3WKMA

The periplasmic pdz tandem fragment of the rsep homologue from aquifex aeolicus in complex with the fab fragment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
176
Chain Sequence
VPKYLKEPVVVGYVQRDSIAQKIGIKPGDKIIKINGYEVRTWEDLRDALIRLSLDGVKETTLFLERNGEVLHLTIKVPNVQKGEELGIAPLVKPVVGGVKKGSPADQVGIKPGDLILEVNGKKINTWYELVEEVRKSQGKAIKLKILRNGKMIEKELIPAKDPKTGTYFIGLFPKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative zinc metalloprotease aq_1964
publication title A Structure-Based Model of Substrate Discrimination by a Noncanonical PDZ Tandem in the Intramembrane-Cleaving Protease RseP
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 45
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3wkmA01
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3wkmA02
1U3BA 2QT5A 1MFGA 1WFVA 3GDSA 2KAWA 1UEZA 4EDJA 3TSZA 1U39A 2R4HA 2EEJA 3K82A 3WKLA 3QIKA 4KFVA 1I92A 3MH4A 4WYTA 5B6LA 1K32A 1UFXA 2PNTA 2OQSA 4YYXA 1OZIA 2VZ5A 2KV8A 1Z86A 1QAUA 2I4SA 4Q2PA 3GGEA 2WL7A 2JIKA 2M3MA 2KBSA 1RGWA 3R0HA 1Y7NA 3R68A 3MH6A 1GQ5A 3VQGA 1R6JA 3TSWA 3CC0A 2VRFA 1QLCA 2G2LA 2W7RA 1FC9A 1XZ9A 2EGNA 1QAVB 2F0AA 5DTHA 1PDRA 3GDVA 3QE1A 4E35A 2M0UA 2OS6A 5HFFA 2VPHA 3ID1A 3ID4A 2KQFA 2F5YA 1BFEA 1V62A 2EEIA 5E21A 1NTEA 3O5NA 4REYA 4Q2OA 2DLSA 1IU0A 2LOBA 2KL1A 3STJA 1RZXA 1X6DA 3I4WA 1L6OA 2EEGA 4WYUA 2M0VA 4JOKA 5HETA 5FHTA 4K76A 1P1EA 1TQ3A 2EGKA 2QG1A 2IWNA 2IWQA 2KYLA 4K6YA 2MHOA 2AWWA 2H2CA 2KJKA 2IWPA 5G1EA 1VA8A 2LUIA 2EDZA 4UU6A 4Q6SA 3FY5A 1X5QA 5HDYA 4RI0A 2EXGA 1WI2A 1N7EA 3TMHA 3VQFA 2QBWA 2ZPLA 1X8SA 1Q3OA 3GJ9A 2M10A 4G69A 3LNXA 4NMOA 2QKVA 4NNLA 5HEBA 4P2AB 1VAEA 4O06A 2H2BA 5HJ1A 2OZFA 2I04A 2DKRA 4JOEA 2I0LA 4P0CA 2PZDA 1V6BA 2L4SA 3GDUA 2VSPA 1FC6A 1WF8A 2KRGA 3B76A 5F67A 3QJNA 1UHPA 3EGHC 4NXQA 1WF7A 1MFLA 4K78A 3DJ3A 3CBZA 4JOFA 5I7ZA 2X7ZA 2ZPMA 1N6EA 2YT8A 1KWAA 2HE2A 3PDZA 2DAZA 3K50A 1BE9A 1V5QA 2REYA 2FE5A 3MH7A 1N7FA 3HPKA 2DMZA 2DM8A 2V90A 2Z9IA 3CH8A 3QGLA 2KJPA 1Y8TA 4JOHA 1KEFA 2PKUA 4NMRA 5HF4A 2K1ZA 4LMMA 3PV5A 1SOZA 1RY4A 2G5MB 1N6FA 3SOEA 3O46A 2EV8A 4UU5A 2FNEA 2DB5A 2KPLA 4KFWA 4N6XA 4NMPA 3ID2A 4F8KA 2H3MA 1QAVA 1IHJA 5HFEA 2H3LA 3CYYA 2PA1A 1I16A 1FCFA 2R3YA 3E17A 4NXPA 1W9QA 3NGHA 3LNYA 2KOHA 5HFDA 3CBXA 2KOMA 2CSSA 4NMVA 2IWOA 5H3JA 3SHWA 1OBZA 4JOGA 1MC7A 2V1WA 2HE4A 2D90A 2QKTA 1D5GA 3GCOA 2YT7A 2P3WA 5E22A 2JINA 4PQWA 3GSLA 4K72A 1KY9A 3OU0A 4GVCA 4OEPA 2KA9A 1X45A 1VB7A 3I18A 4HOPB 2DLUA 2RRMA 3I1EA 3KZDA 1M5ZA 2FN5A 2LC7A 4NMSA 2OPGA 2YUBA 2DJTA 1UJDA 3PV4A 2KOJA 2Q9VA 1UITA 2Z17A 2L4TA 3K1RA 2I6VA 4Q2NA 2O2TA 1TP5A 5HF1A 3QO6A 3RL7A 3NFKA 1WG6A 2KJDA 1U38A 1NF3C 5G1DA 1UM7A 2YTWA 4NXRA 4NMTA 2KPKA 5HFBA 1N99A 3BPUA 1V1TA 5GLJA 2L97A 3PS4A 5HFCA 3CS0A 3PV2A 2AWUA 2EDPA 2OMJA 2JXOA 1G9OA 2K20A 1W9OA 4Z8JA 1TP3A 5E6PB 1GQ4A 4AMHA 1W9EA 1P1DA 2E7KA 2UZCA 1N7TA 3HPMA 1N6DA 3SFJA 2CSJA 4IC6A 2LA8A 4NMQA 4JL7A 1UEPA 2RCZA 3HVQC 4JORA 3WKMA 3L4FD 2I1NA 2OCSA 2D92A 5D13A 2D8IA 4L8NA 2LC6A 4H11A 1UM1A 2FCFA 5EZ0A 1TE0A 1YBOA 3RLEA 2JOAA 4MPAA 1GM1A 2KG2A 1Q3PA 4Z33A 5JXBA 3QDOA 1V5LA 2EAQA 3OTPA 4Q3HA 1T2MA 2EGOA 4YDPA 1Z87A 2EDVA 1UF1A 4NNMA 2AWXA 2YUYA 5A2PA 1WH1A 4FGMA 5HEDA 2ENOA 3CBYA 1ZUBA 2MX6A 2I0IA 1ZOKA 3R69A 1OBXA 1WHDA 3GCNA 1LCYA 2CS5A 3RL8A 4GVDA 2OSGA 1UJUA 4R2ZA 1B8QA 2BYGA 4JOPA 5GNDA 4K75A 1Q7XA 4HOPA 3SHUA 1WJLA 2M0ZA 3NFLA 2EEHA 1UEQA 2AINA 2PDZA 5E11A 4OAJA 2Q3GA 4E3BA 2W4FA 1UJVA 3SUZA 3ZRTA 3PDVA 2JWEA 4XHVA 5FB8C 1WHAA 4Q6HA 1WIFA 2JREA 2PKTA 1VCWA 3DJAA 1WFGA 1WI4A 3QJMA 1X5NA 2EHRA 5E1YA 2QKUA 2DC2A 3EGGC 1U37A 2OGPA 4JOJA 1SOTA 5HEYA 1OBYA 2JILA 1VJ6A 3DJ1A 5EYZA 1X5RA 5F3XA 4E34A 3JXTA 3ID3A 2M0TA 2GZVA 3DORA 2HGAA 3AXAA 2VWRA 1FC7A 1IU2A 3TSVA 1RGRA 4GHNA 3KZEA 3DIWA 2VSVA 3KHFA 4OEOA 4Q2QA 1UEWA 2EJYA
chains in the Genus database with same CATH superfamily
1U3BA 2QT5A 1MFGA 1WFVA 3GDSA 2KAWA 1UEZA 4EDJA 3TSZA 1U39A 2R4HA 2EEJA 3K82A 3WKLA 3QIKA 4KFVA 1I92A 3MH4A 4WYTA 5B6LA 1K32A 1UFXA 2PNTA 2OQSA 4YYXA 1OZIA 2VZ5A 2KV8A 1Z86A 4JJ0A 1QAUA 2I4SA 4Q2PA 3GGEA 2WL7A 2JIKA 2M3MA 2KBSA 1RGWA 3R0HA 1Y7NA 3R68A 3MH6A 1GQ5A 3VQGA 1R6JA 3TSWA 3CC0A 2VRFA 1QLCA 2G2LA 2W7RA 1FC9A 1XZ9A 2EGNA 1QAVB 2F0AA 5DTHA 1PDRA 3GDVA 3QE1A 4FLNA 4E35A 2M0UA 2OS6A 5HFFA 2VPHA 3ID1A 3ID4A 2KQFA 2F5YA 1BFEA 1V62A 2EEIA 5E21A 1NTEA 3O5NA 4REYA 4Q2OA 2DLSA 1IU0A 2LOBA 2KL1A 3STJA 1RZXA 1X6DA 3I4WA 1L6OA 2EEGA 4WYUA 2M0VA 4JOKA 5HETA 5FHTA 4K76A 1P1EA 1TQ3A 2EGKA 2QG1A 2IWNA 2IWQA 2KYLA 4K6YA 2MHOA 2AWWA 2H2CA 2KJKA 2IWPA 5G1EA 1VA8A 2LUIA 2EDZA 4UU6A 4Q6SA 3FY5A 1X5QA 5HDYA 4RI0A 2EXGA 1WI2A 1N7EA 3TMHA 3VQFA 2QBWA 2ZPLA 1X8SA 1Q3OA 3GJ9A 2M10A 4G69A 3LNXA 4NMOA 2QKVA 4NNLA 5HEBA 4P2AB 1VAEA 4O06A 2H2BA 5HJ1A 2OZFA 2I04A 2DKRA 4JOEA 2I0LA 4P0CA 2PZDA 1V6BA 2L4SA 3GDUA 2VSPA 1FC6A 1WF8A 2KRGA 3B76A 5F67A 3QJNA 1UHPA 3EGHC 4NXQA 1WF7A 1MFLA 4K78A 3DJ3A 3CBZA 4JOFA 5I7ZA 2X7ZA 2ZPMA 1N6EA 2YT8A 1KWAA 2HE2A 3PDZA 2DAZA 3K50A 1BE9A 1V5QA 2REYA 2FE5A 3MH7A 1N7FA 3HPKA 2DMZA 3NCVA 3KDGA 2DM8A 2V90A 2Z9IA 3CH8A 3QGLA 2KJPA 1Y8TA 4JOHA 1KEFA 2PKUA 4NMRA 3GABA 5HF4A 2K1ZA 4LMMA 3PV5A 1SOZA 1RY4A 2G5MB 1N6FA 3SOEA 3O46A 2EV8A 4UU5A 2FNEA 2DB5A 2KPLA 4KFWA 4N6XA 4NMPA 3ID2A 4F8KA 2H3MA 1QAVA 1IHJA 5HFEA 2H3LA 3CYYA 2PA1A 1I16A 1FCFA 2R3YA 3E17A 4NXPA 1W9QA 3NGHA 3LNYA 2KOHA 5HFDA 3CBXA 2KOMA 2CSSA 4NMVA 2IWOA 5H3JA 3SHWA 1OBZA 4JOGA 1MC7A 2V1WA 2HE4A 2D90A 2QKTA 1D5GA 3GCOA 2YT7A 2P3WA 5E22A 2JINA 4PQWA 3GSLA 4K72A 1KY9A 3OU0A 4GVCA 4OEPA 2KA9A 1X45A 1VB7A 3I18A 4HOPB 2DLUA 2RRMA 3I1EA 3KZDA 1M5ZA 2FN5A 2LC7A 3KDKA 4NMSA 2OPGA 2YUBA 2DJTA 1UJDA 3PV4A 2KOJA 2Q9VA 1UITA 2Z17A 2L4TA 3K1RA 2I6VA 4Q2NA 2O2TA 1TP5A 5HF1A 3QO6A 3RL7A 3NFKA 1WG6A 2KJDA 1U38A 1NF3C 5G1DA 1UM7A 2YTWA 4NXRA 4NMTA 2KPKA 5HFBA 1N99A 3BPUA 1V1TA 4JJ3A 5GLJA 5ILBA 2L97A 3PS4A 5HFCA 3CS0A 3PV2A 2AWUA 2EDPA 2OMJA 2JXOA 1G9OA 2K20A 1W9OA 4Z8JA 1TP3A 5E6PB 2JSNA 1GQ4A 4AMHA 1W9EA 1P1DA 2E7KA 2UZCA 1N7TA 3HPMA 1N6DA 3SFJA 2CSJA 4IC6A 2LA8A 4NMQA 4JL7A 1UEPA 2RCZA 3HVQC 4JORA 3WKMA 3L4FD 2I1NA 2OCSA 2D92A 5D13A 2D8IA 4L8NA 2LC6A 4H11A 1UM1A 2FCFA 5EZ0A 1TE0A 1YBOA 3RLEA 2JOAA 4MPAA 1GM1A 2KG2A 1Q3PA 4Z33A 5JXBA 3QDOA 1V5LA 2EAQA 3OTPA 4Q3HA 5B42A 1T2MA 2EGOA 4YDPA 1Z87A 2EDVA 1UF1A 4NNMA 2AWXA 2YUYA 5A2PA 1WH1A 4FGMA 5HEDA 2ENOA 3CBYA 1ZUBA 2MX6A 2I0IA 1ZOKA 3R69A 1OBXA 1WHDA 3GCNA 1LCYA 2CS5A 3RL8A 4GVDA 2OSGA 1UJUA 4R2ZA 1B8QA 2BYGA 4JOPA 5GNDA 4K75A 1Q7XA 4HOPA 3SHUA 1WJLA 2M0ZA 3NFLA 2EEHA 1UEQA 2AINA 2PDZA 5E11A 4OAJA 2Q3GA 4E3BA 2W4FA 1UJVA 3SUZA 3ZRTA 2GEFA 3PDVA 2JWEA 4XHVA 5FB8C 1WHAA 4Q6HA 1WIFA 2JREA 2PKTA 1VCWA 3DJAA 1WFGA 1WI4A 3QJMA 1X5NA 2EHRA 5E1YA 1X9ZA 2QKUA 2DC2A 3EGGC 1U37A 2OGPA 4JOJA 1SOTA 5HEYA 1OBYA 2JILA 1VJ6A 3DJ1A 5IL9A 5EYZA 1X5RA 5F3XA 4E34A 3JXTA 3ID3A 2M0TA 2GZVA 3DORA 2HGAA 3AXAA 2VWRA 1FC7A 1IU2A 3TSVA 1RGRA 4GHNA 3KZEA 3DIWA 2VSVA 3KHFA 4OEOA 4Q2QA 1UEWA 2EJYA
chains in the Genus database with same CATH topology
1U3BA 2QT5A 1MFGA 1WFVA 3GDSA 2KAWA 1UEZA 4EDJA 3TSZA 1U39A 2R4HA 2EEJA 3K82A 3WKLA 3QIKA 4KFVA 1I92A 3MH4A 4WYTA 5B6LA 1K32A 1UFXA 2PNTA 2OQSA 4YYXA 1OZIA 2VZ5A 2KV8A 1Z86A 4JJ0A 1QAUA 2I4SA 4Q2PA 3GGEA 2WL7A 2JIKA 2M3MA 2KBSA 1RGWA 3R0HA 1Y7NA 3R68A 3MH6A 1GQ5A 3VQGA 1R6JA 3TSWA 3CC0A 2VRFA 1QLCA 2G2LA 2W7RA 1FC9A 1XZ9A 2EGNA 1QAVB 2F0AA 5DTHA 1PDRA 3GDVA 3QE1A 4FLNA 4E35A 2M0UA 2OS6A 5HFFA 2VPHA 3ID1A 3ID4A 2KQFA 2F5YA 1BFEA 1V62A 2EEIA 5E21A 1NTEA 3O5NA 4REYA 4Q2OA 2DLSA 1IU0A 2LOBA 2KL1A 3STJA 1RZXA 1X6DA 3I4WA 1L6OA 2EEGA 4WYUA 2M0VA 4JOKA 5HETA 5FHTA 4K76A 1P1EA 1TQ3A 2EGKA 2QG1A 2IWNA 2IWQA 2KYLA 4K6YA 2MHOA 2AWWA 2H2CA 2KJKA 2IWPA 5G1EA 1VA8A 2LUIA 2EDZA 4UU6A 4Q6SA 3FY5A 1X5QA 5HDYA 4RI0A 2EXGA 1WI2A 1N7EA 3TMHA 3VQFA 2QBWA 2ZPLA 1X8SA 1Q3OA 3GJ9A 2M10A 4G69A 3LNXA 4NMOA 2QKVA 4NNLA 5HEBA 4P2AB 1VAEA 4O06A 2H2BA 5HJ1A 2OZFA 2I04A 2DKRA 4JOEA 2I0LA 4P0CA 2PZDA 1V6BA 2L4SA 3GDUA 2VSPA 1FC6A 1WF8A 2KRGA 3B76A 5F67A 3QJNA 1UHPA 3EGHC 4NXQA 1WF7A 1MFLA 4K78A 3DJ3A 3CBZA 4JOFA 5I7ZA 2X7ZA 2ZPMA 1N6EA 2YT8A 1KWAA 2HE2A 3PDZA 2DAZA 3K50A 1BE9A 1V5QA 2REYA 2FE5A 3MH7A 1N7FA 3HPKA 2DMZA 3NCVA 3KDGA 2DM8A 2V90A 2Z9IA 3CH8A 3QGLA 2KJPA 1Y8TA 4JOHA 1KEFA 2PKUA 4NMRA 3GABA 5HF4A 2K1ZA 4LMMA 3PV5A 1SOZA 1RY4A 2G5MB 1N6FA 3SOEA 3O46A 2EV8A 4UU5A 2FNEA 2DB5A 2KPLA 4KFWA 4N6XA 4NMPA 3ID2A 4F8KA 2H3MA 1QAVA 1IHJA 5HFEA 2H3LA 3CYYA 2PA1A 1I16A 1FCFA 2R3YA 3E17A 4NXPA 1W9QA 3NGHA 3LNYA 2KOHA 5HFDA 3CBXA 2KOMA 2CSSA 4NMVA 2IWOA 5H3JA 3SHWA 1OBZA 4JOGA 1MC7A 2V1WA 2HE4A 2D90A 2QKTA 1D5GA 3GCOA 2YT7A 2P3WA 5E22A 2JINA 4PQWA 3GSLA 4K72A 1KY9A 3OU0A 4GVCA 4OEPA 2KA9A 1X45A 1VB7A 3I18A 4HOPB 2DLUA 2RRMA 3I1EA 3KZDA 1M5ZA 2FN5A 2LC7A 3KDKA 4NMSA 2OPGA 2YUBA 2DJTA 1UJDA 3PV4A 2KOJA 2Q9VA 1UITA 2Z17A 2L4TA 3K1RA 2I6VA 4Q2NA 2O2TA 1TP5A 5HF1A 3QO6A 3RL7A 3NFKA 1WG6A 2KJDA 1U38A 1NF3C 5G1DA 1UM7A 2YTWA 4NXRA 4NMTA 2KPKA 5HFBA 1N99A 3BPUA 1V1TA 4JJ3A 5GLJA 5ILBA 2L97A 3PS4A 5HFCA 3CS0A 3PV2A 2AWUA 2EDPA 2OMJA 2JXOA 1G9OA 2K20A 1W9OA 4Z8JA 1TP3A 5E6PB 2JSNA 1GQ4A 4AMHA 1W9EA 1P1DA 2E7KA 2UZCA 1N7TA 3HPMA 1N6DA 3SFJA 2CSJA 4IC6A 2LA8A 4NMQA 4JL7A 1UEPA 2RCZA 3HVQC 4JORA 3WKMA 3L4FD 2I1NA 2OCSA 2D92A 5D13A 2D8IA 4L8NA 2LC6A 4H11A 1UM1A 2FCFA 5EZ0A 1TE0A 1YBOA 3RLEA 2JOAA 4MPAA 1GM1A 2KG2A 1Q3PA 4Z33A 5JXBA 3QDOA 1V5LA 2EAQA 3OTPA 4Q3HA 5B42A 1T2MA 2EGOA 4YDPA 1Z87A 2EDVA 1UF1A 4NNMA 2AWXA 2YUYA 5A2PA 1WH1A 4FGMA 5HEDA 2ENOA 3CBYA 1ZUBA 2MX6A 2I0IA 1ZOKA 3R69A 1OBXA 1WHDA 3GCNA 1LCYA 2CS5A 3RL8A 4GVDA 2OSGA 1UJUA 4R2ZA 1B8QA 2BYGA 4JOPA 5GNDA 4K75A 1Q7XA 4HOPA 3SHUA 1WJLA 2M0ZA 3NFLA 2EEHA 1UEQA 2AINA 2PDZA 5E11A 4OAJA 2Q3GA 4E3BA 2W4FA 1UJVA 3SUZA 3ZRTA 2GEFA 3PDVA 2JWEA 4XHVA 5FB8C 1WHAA 4Q6HA 1WIFA 2JREA 2PKTA 1VCWA 3DJAA 1WFGA 1WI4A 3QJMA 1X5NA 2EHRA 5E1YA 1X9ZA 2QKUA 2DC2A 3EGGC 1U37A 2OGPA 4JOJA 1SOTA 5HEYA 1OBYA 2JILA 1VJ6A 3DJ1A 5IL9A 5EYZA 1X5RA 5F3XA 4E34A 3JXTA 3ID3A 2M0TA 2GZVA 3DORA 2HGAA 3AXAA 2VWRA 1FC7A 1IU2A 3TSVA 1RGRA 4GHNA 3KZEA 3DIWA 2VSVA 3KHFA 4OEOA 4Q2QA 1UEWA 2EJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3B A;  2QT5 A;  1MFG A;  1WFV A;  3GDS A;  2KAW A;  1UEZ A;  4EDJ A;  3TSZ A;  1U39 A;  2R4H A;  2EEJ A;  3K82 A;  3WKL A;  3QIK A;  4KFV A;  1I92 A;  3MH4 A;  4WYT A;  5B6L A;  1K32 A;  1UFX A;  2PNT A;  2OQS A;  4YYX A;  1OZI A;  2VZ5 A;  2KV8 A;  1Z86 A;  1QAU A;  2I4S A;  4Q2P A;  3GGE A;  2WL7 A;  2JIK A;  2M3M A;  2KBS A;  1RGW A;  3R0H A;  1Y7N A;  3R68 A;  3MH6 A;  1GQ5 A;  3VQG A;  1R6J A;  3TSW A;  3CC0 A;  2VRF A;  1QLC A;  2G2L A;  2W7R A;  1FC9 A;  1XZ9 A;  2EGN A;  1QAV B;  2F0A A;  5DTH A;  1PDR A;  3GDV A;  3QE1 A;  4E35 A;  2M0U A;  2OS6 A;  5HFF A;  2VPH A;  3ID1 A;  3ID4 A;  2KQF A;  2F5Y A;  1BFE A;  1V62 A;  2EEI A;  5E21 A;  1NTE A;  3O5N A;  4REY A;  4Q2O A;  2DLS A;  1IU0 A;  2LOB A;  2KL1 A;  3STJ A;  1RZX A;  1X6D A;  3I4W A;  1L6O A;  2EEG A;  4WYU A;  2M0V A;  4JOK A;  5HET A;  5FHT A;  4K76 A;  1P1E A;  1TQ3 A;  2EGK A;  2QG1 A;  2IWN A;  2IWQ A;  2KYL A;  4K6Y A;  2MHO A;  2AWW A;  2H2C A;  2KJK A;  2IWP A;  5G1E A;  1VA8 A;  2LUI A;  2EDZ A;  4UU6 A;  4Q6S A;  3FY5 A;  1X5Q A;  5HDY A;  4RI0 A;  2EXG A;  1WI2 A;  1N7E A;  3TMH A;  3VQF A;  2QBW A;  2ZPL A;  1X8S A;  1Q3O A;  3GJ9 A;  2M10 A;  4G69 A;  3LNX A;  4NMO A;  2QKV A;  4NNL A;  5HEB A;  4P2A B;  1VAE A;  4O06 A;  2H2B A;  5HJ1 A;  2OZF A;  2I04 A;  2DKR A;  4JOE A;  2I0L A;  4P0C A;  2PZD A;  1V6B A;  2L4S A;  3GDU A;  2VSP A;  1FC6 A;  1WF8 A;  2KRG A;  3B76 A;  5F67 A;  3QJN A;  1UHP A;  3EGH C;  4NXQ A;  1WF7 A;  1MFL A;  4K78 A;  3DJ3 A;  3CBZ A;  4JOF A;  5I7Z A;  2X7Z A;  2ZPM A;  1N6E A;  2YT8 A;  1KWA A;  2HE2 A;  3PDZ A;  2DAZ A;  3K50 A;  1BE9 A;  1V5Q A;  2REY A;  2FE5 A;  3MH7 A;  1N7F A;  3HPK A;  2DMZ A;  2DM8 A;  2V90 A;  2Z9I A;  3CH8 A;  3QGL A;  2KJP A;  1Y8T A;  4JOH A;  1KEF A;  2PKU A;  4NMR A;  5HF4 A;  2K1Z A;  4LMM A;  3PV5 A;  1SOZ A;  1RY4 A;  2G5M B;  1N6F A;  3SOE A;  3O46 A;  2EV8 A;  4UU5 A;  2FNE A;  2DB5 A;  2KPL A;  4KFW A;  4N6X A;  4NMP A;  3ID2 A;  4F8K A;  2H3M A;  1QAV A;  1IHJ A;  5HFE A;  2H3L A;  3CYY A;  2PA1 A;  1I16 A;  1FCF A;  2R3Y A;  3E17 A;  4NXP A;  1W9Q A;  3NGH A;  3LNY A;  2KOH A;  5HFD A;  3CBX A;  2KOM A;  2CSS A;  4NMV A;  2IWO A;  5H3J A;  3SHW A;  1OBZ A;  4JOG A;  1MC7 A;  2V1W A;  2HE4 A;  2D90 A;  2QKT A;  1D5G A;  3GCO A;  2YT7 A;  2P3W A;  5E22 A;  2JIN A;  4PQW A;  3GSL A;  4K72 A;  1KY9 A;  3OU0 A;  4GVC A;  4OEP A;  2KA9 A;  1X45 A;  1VB7 A;  3I18 A;  4HOP B;  2DLU A;  2RRM A;  3I1E A;  3KZD A;  1M5Z A;  2FN5 A;  2LC7 A;  4NMS A;  2OPG A;  2YUB A;  2DJT A;  1UJD A;  3PV4 A;  2KOJ A;  2Q9V A;  1UIT A;  2Z17 A;  2L4T A;  3K1R A;  2I6V A;  4Q2N A;  2O2T A;  1TP5 A;  5HF1 A;  3QO6 A;  3RL7 A;  3NFK A;  1WG6 A;  2KJD A;  1U38 A;  1NF3 C;  5G1D A;  1UM7 A;  2YTW A;  4NXR A;  4NMT A;  2KPK A;  5HFB A;  1N99 A;  3BPU A;  1V1T A;  5GLJ A;  2L97 A;  3PS4 A;  5HFC A;  3CS0 A;  3PV2 A;  2AWU A;  2EDP A;  2OMJ A;  2JXO A;  1G9O A;  2K20 A;  1W9O A;  4Z8J A;  1TP3 A;  5E6P B;  1GQ4 A;  4AMH A;  1W9E A;  1P1D A;  2E7K A;  2UZC A;  1N7T A;  3HPM A;  1N6D A;  3SFJ A;  2CSJ A;  4IC6 A;  2LA8 A;  4NMQ A;  4JL7 A;  1UEP A;  2RCZ A;  3HVQ C;  4JOR A;  3WKM A;  3L4F D;  2I1N A;  2OCS A;  2D92 A;  5D13 A;  2D8I A;  4L8N A;  2LC6 A;  4H11 A;  1UM1 A;  2FCF A;  5EZ0 A;  1TE0 A;  1YBO A;  3RLE A;  2JOA A;  4MPA A;  1GM1 A;  2KG2 A;  1Q3P A;  4Z33 A;  5JXB A;  3QDO A;  1V5L A;  2EAQ A;  3OTP A;  4Q3H A;  1T2M A;  2EGO A;  4YDP A;  1Z87 A;  2EDV A;  1UF1 A;  4NNM A;  2AWX A;  2YUY A;  5A2P A;  1WH1 A;  4FGM A;  5HED A;  2ENO A;  3CBY A;  1ZUB A;  2MX6 A;  2I0I A;  1ZOK A;  3R69 A;  1OBX A;  1WHD A;  3GCN A;  1LCY A;  2CS5 A;  3RL8 A;  4GVD A;  2OSG A;  1UJU A;  4R2Z A;  1B8Q A;  2BYG A;  4JOP A;  5GND A;  4K75 A;  1Q7X A;  4HOP A;  3SHU A;  1WJL A;  2M0Z A;  3NFL A;  2EEH A;  1UEQ A;  2AIN A;  2PDZ A;  5E11 A;  4OAJ A;  2Q3G A;  4E3B A;  2W4F A;  1UJV A;  3SUZ A;  3ZRT A;  3PDV A;  2JWE A;  4XHV A;  5FB8 C;  1WHA A;  4Q6H A;  1WIF A;  2JRE A;  2PKT A;  1VCW A;  3DJA A;  1WFG A;  1WI4 A;  3QJM A;  1X5N A;  2EHR A;  5E1Y A;  2QKU A;  2DC2 A;  3EGG C;  1U37 A;  2OGP A;  4JOJ A;  1SOT A;  5HEY A;  1OBY A;  2JIL A;  1VJ6 A;  3DJ1 A;  5EYZ A;  1X5R A;  5F3X A;  4E34 A;  3JXT A;  3ID3 A;  2M0T A;  2GZV A;  3DOR A;  2HGA A;  3AXA A;  2VWR A;  1FC7 A;  1IU2 A;  3TSV A;  1RGR A;  4GHN A;  3KZE A;  3DIW A;  2VSV A;  3KHF A;  4OEO A;  4Q2Q A;  1UEW A;  2EJY A; 
#chains in the Genus database with same CATH topology
 1U3B A;  2QT5 A;  1MFG A;  1WFV A;  3GDS A;  2KAW A;  1UEZ A;  4EDJ A;  3TSZ A;  1U39 A;  2R4H A;  2EEJ A;  3K82 A;  3WKL A;  3QIK A;  4KFV A;  1I92 A;  3MH4 A;  4WYT A;  5B6L A;  1K32 A;  1UFX A;  2PNT A;  2OQS A;  4YYX A;  1OZI A;  2VZ5 A;  2KV8 A;  1Z86 A;  4JJ0 A;  1QAU A;  2I4S A;  4Q2P A;  3GGE A;  2WL7 A;  2JIK A;  2M3M A;  2KBS A;  1RGW A;  3R0H A;  1Y7N A;  3R68 A;  3MH6 A;  1GQ5 A;  3VQG A;  1R6J A;  3TSW A;  3CC0 A;  2VRF A;  1QLC A;  2G2L A;  2W7R A;  1FC9 A;  1XZ9 A;  2EGN A;  1QAV B;  2F0A A;  5DTH A;  1PDR A;  3GDV A;  3QE1 A;  4FLN A;  4E35 A;  2M0U A;  2OS6 A;  5HFF A;  2VPH A;  3ID1 A;  3ID4 A;  2KQF A;  2F5Y A;  1BFE A;  1V62 A;  2EEI A;  5E21 A;  1NTE A;  3O5N A;  4REY A;  4Q2O A;  2DLS A;  1IU0 A;  2LOB A;  2KL1 A;  3STJ A;  1RZX A;  1X6D A;  3I4W A;  1L6O A;  2EEG A;  4WYU A;  2M0V A;  4JOK A;  5HET A;  5FHT A;  4K76 A;  1P1E A;  1TQ3 A;  2EGK A;  2QG1 A;  2IWN A;  2IWQ A;  2KYL A;  4K6Y A;  2MHO A;  2AWW A;  2H2C A;  2KJK A;  2IWP A;  5G1E A;  1VA8 A;  2LUI A;  2EDZ A;  4UU6 A;  4Q6S A;  3FY5 A;  1X5Q A;  5HDY A;  4RI0 A;  2EXG A;  1WI2 A;  1N7E A;  3TMH A;  3VQF A;  2QBW A;  2ZPL A;  1X8S A;  1Q3O A;  3GJ9 A;  2M10 A;  4G69 A;  3LNX A;  4NMO A;  2QKV A;  4NNL A;  5HEB A;  4P2A B;  1VAE A;  4O06 A;  2H2B A;  5HJ1 A;  2OZF A;  2I04 A;  2DKR A;  4JOE A;  2I0L A;  4P0C A;  2PZD A;  1V6B A;  2L4S A;  3GDU A;  2VSP A;  1FC6 A;  1WF8 A;  2KRG A;  3B76 A;  5F67 A;  3QJN A;  1UHP A;  3EGH C;  4NXQ A;  1WF7 A;  1MFL A;  4K78 A;  3DJ3 A;  3CBZ A;  4JOF A;  5I7Z A;  2X7Z A;  2ZPM A;  1N6E A;  2YT8 A;  1KWA A;  2HE2 A;  3PDZ A;  2DAZ A;  3K50 A;  1BE9 A;  1V5Q A;  2REY A;  2FE5 A;  3MH7 A;  1N7F A;  3HPK A;  2DMZ A;  3NCV A;  3KDG A;  2DM8 A;  2V90 A;  2Z9I A;  3CH8 A;  3QGL A;  2KJP A;  1Y8T A;  4JOH A;  1KEF A;  2PKU A;  4NMR A;  3GAB A;  5HF4 A;  2K1Z A;  4LMM A;  3PV5 A;  1SOZ A;  1RY4 A;  2G5M B;  1N6F A;  3SOE A;  3O46 A;  2EV8 A;  4UU5 A;  2FNE A;  2DB5 A;  2KPL A;  4KFW A;  4N6X A;  4NMP A;  3ID2 A;  4F8K A;  2H3M A;  1QAV A;  1IHJ A;  5HFE A;  2H3L A;  3CYY A;  2PA1 A;  1I16 A;  1FCF A;  2R3Y A;  3E17 A;  4NXP A;  1W9Q A;  3NGH A;  3LNY A;  2KOH A;  5HFD A;  3CBX A;  2KOM A;  2CSS A;  4NMV A;  2IWO A;  5H3J A;  3SHW A;  1OBZ A;  4JOG A;  1MC7 A;  2V1W A;  2HE4 A;  2D90 A;  2QKT A;  1D5G A;  3GCO A;  2YT7 A;  2P3W A;  5E22 A;  2JIN A;  4PQW A;  3GSL A;  4K72 A;  1KY9 A;  3OU0 A;  4GVC A;  4OEP A;  2KA9 A;  1X45 A;  1VB7 A;  3I18 A;  4HOP B;  2DLU A;  2RRM A;  3I1E A;  3KZD A;  1M5Z A;  2FN5 A;  2LC7 A;  3KDK A;  4NMS A;  2OPG A;  2YUB A;  2DJT A;  1UJD A;  3PV4 A;  2KOJ A;  2Q9V A;  1UIT A;  2Z17 A;  2L4T A;  3K1R A;  2I6V A;  4Q2N A;  2O2T A;  1TP5 A;  5HF1 A;  3QO6 A;  3RL7 A;  3NFK A;  1WG6 A;  2KJD A;  1U38 A;  1NF3 C;  5G1D A;  1UM7 A;  2YTW A;  4NXR A;  4NMT A;  2KPK A;  5HFB A;  1N99 A;  3BPU A;  1V1T A;  4JJ3 A;  5GLJ A;  5ILB A;  2L97 A;  3PS4 A;  5HFC A;  3CS0 A;  3PV2 A;  2AWU A;  2EDP A;  2OMJ A;  2JXO A;  1G9O A;  2K20 A;  1W9O A;  4Z8J A;  1TP3 A;  5E6P B;  2JSN A;  1GQ4 A;  4AMH A;  1W9E A;  1P1D A;  2E7K A;  2UZC A;  1N7T A;  3HPM A;  1N6D A;  3SFJ A;  2CSJ A;  4IC6 A;  2LA8 A;  4NMQ A;  4JL7 A;  1UEP A;  2RCZ A;  3HVQ C;  4JOR A;  3WKM A;  3L4F D;  2I1N A;  2OCS A;  2D92 A;  5D13 A;  2D8I A;  4L8N A;  2LC6 A;  4H11 A;  1UM1 A;  2FCF A;  5EZ0 A;  1TE0 A;  1YBO A;  3RLE A;  2JOA A;  4MPA A;  1GM1 A;  2KG2 A;  1Q3P A;  4Z33 A;  5JXB A;  3QDO A;  1V5L A;  2EAQ A;  3OTP A;  4Q3H A;  5B42 A;  1T2M A;  2EGO A;  4YDP A;  1Z87 A;  2EDV A;  1UF1 A;  4NNM A;  2AWX A;  2YUY A;  5A2P A;  1WH1 A;  4FGM A;  5HED A;  2ENO A;  3CBY A;  1ZUB A;  2MX6 A;  2I0I A;  1ZOK A;  3R69 A;  1OBX A;  1WHD A;  3GCN A;  1LCY A;  2CS5 A;  3RL8 A;  4GVD A;  2OSG A;  1UJU A;  4R2Z A;  1B8Q A;  2BYG A;  4JOP A;  5GND A;  4K75 A;  1Q7X A;  4HOP A;  3SHU A;  1WJL A;  2M0Z A;  3NFL A;  2EEH A;  1UEQ A;  2AIN A;  2PDZ A;  5E11 A;  4OAJ A;  2Q3G A;  4E3B A;  2W4F A;  1UJV A;  3SUZ A;  3ZRT A;  2GEF A;  3PDV A;  2JWE A;  4XHV A;  5FB8 C;  1WHA A;  4Q6H A;  1WIF A;  2JRE A;  2PKT A;  1VCW A;  3DJA A;  1WFG A;  1WI4 A;  3QJM A;  1X5N A;  2EHR A;  5E1Y A;  1X9Z A;  2QKU A;  2DC2 A;  3EGG C;  1U37 A;  2OGP A;  4JOJ A;  1SOT A;  5HEY A;  1OBY A;  2JIL A;  1VJ6 A;  3DJ1 A;  5IL9 A;  5EYZ A;  1X5R A;  5F3X A;  4E34 A;  3JXT A;  3ID3 A;  2M0T A;  2GZV A;  3DOR A;  2HGA A;  3AXA A;  2VWR A;  1FC7 A;  1IU2 A;  3TSV A;  1RGR A;  4GHN A;  3KZE A;  3DIW A;  2VSV A;  3KHF A;  4OEO A;  4Q2Q A;  1UEW A;  2EJY A; 
#chains in the Genus database with same CATH homology
 1U3B A;  2QT5 A;  1MFG A;  1WFV A;  3GDS A;  2KAW A;  1UEZ A;  4EDJ A;  3TSZ A;  1U39 A;  2R4H A;  2EEJ A;  3K82 A;  3WKL A;  3QIK A;  4KFV A;  1I92 A;  3MH4 A;  4WYT A;  5B6L A;  1K32 A;  1UFX A;  2PNT A;  2OQS A;  4YYX A;  1OZI A;  2VZ5 A;  2KV8 A;  1Z86 A;  4JJ0 A;  1QAU A;  2I4S A;  4Q2P A;  3GGE A;  2WL7 A;  2JIK A;  2M3M A;  2KBS A;  1RGW A;  3R0H A;  1Y7N A;  3R68 A;  3MH6 A;  1GQ5 A;  3VQG A;  1R6J A;  3TSW A;  3CC0 A;  2VRF A;  1QLC A;  2G2L A;  2W7R A;  1FC9 A;  1XZ9 A;  2EGN A;  1QAV B;  2F0A A;  5DTH A;  1PDR A;  3GDV A;  3QE1 A;  4FLN A;  4E35 A;  2M0U A;  2OS6 A;  5HFF A;  2VPH A;  3ID1 A;  3ID4 A;  2KQF A;  2F5Y A;  1BFE A;  1V62 A;  2EEI A;  5E21 A;  1NTE A;  3O5N A;  4REY A;  4Q2O A;  2DLS A;  1IU0 A;  2LOB A;  2KL1 A;  3STJ A;  1RZX A;  1X6D A;  3I4W A;  1L6O A;  2EEG A;  4WYU A;  2M0V A;  4JOK A;  5HET A;  5FHT A;  4K76 A;  1P1E A;  1TQ3 A;  2EGK A;  2QG1 A;  2IWN A;  2IWQ A;  2KYL A;  4K6Y A;  2MHO A;  2AWW A;  2H2C A;  2KJK A;  2IWP A;  5G1E A;  1VA8 A;  2LUI A;  2EDZ A;  4UU6 A;  4Q6S A;  3FY5 A;  1X5Q A;  5HDY A;  4RI0 A;  2EXG A;  1WI2 A;  1N7E A;  3TMH A;  3VQF A;  2QBW A;  2ZPL A;  1X8S A;  1Q3O A;  3GJ9 A;  2M10 A;  4G69 A;  3LNX A;  4NMO A;  2QKV A;  4NNL A;  5HEB A;  4P2A B;  1VAE A;  4O06 A;  2H2B A;  5HJ1 A;  2OZF A;  2I04 A;  2DKR A;  4JOE A;  2I0L A;  4P0C A;  2PZD A;  1V6B A;  2L4S A;  3GDU A;  2VSP A;  1FC6 A;  1WF8 A;  2KRG A;  3B76 A;  5F67 A;  3QJN A;  1UHP A;  3EGH C;  4NXQ A;  1WF7 A;  1MFL A;  4K78 A;  3DJ3 A;  3CBZ A;  4JOF A;  5I7Z A;  2X7Z A;  2ZPM A;  1N6E A;  2YT8 A;  1KWA A;  2HE2 A;  3PDZ A;  2DAZ A;  3K50 A;  1BE9 A;  1V5Q A;  2REY A;  2FE5 A;  3MH7 A;  1N7F A;  3HPK A;  2DMZ A;  3NCV A;  3KDG A;  2DM8 A;  2V90 A;  2Z9I A;  3CH8 A;  3QGL A;  2KJP A;  1Y8T A;  4JOH A;  1KEF A;  2PKU A;  4NMR A;  3GAB A;  5HF4 A;  2K1Z A;  4LMM A;  3PV5 A;  1SOZ A;  1RY4 A;  2G5M B;  1N6F A;  3SOE A;  3O46 A;  2EV8 A;  4UU5 A;  2FNE A;  2DB5 A;  2KPL A;  4KFW A;  4N6X A;  4NMP A;  3ID2 A;  4F8K A;  2H3M A;  1QAV A;  1IHJ A;  5HFE A;  2H3L A;  3CYY A;  2PA1 A;  1I16 A;  1FCF A;  2R3Y A;  3E17 A;  4NXP A;  1W9Q A;  3NGH A;  3LNY A;  2KOH A;  5HFD A;  3CBX A;  2KOM A;  2CSS A;  4NMV A;  2IWO A;  5H3J A;  3SHW A;  1OBZ A;  4JOG A;  1MC7 A;  2V1W A;  2HE4 A;  2D90 A;  2QKT A;  1D5G A;  3GCO A;  2YT7 A;  2P3W A;  5E22 A;  2JIN A;  4PQW A;  3GSL A;  4K72 A;  1KY9 A;  3OU0 A;  4GVC A;  4OEP A;  2KA9 A;  1X45 A;  1VB7 A;  3I18 A;  4HOP B;  2DLU A;  2RRM A;  3I1E A;  3KZD A;  1M5Z A;  2FN5 A;  2LC7 A;  3KDK A;  4NMS A;  2OPG A;  2YUB A;  2DJT A;  1UJD A;  3PV4 A;  2KOJ A;  2Q9V A;  1UIT A;  2Z17 A;  2L4T A;  3K1R A;  2I6V A;  4Q2N A;  2O2T A;  1TP5 A;  5HF1 A;  3QO6 A;  3RL7 A;  3NFK A;  1WG6 A;  2KJD A;  1U38 A;  1NF3 C;  5G1D A;  1UM7 A;  2YTW A;  4NXR A;  4NMT A;  2KPK A;  5HFB A;  1N99 A;  3BPU A;  1V1T A;  4JJ3 A;  5GLJ A;  5ILB A;  2L97 A;  3PS4 A;  5HFC A;  3CS0 A;  3PV2 A;  2AWU A;  2EDP A;  2OMJ A;  2JXO A;  1G9O A;  2K20 A;  1W9O A;  4Z8J A;  1TP3 A;  5E6P B;  2JSN A;  1GQ4 A;  4AMH A;  1W9E A;  1P1D A;  2E7K A;  2UZC A;  1N7T A;  3HPM A;  1N6D A;  3SFJ A;  2CSJ A;  4IC6 A;  2LA8 A;  4NMQ A;  4JL7 A;  1UEP A;  2RCZ A;  3HVQ C;  4JOR A;  3WKM A;  3L4F D;  2I1N A;  2OCS A;  2D92 A;  5D13 A;  2D8I A;  4L8N A;  2LC6 A;  4H11 A;  1UM1 A;  2FCF A;  5EZ0 A;  1TE0 A;  1YBO A;  3RLE A;  2JOA A;  4MPA A;  1GM1 A;  2KG2 A;  1Q3P A;  4Z33 A;  5JXB A;  3QDO A;  1V5L A;  2EAQ A;  3OTP A;  4Q3H A;  5B42 A;  1T2M A;  2EGO A;  4YDP A;  1Z87 A;  2EDV A;  1UF1 A;  4NNM A;  2AWX A;  2YUY A;  5A2P A;  1WH1 A;  4FGM A;  5HED A;  2ENO A;  3CBY A;  1ZUB A;  2MX6 A;  2I0I A;  1ZOK A;  3R69 A;  1OBX A;  1WHD A;  3GCN A;  1LCY A;  2CS5 A;  3RL8 A;  4GVD A;  2OSG A;  1UJU A;  4R2Z A;  1B8Q A;  2BYG A;  4JOP A;  5GND A;  4K75 A;  1Q7X A;  4HOP A;  3SHU A;  1WJL A;  2M0Z A;  3NFL A;  2EEH A;  1UEQ A;  2AIN A;  2PDZ A;  5E11 A;  4OAJ A;  2Q3G A;  4E3B A;  2W4F A;  1UJV A;  3SUZ A;  3ZRT A;  2GEF A;  3PDV A;  2JWE A;  4XHV A;  5FB8 C;  1WHA A;  4Q6H A;  1WIF A;  2JRE A;  2PKT A;  1VCW A;  3DJA A;  1WFG A;  1WI4 A;  3QJM A;  1X5N A;  2EHR A;  5E1Y A;  1X9Z A;  2QKU A;  2DC2 A;  3EGG C;  1U37 A;  2OGP A;  4JOJ A;  1SOT A;  5HEY A;  1OBY A;  2JIL A;  1VJ6 A;  3DJ1 A;  5IL9 A;  5EYZ A;  1X5R A;  5F3X A;  4E34 A;  3JXT A;  3ID3 A;  2M0T A;  2GZV A;  3DOR A;  2HGA A;  3AXA A;  2VWR A;  1FC7 A;  1IU2 A;  3TSV A;  1RGR A;  4GHN A;  3KZE A;  3DIW A;  2VSV A;  3KHF A;  4OEO A;  4Q2Q A;  1UEW A;  2EJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...