2KAWA

Nmr structure of the mdvl1 pdz domain in complex with its inhibitor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
NIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Segment polarity protein dishevelled homolog DVL-1
publication title Sulindac inhibits canonical Wnt signaling by blocking the PDZ domain of the protein Dishevelled.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 19
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2kawA00
2EEIA 2OQSA 2YUYA 2VSVA 4OEOA 3TSVA 4NMOA 1U38A 2DJTA 5HFBA 1UEPA 3O46A 2VSPA 4MPAA 4Q2QA 4NMVA 1OBZA 3DIWA 2PZDA 2I6VA 4K75A 3LNYA 3ID4A 1UITA 4AMHA 2QG1A 4K76A 2AINA 3RLEA 3QIKA 4GHNA 4E35A 2KOHA 3AXAA 5HF4A 1GM1A 1V6BA 1UM7A 2EGKA 3KHFA 2KV8A 2KL1A 2CSSA 1FC7A 2LA8A 1UEZA 2EAQA 2Q9VA 1WG6A 3WKMA 1WF7A 4KFWA 2E7KA 2I4SA 1X5QA 2H2BA 1VCWA 2KRGA 2KAWA 1V5QA 5HEDA 3PV4A 2JREA 2EDVA 1I92A 1X8SA 1UFXA 2H3LA 4L8NA 1BE9A 3WKLA 1ZUBA 5E21A 2I0LA 4NXRA 2UZCA 2L97A 2OMJA 3CBXA 5FB8C 3K82A 4NMTA 1RGWA 4UU6A 5A2PA 4GVCA 2IWPA 2WL7A 3QO6A 4NXQA 2YTWA 3KZDA 1Q3PA 5HFFA 4UU5A 2KG2A 1KEFA 2IWOA 3OU0A 2M0VA 1OBYA 4JOGA 5GLJA 1R6JA 2KPLA 2EEGA 1ZOKA 2AWUA 2LC7A 3SUZA 2CSJA 1WHAA 4YYXA 4Q2OA 4K6YA 2EGNA 5HFEA 1KWAA 2DLUA 2OSGA 1QLCA 2KJDA 4JOPA 5F3XA 3JXTA 3R69A 1UJVA 1GQ5A 2KOMA 4XHVA 2O2TA 3MH4A 1WFGA 1VJ6A 2MHOA 1TP3A 3QJMA 1N99A 2LOBA 2W7RA 3GDUA 1X6DA 1XZ9A 2AWXA 1T2MA 2L4TA 5HDYA 3FY5A 2JIKA 3EGHC 2EEJA 3TMHA 5GNDA 2PA1A 4P0CA 5E6PB 1MFLA 2IWQA 2FNEA 2KOJA 2EJYA 3CS0A 3VQGA 2H3MA 3I4WA 1Y7NA 1Z86A 2FE5A 4GVDA 1OBXA 4OEPA 3SHUA 1WJLA 2HGAA 2JWEA 1RZXA 2AWWA 1V5LA 1UM1A 2R3YA 3K50A 3NGHA 5H3JA 2DAZA 5I7ZA 5E11A 2QT5A 4NMQA 5B6LA 2KA9A 2BYGA 3DORA 3R68A 3PV5A 1PDRA 2KPKA 2P3WA 5HEYA 4PQWA 1M5ZA 1P1EA 1SOTA 5F67A 2ZPMA 3MH6A 5HJ1A 3RL8A 1FCFA 4RI0A 2RRMA 1VAEA 5E1YA 4F8KA 1WI4A 1UHPA 3CH8A 1BFEA 2DB5A 2QKUA 2KJKA 2MX6A 2V1WA 3LNXA 1X5RA 3QE1A 1WFVA 2PDZA 5EZ0A 4Z8JA 1LCYA 1Q3OA 4NMSA 3GCOA 3OTPA 3R0HA 2ZPLA 4REYA 5G1DA 1TP5A 5G1EA 5D13A 1W9QA 1V1TA 1UF1A 1K32A 1L6OA 1X45A 2KBSA 2YT7A 1N6FA 3PDZA 1GQ4A 4H11A 3GDVA 3TSZA 3MH7A 1MC7A 2FN5A 2I0IA 4IC6A 2OCSA 2VZ5A 1P1DA 1Q7XA 2D8IA 1D5GA 4OAJA 5E22A 4Q6HA 3CBZA 4K78A 5EYZA 4O06A 2JOAA 1IU0A 3NFKA 3B76A 4FGMA 3PDVA 5HFDA 2M10A 1V62A 2D92A 3SFJA 3E17A 4JOHA 1VB7A 1WH1A 4NMRA 2G5MB 2EDPA 3ID1A 5HEBA 2CS5A 3HPKA 5HFCA 1B8QA 2I04A 5DTHA 3O5NA 1W9OA 2PKTA 3DJAA 5JXBA 3VQFA 2KJPA 4G69A 2V90A 1N7FA 3SOEA 4YDPA 2EHRA 3QJNA 4Q2NA 3GJ9A 4NXPA 2OPGA 4Q6SA 2M0TA 1KY9A 1N7TA 3NFLA 4EDJA 1FC6A 2ENOA 3EGGC 4Q3HA 3ID3A 1WHDA 4N6XA 2DM8A 1IHJA 1WF8A 3QGLA 2JILA 2DLSA 3HVQC 3I1EA 3KZEA 2OS6A 4Z33A 3L4FD 2EV8A 4JORA 2Z9IA 5HF1A 2KYLA 2FCFA 2G2LA 2H2CA 4P2AB 1FC9A 3BPUA 1OZIA 2GZVA 4NMPA 5HETA 3I18A 2L4SA 2JXOA 2VWRA 4HOPA 1YBOA 5FHTA 2I1NA 2K20A 1IU2A 1SOZA 2M3MA 3ZRTA 2DC2A 1NF3C 1Y8TA 3DJ1A 4R2ZA 4E34A 3K1RA 1Z87A 3CYYA 4JOJA 4Q2PA 3GCNA 3HPMA 3DJ3A 4JL7A 2W4FA 4HOPB 3QDOA 3CBYA 2QKVA 1W9EA 2Q3GA 2EXGA 3PS4A 2YT8A 2EDZA 2X7ZA 2QBWA 1N6DA 1UJUA 1WI2A 1G9OA 2DKRA 3ID2A 2DMZA 3STJA 2F5YA 2F0AA 1WIFA 2VRFA 1X5NA 2LC6A 1NTEA 2EGOA 3GSLA 2OZFA 4LMMA 3SHWA 1RGRA 1UEWA 4WYTA 2PNTA 3RL7A 2HE4A 1I16A 1U37A 3TSWA 2R4HA 2LUIA 1RY4A 2KQFA 1VA8A 2M0ZA 1U39A 1N6EA 1TQ3A 2REYA 1U3BA 1QAVA 2RCZA 2QKTA 2VPHA 4E3BA 1UJDA 2YUBA 3PV2A 2K1ZA 2JINA 2PKUA 2EEHA 4JOFA 4JOEA 3CC0A 2IWNA 4JOKA 2Z17A 1QAVB 2HE2A 4NNMA 1QAUA 2D90A 4KFVA 4NNLA 1UEQA 1N7EA 2OGPA 4WYUA 1MFGA 2M0UA 1TE0A 4K72A 3GGEA 3GDSA
chains in the Genus database with same CATH superfamily
2EEIA 2OQSA 2YUYA 2VSVA 3NCVA 4OEOA 3TSVA 4NMOA 1U38A 2DJTA 5HFBA 1UEPA 3O46A 2VSPA 4MPAA 4Q2QA 4NMVA 1OBZA 3DIWA 2PZDA 2I6VA 4K75A 3LNYA 3ID4A 1UITA 4AMHA 2QG1A 4K76A 2AINA 3RLEA 3QIKA 4GHNA 4E35A 2KOHA 3AXAA 5HF4A 1GM1A 1V6BA 1UM7A 2EGKA 3KHFA 2KV8A 2KL1A 2CSSA 1FC7A 2LA8A 1UEZA 2EAQA 2Q9VA 1WG6A 3WKMA 1WF7A 4KFWA 2E7KA 2I4SA 1X5QA 2H2BA 1VCWA 2KRGA 2KAWA 1V5QA 5HEDA 3PV4A 2JREA 2EDVA 2GEFA 1I92A 1X8SA 2JSNA 1UFXA 2H3LA 4L8NA 1BE9A 3WKLA 1ZUBA 5E21A 2I0LA 4NXRA 2UZCA 2L97A 2OMJA 3CBXA 5FB8C 3K82A 4NMTA 1RGWA 4UU6A 5A2PA 4GVCA 2IWPA 2WL7A 3QO6A 4NXQA 2YTWA 3KZDA 1Q3PA 5HFFA 4UU5A 2KG2A 1KEFA 2IWOA 3OU0A 2M0VA 1OBYA 4JOGA 5GLJA 1R6JA 2KPLA 2EEGA 1ZOKA 2AWUA 2LC7A 3SUZA 2CSJA 1WHAA 4YYXA 4Q2OA 4K6YA 2EGNA 5HFEA 3GABA 1KWAA 2DLUA 2OSGA 1QLCA 2KJDA 4JOPA 5F3XA 3JXTA 3R69A 1UJVA 1GQ5A 2KOMA 4XHVA 2O2TA 3MH4A 1WFGA 1VJ6A 2MHOA 1TP3A 3QJMA 1N99A 1X9ZA 2LOBA 2W7RA 3GDUA 1X6DA 1XZ9A 2AWXA 1T2MA 2L4TA 5HDYA 3FY5A 2JIKA 3EGHC 2EEJA 3TMHA 5GNDA 2PA1A 4P0CA 5E6PB 1MFLA 2IWQA 2FNEA 2KOJA 2EJYA 3CS0A 3VQGA 2H3MA 3I4WA 1Y7NA 1Z86A 2FE5A 4GVDA 1OBXA 4OEPA 3SHUA 1WJLA 2HGAA 4JJ3A 2JWEA 1RZXA 2AWWA 1V5LA 1UM1A 2R3YA 3K50A 3NGHA 5H3JA 2DAZA 5I7ZA 5E11A 2QT5A 4NMQA 5B6LA 2KA9A 2BYGA 3DORA 3R68A 3PV5A 1PDRA 2KPKA 2P3WA 5HEYA 4PQWA 1M5ZA 1P1EA 1SOTA 5F67A 2ZPMA 3MH6A 5HJ1A 3RL8A 1FCFA 4RI0A 2RRMA 1VAEA 5E1YA 4F8KA 1WI4A 1UHPA 3CH8A 1BFEA 2DB5A 2QKUA 2KJKA 2MX6A 2V1WA 3LNXA 1X5RA 3QE1A 1WFVA 2PDZA 5EZ0A 4Z8JA 1LCYA 1Q3OA 4NMSA 3GCOA 3OTPA 3R0HA 2ZPLA 4REYA 5G1DA 1TP5A 5G1EA 5D13A 1W9QA 1V1TA 5ILBA 1UF1A 1K32A 1L6OA 1X45A 4JJ0A 2KBSA 2YT7A 1N6FA 3PDZA 1GQ4A 4H11A 3GDVA 3TSZA 3MH7A 1MC7A 2FN5A 2I0IA 4IC6A 2OCSA 2VZ5A 1P1DA 1Q7XA 2D8IA 1D5GA 4OAJA 5E22A 4Q6HA 3CBZA 4K78A 5EYZA 4O06A 2JOAA 1IU0A 3NFKA 3B76A 4FGMA 3PDVA 5HFDA 2M10A 1V62A 2D92A 3SFJA 3E17A 4JOHA 1VB7A 1WH1A 4NMRA 2G5MB 2EDPA 3ID1A 5HEBA 2CS5A 3HPKA 5HFCA 1B8QA 2I04A 5DTHA 3O5NA 1W9OA 2PKTA 3DJAA 5JXBA 3VQFA 2KJPA 4G69A 2V90A 1N7FA 3SOEA 4YDPA 2EHRA 3QJNA 4Q2NA 3GJ9A 4NXPA 2OPGA 4Q6SA 2M0TA 1KY9A 1N7TA 3NFLA 4EDJA 1FC6A 2ENOA 3EGGC 4Q3HA 3ID3A 1WHDA 4N6XA 2DM8A 1IHJA 1WF8A 3QGLA 2JILA 2DLSA 3HVQC 3I1EA 3KZEA 2OS6A 4Z33A 3L4FD 2EV8A 4JORA 2Z9IA 5HF1A 2KYLA 2FCFA 2G2LA 2H2CA 4P2AB 1FC9A 3BPUA 1OZIA 2GZVA 4NMPA 5HETA 3I18A 2L4SA 2JXOA 2VWRA 4HOPA 1YBOA 5FHTA 2I1NA 2K20A 1IU2A 1SOZA 2M3MA 3ZRTA 2DC2A 1NF3C 1Y8TA 3DJ1A 4R2ZA 4E34A 3K1RA 1Z87A 3CYYA 4JOJA 4Q2PA 3GCNA 3HPMA 3DJ3A 4JL7A 2W4FA 4HOPB 3QDOA 3CBYA 2QKVA 1W9EA 2Q3GA 2EXGA 3PS4A 2YT8A 2EDZA 2X7ZA 2QBWA 1N6DA 1UJUA 1WI2A 1G9OA 2DKRA 3ID2A 2DMZA 3KDGA 3STJA 2F5YA 2F0AA 1WIFA 2VRFA 1X5NA 2LC6A 1NTEA 2EGOA 3GSLA 2OZFA 4LMMA 3SHWA 1RGRA 1UEWA 4WYTA 2PNTA 3KDKA 5B42A 3RL7A 2HE4A 1I16A 1U37A 3TSWA 2R4HA 2LUIA 1RY4A 2KQFA 1VA8A 2M0ZA 1U39A 1N6EA 1TQ3A 2REYA 1U3BA 1QAVA 2RCZA 2QKTA 2VPHA 4E3BA 1UJDA 2YUBA 3PV2A 2K1ZA 2JINA 2PKUA 2EEHA 4JOFA 4JOEA 3CC0A 2IWNA 4JOKA 2Z17A 1QAVB 2HE2A 4NNMA 1QAUA 2D90A 4KFVA 4NNLA 1UEQA 1N7EA 2OGPA 4WYUA 5IL9A 1MFGA 2M0UA 1TE0A 4FLNA 4K72A 3GGEA 3GDSA
chains in the Genus database with same CATH topology
2EEIA 2OQSA 2YUYA 2VSVA 3NCVA 4OEOA 3TSVA 4NMOA 1U38A 2DJTA 5HFBA 1UEPA 3O46A 2VSPA 4MPAA 4Q2QA 4NMVA 1OBZA 3DIWA 2PZDA 2I6VA 4K75A 3LNYA 3ID4A 1UITA 4AMHA 2QG1A 4K76A 2AINA 3RLEA 3QIKA 4GHNA 4E35A 2KOHA 3AXAA 5HF4A 1GM1A 1V6BA 1UM7A 2EGKA 3KHFA 2KV8A 2KL1A 2CSSA 1FC7A 2LA8A 1UEZA 2EAQA 2Q9VA 1WG6A 3WKMA 1WF7A 4KFWA 2E7KA 2I4SA 1X5QA 2H2BA 1VCWA 2KRGA 2KAWA 1V5QA 5HEDA 3PV4A 2JREA 2EDVA 2GEFA 1I92A 1X8SA 2JSNA 1UFXA 2H3LA 4L8NA 1BE9A 3WKLA 1ZUBA 5E21A 2I0LA 4NXRA 2UZCA 2L97A 2OMJA 3CBXA 5FB8C 3K82A 4NMTA 1RGWA 4UU6A 5A2PA 4GVCA 2IWPA 2WL7A 3QO6A 4NXQA 2YTWA 3KZDA 1Q3PA 5HFFA 4UU5A 2KG2A 1KEFA 2IWOA 3OU0A 2M0VA 1OBYA 4JOGA 5GLJA 1R6JA 2KPLA 2EEGA 1ZOKA 2AWUA 2LC7A 3SUZA 2CSJA 1WHAA 4YYXA 4Q2OA 4K6YA 2EGNA 5HFEA 3GABA 1KWAA 2DLUA 2OSGA 1QLCA 2KJDA 4JOPA 5F3XA 3JXTA 3R69A 1UJVA 1GQ5A 2KOMA 4XHVA 2O2TA 3MH4A 1WFGA 1VJ6A 2MHOA 1TP3A 3QJMA 1N99A 1X9ZA 2LOBA 2W7RA 3GDUA 1X6DA 1XZ9A 2AWXA 1T2MA 2L4TA 5HDYA 3FY5A 2JIKA 3EGHC 2EEJA 3TMHA 5GNDA 2PA1A 4P0CA 5E6PB 1MFLA 2IWQA 2FNEA 2KOJA 2EJYA 3CS0A 3VQGA 2H3MA 3I4WA 1Y7NA 1Z86A 2FE5A 4GVDA 1OBXA 4OEPA 3SHUA 1WJLA 2HGAA 4JJ3A 2JWEA 1RZXA 2AWWA 1V5LA 1UM1A 2R3YA 3K50A 3NGHA 5H3JA 2DAZA 5I7ZA 5E11A 2QT5A 4NMQA 5B6LA 2KA9A 2BYGA 3DORA 3R68A 3PV5A 1PDRA 2KPKA 2P3WA 5HEYA 4PQWA 1M5ZA 1P1EA 1SOTA 5F67A 2ZPMA 3MH6A 5HJ1A 3RL8A 1FCFA 4RI0A 2RRMA 1VAEA 5E1YA 4F8KA 1WI4A 1UHPA 3CH8A 1BFEA 2DB5A 2QKUA 2KJKA 2MX6A 2V1WA 3LNXA 1X5RA 3QE1A 1WFVA 2PDZA 5EZ0A 4Z8JA 1LCYA 1Q3OA 4NMSA 3GCOA 3OTPA 3R0HA 2ZPLA 4REYA 5G1DA 1TP5A 5G1EA 5D13A 1W9QA 1V1TA 5ILBA 1UF1A 1K32A 1L6OA 1X45A 4JJ0A 2KBSA 2YT7A 1N6FA 3PDZA 1GQ4A 4H11A 3GDVA 3TSZA 3MH7A 1MC7A 2FN5A 2I0IA 4IC6A 2OCSA 2VZ5A 1P1DA 1Q7XA 2D8IA 1D5GA 4OAJA 5E22A 4Q6HA 3CBZA 4K78A 5EYZA 4O06A 2JOAA 1IU0A 3NFKA 3B76A 4FGMA 3PDVA 5HFDA 2M10A 1V62A 2D92A 3SFJA 3E17A 4JOHA 1VB7A 1WH1A 4NMRA 2G5MB 2EDPA 3ID1A 5HEBA 2CS5A 3HPKA 5HFCA 1B8QA 2I04A 5DTHA 3O5NA 1W9OA 2PKTA 3DJAA 5JXBA 3VQFA 2KJPA 4G69A 2V90A 1N7FA 3SOEA 4YDPA 2EHRA 3QJNA 4Q2NA 3GJ9A 4NXPA 2OPGA 4Q6SA 2M0TA 1KY9A 1N7TA 3NFLA 4EDJA 1FC6A 2ENOA 3EGGC 4Q3HA 3ID3A 1WHDA 4N6XA 2DM8A 1IHJA 1WF8A 3QGLA 2JILA 2DLSA 3HVQC 3I1EA 3KZEA 2OS6A 4Z33A 3L4FD 2EV8A 4JORA 2Z9IA 5HF1A 2KYLA 2FCFA 2G2LA 2H2CA 4P2AB 1FC9A 3BPUA 1OZIA 2GZVA 4NMPA 5HETA 3I18A 2L4SA 2JXOA 2VWRA 4HOPA 1YBOA 5FHTA 2I1NA 2K20A 1IU2A 1SOZA 2M3MA 3ZRTA 2DC2A 1NF3C 1Y8TA 3DJ1A 4R2ZA 4E34A 3K1RA 1Z87A 3CYYA 4JOJA 4Q2PA 3GCNA 3HPMA 3DJ3A 4JL7A 2W4FA 4HOPB 3QDOA 3CBYA 2QKVA 1W9EA 2Q3GA 2EXGA 3PS4A 2YT8A 2EDZA 2X7ZA 2QBWA 1N6DA 1UJUA 1WI2A 1G9OA 2DKRA 3ID2A 2DMZA 3KDGA 3STJA 2F5YA 2F0AA 1WIFA 2VRFA 1X5NA 2LC6A 1NTEA 2EGOA 3GSLA 2OZFA 4LMMA 3SHWA 1RGRA 1UEWA 4WYTA 2PNTA 3KDKA 5B42A 3RL7A 2HE4A 1I16A 1U37A 3TSWA 2R4HA 2LUIA 1RY4A 2KQFA 1VA8A 2M0ZA 1U39A 1N6EA 1TQ3A 2REYA 1U3BA 1QAVA 2RCZA 2QKTA 2VPHA 4E3BA 1UJDA 2YUBA 3PV2A 2K1ZA 2JINA 2PKUA 2EEHA 4JOFA 4JOEA 3CC0A 2IWNA 4JOKA 2Z17A 1QAVB 2HE2A 4NNMA 1QAUA 2D90A 4KFVA 4NNLA 1UEQA 1N7EA 2OGPA 4WYUA 5IL9A 1MFGA 2M0UA 1TE0A 4FLNA 4K72A 3GGEA 3GDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EEI A;  2OQS A;  2YUY A;  2VSV A;  4OEO A;  3TSV A;  4NMO A;  1U38 A;  2DJT A;  5HFB A;  1UEP A;  3O46 A;  2VSP A;  4MPA A;  4Q2Q A;  4NMV A;  1OBZ A;  3DIW A;  2PZD A;  2I6V A;  4K75 A;  3LNY A;  3ID4 A;  1UIT A;  4AMH A;  2QG1 A;  4K76 A;  2AIN A;  3RLE A;  3QIK A;  4GHN A;  4E35 A;  2KOH A;  3AXA A;  5HF4 A;  1GM1 A;  1V6B A;  1UM7 A;  2EGK A;  3KHF A;  2KV8 A;  2KL1 A;  2CSS A;  1FC7 A;  2LA8 A;  1UEZ A;  2EAQ A;  2Q9V A;  1WG6 A;  3WKM A;  1WF7 A;  4KFW A;  2E7K A;  2I4S A;  1X5Q A;  2H2B A;  1VCW A;  2KRG A;  2KAW A;  1V5Q A;  5HED A;  3PV4 A;  2JRE A;  2EDV A;  1I92 A;  1X8S A;  1UFX A;  2H3L A;  4L8N A;  1BE9 A;  3WKL A;  1ZUB A;  5E21 A;  2I0L A;  4NXR A;  2UZC A;  2L97 A;  2OMJ A;  3CBX A;  5FB8 C;  3K82 A;  4NMT A;  1RGW A;  4UU6 A;  5A2P A;  4GVC A;  2IWP A;  2WL7 A;  3QO6 A;  4NXQ A;  2YTW A;  3KZD A;  1Q3P A;  5HFF A;  4UU5 A;  2KG2 A;  1KEF A;  2IWO A;  3OU0 A;  2M0V A;  1OBY A;  4JOG A;  5GLJ A;  1R6J A;  2KPL A;  2EEG A;  1ZOK A;  2AWU A;  2LC7 A;  3SUZ A;  2CSJ A;  1WHA A;  4YYX A;  4Q2O A;  4K6Y A;  2EGN A;  5HFE A;  1KWA A;  2DLU A;  2OSG A;  1QLC A;  2KJD A;  4JOP A;  5F3X A;  3JXT A;  3R69 A;  1UJV A;  1GQ5 A;  2KOM A;  4XHV A;  2O2T A;  3MH4 A;  1WFG A;  1VJ6 A;  2MHO A;  1TP3 A;  3QJM A;  1N99 A;  2LOB A;  2W7R A;  3GDU A;  1X6D A;  1XZ9 A;  2AWX A;  1T2M A;  2L4T A;  5HDY A;  3FY5 A;  2JIK A;  3EGH C;  2EEJ A;  3TMH A;  5GND A;  2PA1 A;  4P0C A;  5E6P B;  1MFL A;  2IWQ A;  2FNE A;  2KOJ A;  2EJY A;  3CS0 A;  3VQG A;  2H3M A;  3I4W A;  1Y7N A;  1Z86 A;  2FE5 A;  4GVD A;  1OBX A;  4OEP A;  3SHU A;  1WJL A;  2HGA A;  2JWE A;  1RZX A;  2AWW A;  1V5L A;  1UM1 A;  2R3Y A;  3K50 A;  3NGH A;  5H3J A;  2DAZ A;  5I7Z A;  5E11 A;  2QT5 A;  4NMQ A;  5B6L A;  2KA9 A;  2BYG A;  3DOR A;  3R68 A;  3PV5 A;  1PDR A;  2KPK A;  2P3W A;  5HEY A;  4PQW A;  1M5Z A;  1P1E A;  1SOT A;  5F67 A;  2ZPM A;  3MH6 A;  5HJ1 A;  3RL8 A;  1FCF A;  4RI0 A;  2RRM A;  1VAE A;  5E1Y A;  4F8K A;  1WI4 A;  1UHP A;  3CH8 A;  1BFE A;  2DB5 A;  2QKU A;  2KJK A;  2MX6 A;  2V1W A;  3LNX A;  1X5R A;  3QE1 A;  1WFV A;  2PDZ A;  5EZ0 A;  4Z8J A;  1LCY A;  1Q3O A;  4NMS A;  3GCO A;  3OTP A;  3R0H A;  2ZPL A;  4REY A;  5G1D A;  1TP5 A;  5G1E A;  5D13 A;  1W9Q A;  1V1T A;  1UF1 A;  1K32 A;  1L6O A;  1X45 A;  2KBS A;  2YT7 A;  1N6F A;  3PDZ A;  1GQ4 A;  4H11 A;  3GDV A;  3TSZ A;  3MH7 A;  1MC7 A;  2FN5 A;  2I0I A;  4IC6 A;  2OCS A;  2VZ5 A;  1P1D A;  1Q7X A;  2D8I A;  1D5G A;  4OAJ A;  5E22 A;  4Q6H A;  3CBZ A;  4K78 A;  5EYZ A;  4O06 A;  2JOA A;  1IU0 A;  3NFK A;  3B76 A;  4FGM A;  3PDV A;  5HFD A;  2M10 A;  1V62 A;  2D92 A;  3SFJ A;  3E17 A;  4JOH A;  1VB7 A;  1WH1 A;  4NMR A;  2G5M B;  2EDP A;  3ID1 A;  5HEB A;  2CS5 A;  3HPK A;  5HFC A;  1B8Q A;  2I04 A;  5DTH A;  3O5N A;  1W9O A;  2PKT A;  3DJA A;  5JXB A;  3VQF A;  2KJP A;  4G69 A;  2V90 A;  1N7F A;  3SOE A;  4YDP A;  2EHR A;  3QJN A;  4Q2N A;  3GJ9 A;  4NXP A;  2OPG A;  4Q6S A;  2M0T A;  1KY9 A;  1N7T A;  3NFL A;  4EDJ A;  1FC6 A;  2ENO A;  3EGG C;  4Q3H A;  3ID3 A;  1WHD A;  4N6X A;  2DM8 A;  1IHJ A;  1WF8 A;  3QGL A;  2JIL A;  2DLS A;  3HVQ C;  3I1E A;  3KZE A;  2OS6 A;  4Z33 A;  3L4F D;  2EV8 A;  4JOR A;  2Z9I A;  5HF1 A;  2KYL A;  2FCF A;  2G2L A;  2H2C A;  4P2A B;  1FC9 A;  3BPU A;  1OZI A;  2GZV A;  4NMP A;  5HET A;  3I18 A;  2L4S A;  2JXO A;  2VWR A;  4HOP A;  1YBO A;  5FHT A;  2I1N A;  2K20 A;  1IU2 A;  1SOZ A;  2M3M A;  3ZRT A;  2DC2 A;  1NF3 C;  1Y8T A;  3DJ1 A;  4R2Z A;  4E34 A;  3K1R A;  1Z87 A;  3CYY A;  4JOJ A;  4Q2P A;  3GCN A;  3HPM A;  3DJ3 A;  4JL7 A;  2W4F A;  4HOP B;  3QDO A;  3CBY A;  2QKV A;  1W9E A;  2Q3G A;  2EXG A;  3PS4 A;  2YT8 A;  2EDZ A;  2X7Z A;  2QBW A;  1N6D A;  1UJU A;  1WI2 A;  1G9O A;  2DKR A;  3ID2 A;  2DMZ A;  3STJ A;  2F5Y A;  2F0A A;  1WIF A;  2VRF A;  1X5N A;  2LC6 A;  1NTE A;  2EGO A;  3GSL A;  2OZF A;  4LMM A;  3SHW A;  1RGR A;  1UEW A;  4WYT A;  2PNT A;  3RL7 A;  2HE4 A;  1I16 A;  1U37 A;  3TSW A;  2R4H A;  2LUI A;  1RY4 A;  2KQF A;  1VA8 A;  2M0Z A;  1U39 A;  1N6E A;  1TQ3 A;  2REY A;  1U3B A;  1QAV A;  2RCZ A;  2QKT A;  2VPH A;  4E3B A;  1UJD A;  2YUB A;  3PV2 A;  2K1Z A;  2JIN A;  2PKU A;  2EEH A;  4JOF A;  4JOE A;  3CC0 A;  2IWN A;  4JOK A;  2Z17 A;  1QAV B;  2HE2 A;  4NNM A;  1QAU A;  2D90 A;  4KFV A;  4NNL A;  1UEQ A;  1N7E A;  2OGP A;  4WYU A;  1MFG A;  2M0U A;  1TE0 A;  4K72 A;  3GGE A;  3GDS A; 
#chains in the Genus database with same CATH topology
 2EEI A;  2OQS A;  2YUY A;  2VSV A;  3NCV A;  4OEO A;  3TSV A;  4NMO A;  1U38 A;  2DJT A;  5HFB A;  1UEP A;  3O46 A;  2VSP A;  4MPA A;  4Q2Q A;  4NMV A;  1OBZ A;  3DIW A;  2PZD A;  2I6V A;  4K75 A;  3LNY A;  3ID4 A;  1UIT A;  4AMH A;  2QG1 A;  4K76 A;  2AIN A;  3RLE A;  3QIK A;  4GHN A;  4E35 A;  2KOH A;  3AXA A;  5HF4 A;  1GM1 A;  1V6B A;  1UM7 A;  2EGK A;  3KHF A;  2KV8 A;  2KL1 A;  2CSS A;  1FC7 A;  2LA8 A;  1UEZ A;  2EAQ A;  2Q9V A;  1WG6 A;  3WKM A;  1WF7 A;  4KFW A;  2E7K A;  2I4S A;  1X5Q A;  2H2B A;  1VCW A;  2KRG A;  2KAW A;  1V5Q A;  5HED A;  3PV4 A;  2JRE A;  2EDV A;  2GEF A;  1I92 A;  1X8S A;  2JSN A;  1UFX A;  2H3L A;  4L8N A;  1BE9 A;  3WKL A;  1ZUB A;  5E21 A;  2I0L A;  4NXR A;  2UZC A;  2L97 A;  2OMJ A;  3CBX A;  5FB8 C;  3K82 A;  4NMT A;  1RGW A;  4UU6 A;  5A2P A;  4GVC A;  2IWP A;  2WL7 A;  3QO6 A;  4NXQ A;  2YTW A;  3KZD A;  1Q3P A;  5HFF A;  4UU5 A;  2KG2 A;  1KEF A;  2IWO A;  3OU0 A;  2M0V A;  1OBY A;  4JOG A;  5GLJ A;  1R6J A;  2KPL A;  2EEG A;  1ZOK A;  2AWU A;  2LC7 A;  3SUZ A;  2CSJ A;  1WHA A;  4YYX A;  4Q2O A;  4K6Y A;  2EGN A;  5HFE A;  3GAB A;  1KWA A;  2DLU A;  2OSG A;  1QLC A;  2KJD A;  4JOP A;  5F3X A;  3JXT A;  3R69 A;  1UJV A;  1GQ5 A;  2KOM A;  4XHV A;  2O2T A;  3MH4 A;  1WFG A;  1VJ6 A;  2MHO A;  1TP3 A;  3QJM A;  1N99 A;  1X9Z A;  2LOB A;  2W7R A;  3GDU A;  1X6D A;  1XZ9 A;  2AWX A;  1T2M A;  2L4T A;  5HDY A;  3FY5 A;  2JIK A;  3EGH C;  2EEJ A;  3TMH A;  5GND A;  2PA1 A;  4P0C A;  5E6P B;  1MFL A;  2IWQ A;  2FNE A;  2KOJ A;  2EJY A;  3CS0 A;  3VQG A;  2H3M A;  3I4W A;  1Y7N A;  1Z86 A;  2FE5 A;  4GVD A;  1OBX A;  4OEP A;  3SHU A;  1WJL A;  2HGA A;  4JJ3 A;  2JWE A;  1RZX A;  2AWW A;  1V5L A;  1UM1 A;  2R3Y A;  3K50 A;  3NGH A;  5H3J A;  2DAZ A;  5I7Z A;  5E11 A;  2QT5 A;  4NMQ A;  5B6L A;  2KA9 A;  2BYG A;  3DOR A;  3R68 A;  3PV5 A;  1PDR A;  2KPK A;  2P3W A;  5HEY A;  4PQW A;  1M5Z A;  1P1E A;  1SOT A;  5F67 A;  2ZPM A;  3MH6 A;  5HJ1 A;  3RL8 A;  1FCF A;  4RI0 A;  2RRM A;  1VAE A;  5E1Y A;  4F8K A;  1WI4 A;  1UHP A;  3CH8 A;  1BFE A;  2DB5 A;  2QKU A;  2KJK A;  2MX6 A;  2V1W A;  3LNX A;  1X5R A;  3QE1 A;  1WFV A;  2PDZ A;  5EZ0 A;  4Z8J A;  1LCY A;  1Q3O A;  4NMS A;  3GCO A;  3OTP A;  3R0H A;  2ZPL A;  4REY A;  5G1D A;  1TP5 A;  5G1E A;  5D13 A;  1W9Q A;  1V1T A;  5ILB A;  1UF1 A;  1K32 A;  1L6O A;  1X45 A;  4JJ0 A;  2KBS A;  2YT7 A;  1N6F A;  3PDZ A;  1GQ4 A;  4H11 A;  3GDV A;  3TSZ A;  3MH7 A;  1MC7 A;  2FN5 A;  2I0I A;  4IC6 A;  2OCS A;  2VZ5 A;  1P1D A;  1Q7X A;  2D8I A;  1D5G A;  4OAJ A;  5E22 A;  4Q6H A;  3CBZ A;  4K78 A;  5EYZ A;  4O06 A;  2JOA A;  1IU0 A;  3NFK A;  3B76 A;  4FGM A;  3PDV A;  5HFD A;  2M10 A;  1V62 A;  2D92 A;  3SFJ A;  3E17 A;  4JOH A;  1VB7 A;  1WH1 A;  4NMR A;  2G5M B;  2EDP A;  3ID1 A;  5HEB A;  2CS5 A;  3HPK A;  5HFC A;  1B8Q A;  2I04 A;  5DTH A;  3O5N A;  1W9O A;  2PKT A;  3DJA A;  5JXB A;  3VQF A;  2KJP A;  4G69 A;  2V90 A;  1N7F A;  3SOE A;  4YDP A;  2EHR A;  3QJN A;  4Q2N A;  3GJ9 A;  4NXP A;  2OPG A;  4Q6S A;  2M0T A;  1KY9 A;  1N7T A;  3NFL A;  4EDJ A;  1FC6 A;  2ENO A;  3EGG C;  4Q3H A;  3ID3 A;  1WHD A;  4N6X A;  2DM8 A;  1IHJ A;  1WF8 A;  3QGL A;  2JIL A;  2DLS A;  3HVQ C;  3I1E A;  3KZE A;  2OS6 A;  4Z33 A;  3L4F D;  2EV8 A;  4JOR A;  2Z9I A;  5HF1 A;  2KYL A;  2FCF A;  2G2L A;  2H2C A;  4P2A B;  1FC9 A;  3BPU A;  1OZI A;  2GZV A;  4NMP A;  5HET A;  3I18 A;  2L4S A;  2JXO A;  2VWR A;  4HOP A;  1YBO A;  5FHT A;  2I1N A;  2K20 A;  1IU2 A;  1SOZ A;  2M3M A;  3ZRT A;  2DC2 A;  1NF3 C;  1Y8T A;  3DJ1 A;  4R2Z A;  4E34 A;  3K1R A;  1Z87 A;  3CYY A;  4JOJ A;  4Q2P A;  3GCN A;  3HPM A;  3DJ3 A;  4JL7 A;  2W4F A;  4HOP B;  3QDO A;  3CBY A;  2QKV A;  1W9E A;  2Q3G A;  2EXG A;  3PS4 A;  2YT8 A;  2EDZ A;  2X7Z A;  2QBW A;  1N6D A;  1UJU A;  1WI2 A;  1G9O A;  2DKR A;  3ID2 A;  2DMZ A;  3KDG A;  3STJ A;  2F5Y A;  2F0A A;  1WIF A;  2VRF A;  1X5N A;  2LC6 A;  1NTE A;  2EGO A;  3GSL A;  2OZF A;  4LMM A;  3SHW A;  1RGR A;  1UEW A;  4WYT A;  2PNT A;  3KDK A;  5B42 A;  3RL7 A;  2HE4 A;  1I16 A;  1U37 A;  3TSW A;  2R4H A;  2LUI A;  1RY4 A;  2KQF A;  1VA8 A;  2M0Z A;  1U39 A;  1N6E A;  1TQ3 A;  2REY A;  1U3B A;  1QAV A;  2RCZ A;  2QKT A;  2VPH A;  4E3B A;  1UJD A;  2YUB A;  3PV2 A;  2K1Z A;  2JIN A;  2PKU A;  2EEH A;  4JOF A;  4JOE A;  3CC0 A;  2IWN A;  4JOK A;  2Z17 A;  1QAV B;  2HE2 A;  4NNM A;  1QAU A;  2D90 A;  4KFV A;  4NNL A;  1UEQ A;  1N7E A;  2OGP A;  4WYU A;  5IL9 A;  1MFG A;  2M0U A;  1TE0 A;  4FLN A;  4K72 A;  3GGE A;  3GDS A; 
#chains in the Genus database with same CATH homology
 2EEI A;  2OQS A;  2YUY A;  2VSV A;  3NCV A;  4OEO A;  3TSV A;  4NMO A;  1U38 A;  2DJT A;  5HFB A;  1UEP A;  3O46 A;  2VSP A;  4MPA A;  4Q2Q A;  4NMV A;  1OBZ A;  3DIW A;  2PZD A;  2I6V A;  4K75 A;  3LNY A;  3ID4 A;  1UIT A;  4AMH A;  2QG1 A;  4K76 A;  2AIN A;  3RLE A;  3QIK A;  4GHN A;  4E35 A;  2KOH A;  3AXA A;  5HF4 A;  1GM1 A;  1V6B A;  1UM7 A;  2EGK A;  3KHF A;  2KV8 A;  2KL1 A;  2CSS A;  1FC7 A;  2LA8 A;  1UEZ A;  2EAQ A;  2Q9V A;  1WG6 A;  3WKM A;  1WF7 A;  4KFW A;  2E7K A;  2I4S A;  1X5Q A;  2H2B A;  1VCW A;  2KRG A;  2KAW A;  1V5Q A;  5HED A;  3PV4 A;  2JRE A;  2EDV A;  2GEF A;  1I92 A;  1X8S A;  2JSN A;  1UFX A;  2H3L A;  4L8N A;  1BE9 A;  3WKL A;  1ZUB A;  5E21 A;  2I0L A;  4NXR A;  2UZC A;  2L97 A;  2OMJ A;  3CBX A;  5FB8 C;  3K82 A;  4NMT A;  1RGW A;  4UU6 A;  5A2P A;  4GVC A;  2IWP A;  2WL7 A;  3QO6 A;  4NXQ A;  2YTW A;  3KZD A;  1Q3P A;  5HFF A;  4UU5 A;  2KG2 A;  1KEF A;  2IWO A;  3OU0 A;  2M0V A;  1OBY A;  4JOG A;  5GLJ A;  1R6J A;  2KPL A;  2EEG A;  1ZOK A;  2AWU A;  2LC7 A;  3SUZ A;  2CSJ A;  1WHA A;  4YYX A;  4Q2O A;  4K6Y A;  2EGN A;  5HFE A;  3GAB A;  1KWA A;  2DLU A;  2OSG A;  1QLC A;  2KJD A;  4JOP A;  5F3X A;  3JXT A;  3R69 A;  1UJV A;  1GQ5 A;  2KOM A;  4XHV A;  2O2T A;  3MH4 A;  1WFG A;  1VJ6 A;  2MHO A;  1TP3 A;  3QJM A;  1N99 A;  1X9Z A;  2LOB A;  2W7R A;  3GDU A;  1X6D A;  1XZ9 A;  2AWX A;  1T2M A;  2L4T A;  5HDY A;  3FY5 A;  2JIK A;  3EGH C;  2EEJ A;  3TMH A;  5GND A;  2PA1 A;  4P0C A;  5E6P B;  1MFL A;  2IWQ A;  2FNE A;  2KOJ A;  2EJY A;  3CS0 A;  3VQG A;  2H3M A;  3I4W A;  1Y7N A;  1Z86 A;  2FE5 A;  4GVD A;  1OBX A;  4OEP A;  3SHU A;  1WJL A;  2HGA A;  4JJ3 A;  2JWE A;  1RZX A;  2AWW A;  1V5L A;  1UM1 A;  2R3Y A;  3K50 A;  3NGH A;  5H3J A;  2DAZ A;  5I7Z A;  5E11 A;  2QT5 A;  4NMQ A;  5B6L A;  2KA9 A;  2BYG A;  3DOR A;  3R68 A;  3PV5 A;  1PDR A;  2KPK A;  2P3W A;  5HEY A;  4PQW A;  1M5Z A;  1P1E A;  1SOT A;  5F67 A;  2ZPM A;  3MH6 A;  5HJ1 A;  3RL8 A;  1FCF A;  4RI0 A;  2RRM A;  1VAE A;  5E1Y A;  4F8K A;  1WI4 A;  1UHP A;  3CH8 A;  1BFE A;  2DB5 A;  2QKU A;  2KJK A;  2MX6 A;  2V1W A;  3LNX A;  1X5R A;  3QE1 A;  1WFV A;  2PDZ A;  5EZ0 A;  4Z8J A;  1LCY A;  1Q3O A;  4NMS A;  3GCO A;  3OTP A;  3R0H A;  2ZPL A;  4REY A;  5G1D A;  1TP5 A;  5G1E A;  5D13 A;  1W9Q A;  1V1T A;  5ILB A;  1UF1 A;  1K32 A;  1L6O A;  1X45 A;  4JJ0 A;  2KBS A;  2YT7 A;  1N6F A;  3PDZ A;  1GQ4 A;  4H11 A;  3GDV A;  3TSZ A;  3MH7 A;  1MC7 A;  2FN5 A;  2I0I A;  4IC6 A;  2OCS A;  2VZ5 A;  1P1D A;  1Q7X A;  2D8I A;  1D5G A;  4OAJ A;  5E22 A;  4Q6H A;  3CBZ A;  4K78 A;  5EYZ A;  4O06 A;  2JOA A;  1IU0 A;  3NFK A;  3B76 A;  4FGM A;  3PDV A;  5HFD A;  2M10 A;  1V62 A;  2D92 A;  3SFJ A;  3E17 A;  4JOH A;  1VB7 A;  1WH1 A;  4NMR A;  2G5M B;  2EDP A;  3ID1 A;  5HEB A;  2CS5 A;  3HPK A;  5HFC A;  1B8Q A;  2I04 A;  5DTH A;  3O5N A;  1W9O A;  2PKT A;  3DJA A;  5JXB A;  3VQF A;  2KJP A;  4G69 A;  2V90 A;  1N7F A;  3SOE A;  4YDP A;  2EHR A;  3QJN A;  4Q2N A;  3GJ9 A;  4NXP A;  2OPG A;  4Q6S A;  2M0T A;  1KY9 A;  1N7T A;  3NFL A;  4EDJ A;  1FC6 A;  2ENO A;  3EGG C;  4Q3H A;  3ID3 A;  1WHD A;  4N6X A;  2DM8 A;  1IHJ A;  1WF8 A;  3QGL A;  2JIL A;  2DLS A;  3HVQ C;  3I1E A;  3KZE A;  2OS6 A;  4Z33 A;  3L4F D;  2EV8 A;  4JOR A;  2Z9I A;  5HF1 A;  2KYL A;  2FCF A;  2G2L A;  2H2C A;  4P2A B;  1FC9 A;  3BPU A;  1OZI A;  2GZV A;  4NMP A;  5HET A;  3I18 A;  2L4S A;  2JXO A;  2VWR A;  4HOP A;  1YBO A;  5FHT A;  2I1N A;  2K20 A;  1IU2 A;  1SOZ A;  2M3M A;  3ZRT A;  2DC2 A;  1NF3 C;  1Y8T A;  3DJ1 A;  4R2Z A;  4E34 A;  3K1R A;  1Z87 A;  3CYY A;  4JOJ A;  4Q2P A;  3GCN A;  3HPM A;  3DJ3 A;  4JL7 A;  2W4F A;  4HOP B;  3QDO A;  3CBY A;  2QKV A;  1W9E A;  2Q3G A;  2EXG A;  3PS4 A;  2YT8 A;  2EDZ A;  2X7Z A;  2QBW A;  1N6D A;  1UJU A;  1WI2 A;  1G9O A;  2DKR A;  3ID2 A;  2DMZ A;  3KDG A;  3STJ A;  2F5Y A;  2F0A A;  1WIF A;  2VRF A;  1X5N A;  2LC6 A;  1NTE A;  2EGO A;  3GSL A;  2OZF A;  4LMM A;  3SHW A;  1RGR A;  1UEW A;  4WYT A;  2PNT A;  3KDK A;  5B42 A;  3RL7 A;  2HE4 A;  1I16 A;  1U37 A;  3TSW A;  2R4H A;  2LUI A;  1RY4 A;  2KQF A;  1VA8 A;  2M0Z A;  1U39 A;  1N6E A;  1TQ3 A;  2REY A;  1U3B A;  1QAV A;  2RCZ A;  2QKT A;  2VPH A;  4E3B A;  1UJD A;  2YUB A;  3PV2 A;  2K1Z A;  2JIN A;  2PKU A;  2EEH A;  4JOF A;  4JOE A;  3CC0 A;  2IWN A;  4JOK A;  2Z17 A;  1QAV B;  2HE2 A;  4NNM A;  1QAU A;  2D90 A;  4KFV A;  4NNL A;  1UEQ A;  1N7E A;  2OGP A;  4WYU A;  5IL9 A;  1MFG A;  2M0U A;  1TE0 A;  4FLN A;  4K72 A;  3GGE A;  3GDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...