A2PA 1V5LA 4NMRA 1UM7A 1MFGA 4KFVA 2WL7A 1OBZA 2OZFA 1X5NA 2MX6A 4GVCA 4K75A 2V90A 1LCYA 2Z17A 3K82A 1UJUA 3CH8A 3EGHC 3LNYA 2DAZA 4Q3HA 1UJVA 3GGEA 1WIFA 2KOJA 1G9OA 4JOJA 5HEBA 2H3LA 3TSWA 2Q9VA 1VAEA 2QG1A 3WKLA 3I18A 5F3XA 3CC0A 1QAVB 1IU0A 1YBOA 4FLNA 2VZ5A 4Q2NA 2LOBA 2OMJA 2RRMA 1VB7A 1X6DA 2X7ZA 1N7TA 2FN5A 2EEGA 2EGKA 1RGRA 3DJAA 5HETA 4YYXA 1NTEA 2D92A 1X5QA 5GLJA 2IWNA 2DM8A 3ID4A 3ID2A 3KHFA 2V1WA 3CBZA 4OEPA 3QJMA 2I4SA 4Z33A 2EHRA 3SFJA 5ILBA
chains in the Genus database with same CATH topology
4Q2QA 2OSGA 4HOPA 1N6FA 1WH1A 2LUIA 3VQGA 4NXQA 1QAUA 1ZUBA 3PDVA 2GEFA 2BYGA 1X9ZA 1Z87A 4NMVA 2E7KA 3DIWA 2AINA 3EGGC 4K6YA 3CYYA 4JOEA 3PV2A 3HVQC 3O46A 1I92A 3SOEA 4JORA 4OEOA 3KZDA 2JIKA 3B76A 3NGHA 2VSVA 4K76A 3SHUA 1TP3A 1GM1A 1UFXA 2YUYA 2KL1A 2L4TA 1RGWA 4Q6SA 2YT7A 2Z9IA 1UHPA 4WYTA 2M0UA 4K78A 2HE4A 2DB5A 2KA9A 3HPKA 1U3BA 2EDVA 1Q7XA 2H2CA 2LC6A 4O06A 5I7ZA 4XHVA 1W9QA 2MHOA 2QKVA 3K50A 5E6PB 1FCFA 1UEQA 1RZXA 1WI4A 1V5QA 2R3YA 4P2AB 5IL9A 2KG2A 4GVDA 1W9OA 2AWUA 2EGOA 2UZCA 2M0VA 5HFDA 1UM1A 1QLCA 1WHAA 2EGNA 1KEFA 4N6XA 4JOKA 2YUBA 3OU0A 1XZ9A 2K20A 4NMTA 2F5YA 3L4FD 5FHTA 5H3JA 3MH7A 2H2BA 1PDRA 2P3WA 4R2ZA 1RY4A 5HEDA 1K32A 1TQ3A 2VRFA 2CSSA 2FE5A 3CBYA 3BPUA 3KZEA 3O5NA 5HFFA 5FB8C 2I0IA 1R6JA 2EDZA 5B6LA 5GNDA 1TP5A 2L4SA 4UU5A 5HEYA 2I6VA 4IC6A 1WI2A 1MFLA 1V62A 2PDZA 3GJ9A 1IHJA 2OGPA 4Q2PA 2IWQA 2G5MB 2I1NA 1V1TA 2W4FA 3DJ3A 3TMHA 1GQ4A 3DORA 1I16A 3RL8A 5HDYA 1W9EA 1Q3PA 4MPAA 2AWXA 2HE2A 1UEWA 3GDUA 3QGLA 2KOHA 2L97A 1MC7A 1P1EA 3DJ1A 3ZRTA 3GCOA 1FC9A 2VWRA 2ENOA 1M5ZA 3PV4A 1BFEA 2H3MA 1UF1A 5HF1A 5HFBA 4NMPA 2KOMA 2D8IA 2EXGA 3NCVA 5G1EA 2DC2A 3QJNA 1IU2A 4Q6HA 2EAQA 2D90A 1ZOKA 3R0HA 3OTPA 5G1DA 5HJ1A 1X45A 2M0TA 1SOTA 1V6BA 3KDGA 4KFWA 2DLSA 3QE1A 4JJ0A 3NFKA 3KDKA 2QT5A 2ZPLA 3RLEA 1U37A 2OQSA 2HGAA 4LMMA 3I1EA 2G2LA 5E22A 1Z86A 1N99A 3LNXA 2KAWA 2PKTA 2KPLA 1VA8A 4JJ3A 3K1RA 3RL7A 1L6OA 2Q3GA 1B8QA 1OBYA 4JOHA 2FCFA 2I0LA 1N6DA 2LC7A 4EDJA 2IWPA 2KYLA 3QDOA 4NMQA 4JL7A 1WG6A 1VCWA 4NNMA 4WYUA 3MH4A 5JXBA 1X8SA 2KRGA 2EDPA 1FC6A 2JINA 1UEZA 5B42A 2JXOA 1FC7A 2I04A 5E1YA 2QKUA 3PS4A 4Q2OA 2KJKA 2EEHA 4REYA 4F8KA 4Z8JA 2JWEA 4E35A 2KJDA 4GHNA 1GQ5A 1KY9A 2VSPA 3GDSA 3E17A 3MH6A 1OBXA 4NMOA 1WF8A 2M3MA 2KQFA 2KPKA 5EZ0A 3I4WA 3PV5A 4NXRA 2O2TA 1U39A 1UITA 1UJDA 4UU6A 4YDPA 3HPMA 5HF4A 2VPHA 2DKRA 1P1DA 3STJA 2W7RA 2DMZA 3ID3A 3GABA 4K72A 4FGMA 4JOFA 5HFCA 1U38A 2EEJA 3TSVA 1WHDA 2M10A 2JSNA 1Q3OA 2PZDA 1WFVA 2DJTA 4G69A 3AXAA 2JOAA 2KV8A 3PDZA 1T2MA 3ID1A 1Y7NA 3JXTA 2QKTA 2ZPMA 3GSLA 3QIKA 4P0CA 2JILA 3GDVA 1TE0A 3R69A 4AMHA 2KBSA 2CS5A 2JREA 3WKMA 4NNLA 4RI0A 1WJLA 1N6EA 1Y8TA 2EEIA 4JOPA 1UEPA 5F67A 2AWWA 1SOZA 3R68A 2PNTA 3CS0A 5EYZA 4OAJA 2OS6A 4JOGA 1OZIA 2RCZA 2QBWA 2YT8A 1X5RA 5D13A 2R4HA 2EV8A 4E3BA 2DLUA 3SHWA 2M0ZA 3SUZA 4NMSA 4NXPA 2PKUA 2YTWA 3TSZA 2IWOA 2F0AA 2OPGA 2FNEA 3QO6A 2EJYA 4H11A 1BE9A 5HFEA 3VQFA 1WFGA 1D5GA 1NF3C 4HOPB 2PA1A 5E21A 1N7EA 2CSJA 4PQWA 3NFLA 3GCNA 5E11A 1QAVA 4L8NA 2GZVA 1WF7A 1N7FA 1KWAA 3FY5A 1VJ6A 2REYA 2KJPA 5DTHA 2OCSA 2K1ZA 3CBXA 2LA8A 4E34A 5A2PA 1V5LA 4NMRA 1UM7A 1MFGA 4KFVA 2WL7A 1OBZA 2OZFA 1X5NA 2MX6A 4GVCA 4K75A 2V90A 1LCYA 2Z17A 3K82A 1UJUA 3CH8A 3EGHC 3LNYA 2DAZA 4Q3HA 1UJVA 3GGEA 1WIFA 2KOJA 1G9OA 4JOJA 5HEBA 2H3LA 3TSWA 2Q9VA 1VAEA 2QG1A 3WKLA 3I18A 5F3XA 3CC0A 1QAVB 1IU0A 1YBOA 4FLNA 2VZ5A 4Q2NA 2LOBA 2OMJA 2RRMA 1VB7A 1X6DA 2X7ZA 1N7TA 2FN5A 2EEGA 2EGKA 1RGRA 3DJAA 5HETA 4YYXA 1NTEA 2D92A 1X5QA 5GLJA 2IWNA 2DM8A 3ID4A 3ID2A 3KHFA 2V1WA 3CBZA 4OEPA 3QJMA 2I4SA 4Z33A 2EHRA 3SFJA 5ILBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2Q A;  2OSG A;  4HOP A;  1N6F A;  1WH1 A;  2LUI A;  3VQG A;  4NXQ A;  1QAU A;  1ZUB A;  3PDV A;  2BYG A;  1Z87 A;  4NMV A;  2E7K A;  3DIW A;  2AIN A;  3EGG C;  4K6Y A;  3CYY A;  4JOE A;  3PV2 A;  3HVQ C;  3O46 A;  1I92 A;  3SOE A;  4JOR A;  4OEO A;  3KZD A;  2JIK A;  3B76 A;  3NGH A;  2VSV A;  4K76 A;  3SHU A;  1TP3 A;  1GM1 A;  1UFX A;  2YUY A;  2KL1 A;  2L4T A;  1RGW A;  4Q6S A;  2YT7 A;  2Z9I A;  1UHP A;  4WYT A;  2M0U A;  4K78 A;  2HE4 A;  2DB5 A;  2KA9 A;  3HPK A;  1U3B A;  2EDV A;  1Q7X A;  2H2C A;  2LC6 A;  4O06 A;  5I7Z A;  4XHV A;  1W9Q A;  2MHO A;  2QKV A;  3K50 A;  5E6P B;  1FCF A;  1UEQ A;  1RZX A;  1WI4 A;  1V5Q A;  2R3Y A;  4P2A B;  2KG2 A;  4GVD A;  1W9O A;  2AWU A;  2EGO A;  2UZC A;  2M0V A;  5HFD A;  1UM1 A;  1QLC A;  1WHA A;  2EGN A;  1KEF A;  4N6X A;  4JOK A;  2YUB A;  3OU0 A;  1XZ9 A;  2K20 A;  4NMT A;  2F5Y A;  3L4F D;  5FHT A;  5H3J A;  3MH7 A;  2H2B A;  1PDR A;  2P3W A;  4R2Z A;  1RY4 A;  5HED A;  1K32 A;  1TQ3 A;  2VRF A;  2CSS A;  2FE5 A;  3CBY A;  3BPU A;  3KZE A;  3O5N A;  5HFF A;  5FB8 C;  2I0I A;  1R6J A;  2EDZ A;  5B6L A;  5GND A;  1TP5 A;  2L4S A;  4UU5 A;  5HEY A;  2I6V A;  4IC6 A;  1WI2 A;  1MFL A;  1V62 A;  2PDZ A;  3GJ9 A;  1IHJ A;  2OGP A;  4Q2P A;  2IWQ A;  2G5M B;  2I1N A;  1V1T A;  2W4F A;  3DJ3 A;  3TMH A;  1GQ4 A;  3DOR A;  1I16 A;  3RL8 A;  5HDY A;  1W9E A;  1Q3P A;  4MPA A;  2AWX A;  2HE2 A;  1UEW A;  3GDU A;  3QGL A;  2KOH A;  2L97 A;  1MC7 A;  1P1E A;  3DJ1 A;  3ZRT A;  3GCO A;  1FC9 A;  2VWR A;  2ENO A;  1M5Z A;  3PV4 A;  1BFE A;  2H3M A;  1UF1 A;  5HF1 A;  5HFB A;  4NMP A;  2KOM A;  2D8I A;  2EXG A;  5G1E A;  2DC2 A;  3QJN A;  1IU2 A;  4Q6H A;  2EAQ A;  2D90 A;  1ZOK A;  3R0H A;  3OTP A;  5G1D A;  5HJ1 A;  1X45 A;  2M0T A;  1SOT A;  1V6B A;  4KFW A;  2DLS A;  3QE1 A;  3NFK A;  2QT5 A;  2ZPL A;  3RLE A;  1U37 A;  2OQS A;  2HGA A;  4LMM A;  3I1E A;  2G2L A;  5E22 A;  1Z86 A;  1N99 A;  3LNX A;  2KAW A;  2PKT A;  2KPL A;  1VA8 A;  3K1R A;  3RL7 A;  1L6O A;  2Q3G A;  1B8Q A;  1OBY A;  4JOH A;  2FCF A;  2I0L A;  1N6D A;  2LC7 A;  4EDJ A;  2IWP A;  2KYL A;  3QDO A;  4NMQ A;  4JL7 A;  1WG6 A;  1VCW A;  4NNM A;  4WYU A;  3MH4 A;  5JXB A;  1X8S A;  2KRG A;  2EDP A;  1FC6 A;  2JIN A;  1UEZ A;  2JXO A;  1FC7 A;  2I04 A;  5E1Y A;  2QKU A;  3PS4 A;  4Q2O A;  2KJK A;  2EEH A;  4REY A;  4F8K A;  4Z8J A;  2JWE A;  4E35 A;  2KJD A;  4GHN A;  1GQ5 A;  1KY9 A;  2VSP A;  3GDS A;  3E17 A;  3MH6 A;  1OBX A;  4NMO A;  1WF8 A;  2M3M A;  2KQF A;  2KPK A;  5EZ0 A;  3I4W A;  3PV5 A;  4NXR A;  2O2T A;  1U39 A;  1UIT A;  1UJD A;  4UU6 A;  4YDP A;  3HPM A;  5HF4 A;  2VPH A;  2DKR A;  1P1D A;  3STJ A;  2W7R A;  2DMZ A;  3ID3 A;  4K72 A;  4FGM A;  4JOF A;  5HFC A;  1U38 A;  2EEJ A;  3TSV A;  1WHD A;  2M10 A;  1Q3O A;  2PZD A;  1WFV A;  2DJT A;  4G69 A;  3AXA A;  2JOA A;  2KV8 A;  3PDZ A;  1T2M A;  3ID1 A;  1Y7N A;  3JXT A;  2QKT A;  2ZPM A;  3GSL A;  3QIK A;  4P0C A;  2JIL A;  3GDV A;  1TE0 A;  3R69 A;  4AMH A;  2KBS A;  2CS5 A;  2JRE A;  3WKM A;  4NNL A;  4RI0 A;  1WJL A;  1N6E A;  1Y8T A;  2EEI A;  4JOP A;  1UEP A;  5F67 A;  2AWW A;  1SOZ A;  3R68 A;  2PNT A;  3CS0 A;  5EYZ A;  4OAJ A;  2OS6 A;  4JOG A;  1OZI A;  2RCZ A;  2QBW A;  2YT8 A;  1X5R A;  5D13 A;  2R4H A;  2EV8 A;  4E3B A;  2DLU A;  3SHW A;  2M0Z A;  3SUZ A;  4NMS A;  4NXP A;  2PKU A;  2YTW A;  3TSZ A;  2IWO A;  2F0A A;  2OPG A;  2FNE A;  3QO6 A;  2EJY A;  4H11 A;  1BE9 A;  5HFE A;  3VQF A;  1WFG A;  1D5G A;  1NF3 C;  4HOP B;  2PA1 A;  5E21 A;  1N7E A;  2CSJ A;  4PQW A;  3NFL A;  3GCN A;  5E11 A;  1QAV A;  4L8N A;  2GZV A;  1WF7 A;  1N7F A;  1KWA A;  3FY5 A;  1VJ6 A;  2REY A;  2KJP A;  5DTH A;  2OCS A;  2K1Z A;  3CBX A;  2LA8 A;  4E34 A;  5A2P A;  1V5L A;  4NMR A;  1UM7 A;  1MFG A;  4KFV A;  2WL7 A;  1OBZ A;  2OZF A;  1X5N A;  2MX6 A;  4GVC A;  4K75 A;  2V90 A;  1LCY A;  2Z17 A;  3K82 A;  1UJU A;  3CH8 A;  3EGH C;  3LNY A;  2DAZ A;  4Q3H A;  1UJV A;  3GGE A;  1WIF A;  2KOJ A;  1G9O A;  4JOJ A;  5HEB A;  2H3L A;  3TSW A;  2Q9V A;  1VAE A;  2QG1 A;  3WKL A;  3I18 A;  5F3X A;  3CC0 A;  1QAV B;  1IU0 A;  1YBO A;  2VZ5 A;  4Q2N A;  2LOB A;  2OMJ A;  2RRM A;  1VB7 A;  1X6D A;  2X7Z A;  1N7T A;  2FN5 A;  2EEG A;  2EGK A;  1RGR A;  3DJA A;  5HET A;  4YYX A;  1NTE A;  2D92 A;  1X5Q A;  5GLJ A;  2IWN A;  2DM8 A;  3ID4 A;  3ID2 A;  3KHF A;  2V1W A;  3CBZ A;  4OEP A;  3QJM A;  2I4S A;  4Z33 A;  2EHR A;  3SFJ A; 
#chains in the Genus database with same CATH topology
 4Q2Q A;  2OSG A;  4HOP A;  1N6F A;  1WH1 A;  2LUI A;  3VQG A;  4NXQ A;  1QAU A;  1ZUB A;  3PDV A;  2GEF A;  2BYG A;  1X9Z A;  1Z87 A;  4NMV A;  2E7K A;  3DIW A;  2AIN A;  3EGG C;  4K6Y A;  3CYY A;  4JOE A;  3PV2 A;  3HVQ C;  3O46 A;  1I92 A;  3SOE A;  4JOR A;  4OEO A;  3KZD A;  2JIK A;  3B76 A;  3NGH A;  2VSV A;  4K76 A;  3SHU A;  1TP3 A;  1GM1 A;  1UFX A;  2YUY A;  2KL1 A;  2L4T A;  1RGW A;  4Q6S A;  2YT7 A;  2Z9I A;  1UHP A;  4WYT A;  2M0U A;  4K78 A;  2HE4 A;  2DB5 A;  2KA9 A;  3HPK A;  1U3B A;  2EDV A;  1Q7X A;  2H2C A;  2LC6 A;  4O06 A;  5I7Z A;  4XHV A;  1W9Q A;  2MHO A;  2QKV A;  3K50 A;  5E6P B;  1FCF A;  1UEQ A;  1RZX A;  1WI4 A;  1V5Q A;  2R3Y A;  4P2A B;  5IL9 A;  2KG2 A;  4GVD A;  1W9O A;  2AWU A;  2EGO A;  2UZC A;  2M0V A;  5HFD A;  1UM1 A;  1QLC A;  1WHA A;  2EGN A;  1KEF A;  4N6X A;  4JOK A;  2YUB A;  3OU0 A;  1XZ9 A;  2K20 A;  4NMT A;  2F5Y A;  3L4F D;  5FHT A;  5H3J A;  3MH7 A;  2H2B A;  1PDR A;  2P3W A;  4R2Z A;  1RY4 A;  5HED A;  1K32 A;  1TQ3 A;  2VRF A;  2CSS A;  2FE5 A;  3CBY A;  3BPU A;  3KZE A;  3O5N A;  5HFF A;  5FB8 C;  2I0I A;  1R6J A;  2EDZ A;  5B6L A;  5GND A;  1TP5 A;  2L4S A;  4UU5 A;  5HEY A;  2I6V A;  4IC6 A;  1WI2 A;  1MFL A;  1V62 A;  2PDZ A;  3GJ9 A;  1IHJ A;  2OGP A;  4Q2P A;  2IWQ A;  2G5M B;  2I1N A;  1V1T A;  2W4F A;  3DJ3 A;  3TMH A;  1GQ4 A;  3DOR A;  1I16 A;  3RL8 A;  5HDY A;  1W9E A;  1Q3P A;  4MPA A;  2AWX A;  2HE2 A;  1UEW A;  3GDU A;  3QGL A;  2KOH A;  2L97 A;  1MC7 A;  1P1E A;  3DJ1 A;  3ZRT A;  3GCO A;  1FC9 A;  2VWR A;  2ENO A;  1M5Z A;  3PV4 A;  1BFE A;  2H3M A;  1UF1 A;  5HF1 A;  5HFB A;  4NMP A;  2KOM A;  2D8I A;  2EXG A;  3NCV A;  5G1E A;  2DC2 A;  3QJN A;  1IU2 A;  4Q6H A;  2EAQ A;  2D90 A;  1ZOK A;  3R0H A;  3OTP A;  5G1D A;  5HJ1 A;  1X45 A;  2M0T A;  1SOT A;  1V6B A;  3KDG A;  4KFW A;  2DLS A;  3QE1 A;  4JJ0 A;  3NFK A;  3KDK A;  2QT5 A;  2ZPL A;  3RLE A;  1U37 A;  2OQS A;  2HGA A;  4LMM A;  3I1E A;  2G2L A;  5E22 A;  1Z86 A;  1N99 A;  3LNX A;  2KAW A;  2PKT A;  2KPL A;  1VA8 A;  4JJ3 A;  3K1R A;  3RL7 A;  1L6O A;  2Q3G A;  1B8Q A;  1OBY A;  4JOH A;  2FCF A;  2I0L A;  1N6D A;  2LC7 A;  4EDJ A;  2IWP A;  2KYL A;  3QDO A;  4NMQ A;  4JL7 A;  1WG6 A;  1VCW A;  4NNM A;  4WYU A;  3MH4 A;  5JXB A;  1X8S A;  2KRG A;  2EDP A;  1FC6 A;  2JIN A;  1UEZ A;  5B42 A;  2JXO A;  1FC7 A;  2I04 A;  5E1Y A;  2QKU A;  3PS4 A;  4Q2O A;  2KJK A;  2EEH A;  4REY A;  4F8K A;  4Z8J A;  2JWE A;  4E35 A;  2KJD A;  4GHN A;  1GQ5 A;  1KY9 A;  2VSP A;  3GDS A;  3E17 A;  3MH6 A;  1OBX A;  4NMO A;  1WF8 A;  2M3M A;  2KQF A;  2KPK A;  5EZ0 A;  3I4W A;  3PV5 A;  4NXR A;  2O2T A;  1U39 A;  1UIT A;  1UJD A;  4UU6 A;  4YDP A;  3HPM A;  5HF4 A;  2VPH A;  2DKR A;  1P1D A;  3STJ A;  2W7R A;  2DMZ A;  3ID3 A;  3GAB A;  4K72 A;  4FGM A;  4JOF A;  5HFC A;  1U38 A;  2EEJ A;  3TSV A;  1WHD A;  2M10 A;  2JSN A;  1Q3O A;  2PZD A;  1WFV A;  2DJT A;  4G69 A;  3AXA A;  2JOA A;  2KV8 A;  3PDZ A;  1T2M A;  3ID1 A;  1Y7N A;  3JXT A;  2QKT A;  2ZPM A;  3GSL A;  3QIK A;  4P0C A;  2JIL A;  3GDV A;  1TE0 A;  3R69 A;  4AMH A;  2KBS A;  2CS5 A;  2JRE A;  3WKM A;  4NNL A;  4RI0 A;  1WJL A;  1N6E A;  1Y8T A;  2EEI A;  4JOP A;  1UEP A;  5F67 A;  2AWW A;  1SOZ A;  3R68 A;  2PNT A;  3CS0 A;  5EYZ A;  4OAJ A;  2OS6 A;  4JOG A;  1OZI A;  2RCZ A;  2QBW A;  2YT8 A;  1X5R A;  5D13 A;  2R4H A;  2EV8 A;  4E3B A;  2DLU A;  3SHW A;  2M0Z A;  3SUZ A;  4NMS A;  4NXP A;  2PKU A;  2YTW A;  3TSZ A;  2IWO A;  2F0A A;  2OPG A;  2FNE A;  3QO6 A;  2EJY A;  4H11 A;  1BE9 A;  5HFE A;  3VQF A;  1WFG A;  1D5G A;  1NF3 C;  4HOP B;  2PA1 A;  5E21 A;  1N7E A;  2CSJ A;  4PQW A;  3NFL A;  3GCN A;  5E11 A;  1QAV A;  4L8N A;  2GZV A;  1WF7 A;  1N7F A;  1KWA A;  3FY5 A;  1VJ6 A;  2REY A;  2KJP A;  5DTH A;  2OCS A;  2K1Z A;  3CBX A;  2LA8 A;  4E34 A;  5A2P A;  1V5L A;  4NMR A;  1UM7 A;  1MFG A;  4KFV A;  2WL7 A;  1OBZ A;  2OZF A;  1X5N A;  2MX6 A;  4GVC A;  4K75 A;  2V90 A;  1LCY A;  2Z17 A;  3K82 A;  1UJU A;  3CH8 A;  3EGH C;  3LNY A;  2DAZ A;  4Q3H A;  1UJV A;  3GGE A;  1WIF A;  2KOJ A;  1G9O A;  4JOJ A;  5HEB A;  2H3L A;  3TSW A;  2Q9V A;  1VAE A;  2QG1 A;  3WKL A;  3I18 A;  5F3X A;  3CC0 A;  1QAV B;  1IU0 A;  1YBO A;  4FLN A;  2VZ5 A;  4Q2N A;  2LOB A;  2OMJ A;  2RRM A;  1VB7 A;  1X6D A;  2X7Z A;  1N7T A;  2FN5 A;  2EEG A;  2EGK A;  1RGR A;  3DJA A;  5HET A;  4YYX A;  1NTE A;  2D92 A;  1X5Q A;  5GLJ A;  2IWN A;  2DM8 A;  3ID4 A;  3ID2 A;  3KHF A;  2V1W A;  3CBZ A;  4OEP A;  3QJM A;  2I4S A;  4Z33 A;  2EHR A;  3SFJ A;  5ILB A; 
#chains in the Genus database with same CATH homology
 4Q2Q A;  2OSG A;  4HOP A;  1N6F A;  1WH1 A;  2LUI A;  3VQG A;  4NXQ A;  1QAU A;  1ZUB A;  3PDV A;  2GEF A;  2BYG A;  1X9Z A;  1Z87 A;  4NMV A;  2E7K A;  3DIW A;  2AIN A;  3EGG C;  4K6Y A;  3CYY A;  4JOE A;  3PV2 A;  3HVQ C;  3O46 A;  1I92 A;  3SOE A;  4JOR A;  4OEO A;  3KZD A;  2JIK A;  3B76 A;  3NGH A;  2VSV A;  4K76 A;  3SHU A;  1TP3 A;  1GM1 A;  1UFX A;  2YUY A;  2KL1 A;  2L4T A;  1RGW A;  4Q6S A;  2YT7 A;  2Z9I A;  1UHP A;  4WYT A;  2M0U A;  4K78 A;  2HE4 A;  2DB5 A;  2KA9 A;  3HPK A;  1U3B A;  2EDV A;  1Q7X A;  2H2C A;  2LC6 A;  4O06 A;  5I7Z A;  4XHV A;  1W9Q A;  2MHO A;  2QKV A;  3K50 A;  5E6P B;  1FCF A;  1UEQ A;  1RZX A;  1WI4 A;  1V5Q A;  2R3Y A;  4P2A B;  5IL9 A;  2KG2 A;  4GVD A;  1W9O A;  2AWU A;  2EGO A;  2UZC A;  2M0V A;  5HFD A;  1UM1 A;  1QLC A;  1WHA A;  2EGN A;  1KEF A;  4N6X A;  4JOK A;  2YUB A;  3OU0 A;  1XZ9 A;  2K20 A;  4NMT A;  2F5Y A;  3L4F D;  5FHT A;  5H3J A;  3MH7 A;  2H2B A;  1PDR A;  2P3W A;  4R2Z A;  1RY4 A;  5HED A;  1K32 A;  1TQ3 A;  2VRF A;  2CSS A;  2FE5 A;  3CBY A;  3BPU A;  3KZE A;  3O5N A;  5HFF A;  5FB8 C;  2I0I A;  1R6J A;  2EDZ A;  5B6L A;  5GND A;  1TP5 A;  2L4S A;  4UU5 A;  5HEY A;  2I6V A;  4IC6 A;  1WI2 A;  1MFL A;  1V62 A;  2PDZ A;  3GJ9 A;  1IHJ A;  2OGP A;  4Q2P A;  2IWQ A;  2G5M B;  2I1N A;  1V1T A;  2W4F A;  3DJ3 A;  3TMH A;  1GQ4 A;  3DOR A;  1I16 A;  3RL8 A;  5HDY A;  1W9E A;  1Q3P A;  4MPA A;  2AWX A;  2HE2 A;  1UEW A;  3GDU A;  3QGL A;  2KOH A;  2L97 A;  1MC7 A;  1P1E A;  3DJ1 A;  3ZRT A;  3GCO A;  1FC9 A;  2VWR A;  2ENO A;  1M5Z A;  3PV4 A;  1BFE A;  2H3M A;  1UF1 A;  5HF1 A;  5HFB A;  4NMP A;  2KOM A;  2D8I A;  2EXG A;  3NCV A;  5G1E A;  2DC2 A;  3QJN A;  1IU2 A;  4Q6H A;  2EAQ A;  2D90 A;  1ZOK A;  3R0H A;  3OTP A;  5G1D A;  5HJ1 A;  1X45 A;  2M0T A;  1SOT A;  1V6B A;  3KDG A;  4KFW A;  2DLS A;  3QE1 A;  4JJ0 A;  3NFK A;  3KDK A;  2QT5 A;  2ZPL A;  3RLE A;  1U37 A;  2OQS A;  2HGA A;  4LMM A;  3I1E A;  2G2L A;  5E22 A;  1Z86 A;  1N99 A;  3LNX A;  2KAW A;  2PKT A;  2KPL A;  1VA8 A;  4JJ3 A;  3K1R A;  3RL7 A;  1L6O A;  2Q3G A;  1B8Q A;  1OBY A;  4JOH A;  2FCF A;  2I0L A;  1N6D A;  2LC7 A;  4EDJ A;  2IWP A;  2KYL A;  3QDO A;  4NMQ A;  4JL7 A;  1WG6 A;  1VCW A;  4NNM A;  4WYU A;  3MH4 A;  5JXB A;  1X8S A;  2KRG A;  2EDP A;  1FC6 A;  2JIN A;  1UEZ A;  5B42 A;  2JXO A;  1FC7 A;  2I04 A;  5E1Y A;  2QKU A;  3PS4 A;  4Q2O A;  2KJK A;  2EEH A;  4REY A;  4F8K A;  4Z8J A;  2JWE A;  4E35 A;  2KJD A;  4GHN A;  1GQ5 A;  1KY9 A;  2VSP A;  3GDS A;  3E17 A;  3MH6 A;  1OBX A;  4NMO A;  1WF8 A;  2M3M A;  2KQF A;  2KPK A;  5EZ0 A;  3I4W A;  3PV5 A;  4NXR A;  2O2T A;  1U39 A;  1UIT A;  1UJD A;  4UU6 A;  4YDP A;  3HPM A;  5HF4 A;  2VPH A;  2DKR A;  1P1D A;  3STJ A;  2W7R A;  2DMZ A;  3ID3 A;  3GAB A;  4K72 A;  4FGM A;  4JOF A;  5HFC A;  1U38 A;  2EEJ A;  3TSV A;  1WHD A;  2M10 A;  2JSN A;  1Q3O A;  2PZD A;  1WFV A;  2DJT A;  4G69 A;  3AXA A;  2JOA A;  2KV8 A;  3PDZ A;  1T2M A;  3ID1 A;  1Y7N A;  3JXT A;  2QKT A;  2ZPM A;  3GSL A;  3QIK A;  4P0C A;  2JIL A;  3GDV A;  1TE0 A;  3R69 A;  4AMH A;  2KBS A;  2CS5 A;  2JRE A;  3WKM A;  4NNL A;  4RI0 A;  1WJL A;  1N6E A;  1Y8T A;  2EEI A;  4JOP A;  1UEP A;  5F67 A;  2AWW A;  1SOZ A;  3R68 A;  2PNT A;  3CS0 A;  5EYZ A;  4OAJ A;  2OS6 A;  4JOG A;  1OZI A;  2RCZ A;  2QBW A;  2YT8 A;  1X5R A;  5D13 A;  2R4H A;  2EV8 A;  4E3B A;  2DLU A;  3SHW A;  2M0Z A;  3SUZ A;  4NMS A;  4NXP A;  2PKU A;  2YTW A;  3TSZ A;  2IWO A;  2F0A A;  2OPG A;  2FNE A;  3QO6 A;  2EJY A;  4H11 A;  1BE9 A;  5HFE A;  3VQF A;  1WFG A;  1D5G A;  1NF3 C;  4HOP B;  2PA1 A;  5E21 A;  1N7E A;  2CSJ A;  4PQW A;  3NFL A;  3GCN A;  5E11 A;  1QAV A;  4L8N A;  2GZV A;  1WF7 A;  1N7F A;  1KWA A;  3FY5 A;  1VJ6 A;  2REY A;  2KJP A;  5DTH A;  2OCS A;  2K1Z A;  3CBX A;  2LA8 A;  4E34 A;  5A2P A;  1V5L A;  4NMR A;  1UM7 A;  1MFG A;  4KFV A;  2WL7 A;  1OBZ A;  2OZF A;  1X5N A;  2MX6 A;  4GVC A;  4K75 A;  2V90 A;  1LCY A;  2Z17 A;  3K82 A;  1UJU A;  3CH8 A;  3EGH C;  3LNY A;  2DAZ A;  4Q3H A;  1UJV A;  3GGE A;  1WIF A;  2KOJ A;  1G9O A;  4JOJ A;  5HEB A;  2H3L A;  3TSW A;  2Q9V A;  1VAE A;  2QG1 A;  3WKL A;  3I18 A;  5F3X A;  3CC0 A;  1QAV B;  1IU0 A;  1YBO A;  4FLN A;  2VZ5 A;  4Q2N A;  2LOB A;  2OMJ A;  2RRM A;  1VB7 A;  1X6D A;  2X7Z A;  1N7T A;  2FN5 A;  2EEG A;  2EGK A;  1RGR A;  3DJA A;  5HET A;  4YYX A;  1NTE A;  2D92 A;  1X5Q A;  5GLJ A;  2IWN A;  2DM8 A;  3ID4 A;  3ID2 A;  3KHF A;  2V1W A;  3CBZ A;  4OEP A;  3QJM A;  2I4S A;  4Z33 A;  2EHR A;  3SFJ A;  5ILB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...