3I18A

Crystal structure of the pdz domain of the sdrc-like protein (lmo2051) from listeria monocytogenes, northeast structural genomics consortium target lmr166b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
95
Chain Sequence
VKVTYDGVYVMSVKDDVPAADVLHAGDLITEIDGNAFKSSQEFIDYIHSKKVGDTVKINYKHGDKNEQADIKLTAIDKKGTPGIGITLVDDLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2051 protein
publication title Northeast Structural Genomics Consortium Target LmR166B
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 17
structure length 95
sequence length 99
ec nomenclature
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3i18A00
1P1EA 2DLUA 2GZVA 1KWAA 1WG6A 5HEYA 1BFEA 2M0UA 4EDJA 3GCOA 2W4FA 2AINA 2KL1A 2CSSA 2EHRA 3L4FD 2KV8A 3RL8A 2YT8A 3NFKA 1B8QA 3GCNA 3VQGA 4K75A 2OGPA 2G5MB 2I0LA 5HEBA 1V62A 2Q3GA 2K1ZA 3MH6A 1TP5A 2FE5A 2KAWA 4NMVA 2DJTA 2HE4A 4GHNA 3DJAA 4JOKA 1RGRA 3EGGC 5H3JA 3GJ9A 1UM7A 1QAVB 1V5QA 2M0TA 5I7ZA 1W9QA 2D92A 4JOPA 1FCFA 5EZ0A 5E6PB 2ZPMA 1Q7XA 4Q6SA 2JREA 4G69A 3GDUA 4NMRA 3K82A 2ENOA 5HF4A 1ZOKA 2JOAA 3KZDA 3BPUA 4K72A 2VRFA 2OSGA 4NXPA 2M10A 4WYUA 3O46A 3SOEA 4NXQA 2PZDA 2H2CA 5E11A 5HDYA 3ID2A 1X5QA 1UJVA 2M0ZA 4F8KA 1RGWA 2OQSA 3HPKA 5E1YA 1OBXA 1ZUBA 2I04A 4JOGA 2PA1A 2K20A 4Q6HA 3QIKA 2PKTA 1N6EA 2OPGA 2KPKA 2KJPA 3QGLA 2EEGA 4Q2NA 4O06A 1X5RA 1RY4A 2I0IA 2Q9VA 3TSWA 1WFGA 4NNMA 1GQ4A 3VQFA 2KBSA 1TE0A 4Z33A 2IWNA 1N7FA 2D90A 1VJ6A 2KG2A 1W9EA 1UJDA 2KJKA 1K32A 2DLSA 2L4TA 2W7RA 2DM8A 1BE9A 2KA9A 2Z17A 1QLCA 3CC0A 4P2AB 4JL7A 1UF1A 2KYLA 3GDSA 1WIFA 1WHAA 2KOMA 1QAVA 4K78A 2LA8A 2JIKA 1GM1A 3SHUA 1X45A 1N6DA 1X8SA 2EEHA 3DORA 3ID3A 4NMPA 2EJYA 3RLEA 3CS0A 4JOHA 2G2LA 2VWRA 1VCWA 3KHFA 2JXOA 4E34A 1T2MA 1V6BA 3HPMA 1G9OA 2EV8A 2OS6A 1SOZA 4RI0A 2R3YA 1OBZA 4FGMA 2KPLA 2CSJA 4KFVA 3R69A 5HFFA 1WF8A 3I4WA 2FCFA 4JOEA 1UITA 1W9OA 3R68A 2HGAA 3HVQC 2EAQA 3QE1A 1U3BA 4JOJA 2UZCA 4OEOA 3WKMA 5F3XA 3TMHA 2I4SA 1LCYA 2EEJA 2VSVA 2EGOA 1UEWA 3JXTA 1U37A 2WL7A 5EYZA 4AMHA 1M5ZA 3PV4A 2EGKA 4YYXA 1X6DA 1I16A 4HOPA 3SHWA 2KRGA 2LC6A 4Z8JA 5F67A 1U39A 3QJMA 2E7KA 5HFEA 1YBOA 1KY9A 2QKUA 1GQ5A 2JWEA 3DJ3A 4NMTA 5HFCA 1TQ3A 4UU6A 4REYA 4GVDA 5HF1A 1U38A 1D5GA 1FC6A 3TSVA 3QDOA 3E17A 2QKVA 2QBWA 1X5NA 4P0CA 3ID1A 2H3MA 4UU5A 4KFWA 1NF3C 2REYA 1VAEA 1WF7A 5HJ1A 4K76A 2HE2A 2R4HA 2EDPA 2DB5A 2CS5A 3GDVA 2Z9IA 3K50A 5B6LA 3R0HA 4E3BA 1MFLA 2QG1A 2YUBA 2RRMA 3MH7A 2BYGA 2DAZA 2JILA 4NNLA 1N7TA 4XHVA 3LNXA 2F5YA 2QT5A 5HFBA 4K6YA 1WI4A 2MX6A 2IWQA 2AWWA 2H2BA 1OZIA 2PNTA 3SFJA 2O2TA 1OBYA 1V5LA 5HEDA 2KOJA 1Z86A 1Q3PA 2KOHA 2PDZA 3PDVA 2PKUA 1UJUA 3O5NA 3PV2A 2H3LA 3OU0A 1N7EA 2EEIA 1Q3OA 2ZPLA 2RCZA 2YTWA 3CBYA 2M3MA 1RZXA 1SOTA 2AWUA 4NMSA 3QO6A 1I92A 1L6OA 1MFGA 1UM1A 1PDRA 2FNEA 3GGEA 3GSLA 2KQFA 4PQWA 2L4SA 4WYTA 2KJDA 1N99A 3ID4A 3STJA 3EGHC 4JORA 1UEQA 2LOBA 3PS4A 4R2ZA 4LMMA 1WJLA 4N6XA 1Z87A 4NMOA 3OTPA 1FC7A 3AXAA 3TSZA 2F0AA 2I6VA 3PV5A 2QKTA 2IWOA 3ZRTA 2IWPA 1WI2A 4IC6A 4NXRA 3K1RA 2EXGA 2V1WA 4Q2PA 1VB7A 2M0VA 3LNYA 4L8NA 2VPHA 1WFVA 1UEZA 1TP3A 4Q2QA 3SUZA 4JOFA 3CBZA 5FHTA 2VSPA 1V1TA 3KZEA 3MH4A 2VZ5A 1UFXA 5GLJA 5E22A 5HETA 1MC7A 5A2PA 1Y7NA 2I1NA 2EDZA 3CBXA 4GVCA 5HFDA 1Y8TA 1IHJA 5DTHA 1UEPA 3CYYA 2AWXA 3DJ1A 5E21A 1IU0A 2DKRA 2OCSA 2LUIA 1VA8A 1N6FA 3QJNA 2EGNA 4H11A 4E35A 2DC2A 1WHDA 2EDVA 2YT7A 1WH1A 4OAJA 4Q2OA 2L97A 2FN5A 2P3WA 5D13A 2X7ZA 5FB8C 3RL7A 3B76A 3NFLA 3WKLA 1UHPA 2OMJA 1FC9A 4OEPA 5G1DA 3FY5A 4HOPB 3DIWA 1R6JA 1KEFA 2MHOA 2D8IA 2LC7A 1P1DA 5GNDA 1XZ9A 3I18A 3I1EA 2YUYA 1IU2A 1QAUA 2V90A 4NMQA 4YDPA 2DMZA 4Q3HA 3PDZA 5G1EA 1NTEA 3NGHA 3CH8A 4MPAA 2OZFA 2JINA 5JXBA
chains in the Genus database with same CATH superfamily
1P1EA 2DLUA 2GZVA 1KWAA 1WG6A 5HEYA 1BFEA 2M0UA 4EDJA 3GCOA 2W4FA 2AINA 2KL1A 2CSSA 2EHRA 3L4FD 2KV8A 3RL8A 2YT8A 3NFKA 1B8QA 3GCNA 3VQGA 4K75A 2OGPA 2G5MB 2I0LA 5HEBA 1V62A 2Q3GA 2K1ZA 3MH6A 1TP5A 2FE5A 2KAWA 5B42A 4NMVA 5ILBA 2DJTA 2HE4A 4GHNA 3DJAA 4JOKA 1RGRA 3EGGC 5H3JA 3GJ9A 1UM7A 1QAVB 1V5QA 2M0TA 5I7ZA 1W9QA 2D92A 4JOPA 1FCFA 5EZ0A 5E6PB 2ZPMA 1Q7XA 4Q6SA 2JREA 4G69A 3GDUA 4NMRA 3K82A 2ENOA 5HF4A 1ZOKA 2JOAA 3KZDA 3BPUA 4K72A 2VRFA 2OSGA 4NXPA 2M10A 4WYUA 3O46A 3SOEA 4NXQA 2PZDA 2H2CA 5E11A 5HDYA 3ID2A 1X5QA 2GEFA 1UJVA 2M0ZA 4F8KA 1RGWA 2OQSA 3HPKA 5E1YA 1OBXA 1ZUBA 2I04A 4JOGA 2PA1A 2K20A 4Q6HA 3QIKA 2PKTA 1N6EA 2OPGA 2KPKA 2KJPA 3QGLA 2EEGA 2JSNA 4Q2NA 4O06A 1X5RA 1RY4A 2I0IA 2Q9VA 3TSWA 1WFGA 4NNMA 1GQ4A 3VQFA 2KBSA 1TE0A 4Z33A 2IWNA 1N7FA 2D90A 1VJ6A 2KG2A 1W9EA 1UJDA 2KJKA 1K32A 2DLSA 2L4TA 2W7RA 2DM8A 1BE9A 2KA9A 2Z17A 1QLCA 3CC0A 4P2AB 4JL7A 1UF1A 2KYLA 3GDSA 4JJ3A 1WIFA 1WHAA 2KOMA 1QAVA 4K78A 2LA8A 3NCVA 2JIKA 1GM1A 3SHUA 1X45A 1N6DA 1X8SA 2EEHA 3DORA 3ID3A 4NMPA 2EJYA 3RLEA 3CS0A 4JOHA 2G2LA 2VWRA 1VCWA 3KHFA 2JXOA 4E34A 1T2MA 1V6BA 3HPMA 1G9OA 2EV8A 2OS6A 1SOZA 4RI0A 2R3YA 1OBZA 4FGMA 2KPLA 2CSJA 4KFVA 3R69A 5HFFA 1WF8A 3I4WA 2FCFA 4JOEA 1UITA 1W9OA 3R68A 2HGAA 1X9ZA 3HVQC 2EAQA 3QE1A 1U3BA 4JOJA 2UZCA 4OEOA 3WKMA 5F3XA 3TMHA 2I4SA 1LCYA 2EEJA 2VSVA 2EGOA 1UEWA 3JXTA 1U37A 2WL7A 5EYZA 4AMHA 1M5ZA 3PV4A 2EGKA 4YYXA 1X6DA 1I16A 4HOPA 3SHWA 2KRGA 2LC6A 4Z8JA 5F67A 1U39A 3QJMA 2E7KA 5HFEA 1YBOA 1KY9A 2QKUA 1GQ5A 2JWEA 3DJ3A 4NMTA 5HFCA 1TQ3A 4UU6A 4REYA 4GVDA 5HF1A 1U38A 1D5GA 1FC6A 3TSVA 3QDOA 3E17A 2QKVA 2QBWA 1X5NA 4P0CA 3ID1A 2H3MA 4UU5A 4KFWA 1NF3C 2REYA 1VAEA 1WF7A 5HJ1A 4K76A 2HE2A 2R4HA 2EDPA 2DB5A 2CS5A 3GDVA 2Z9IA 3K50A 5B6LA 3R0HA 4E3BA 1MFLA 2QG1A 2YUBA 2RRMA 3MH7A 2BYGA 2DAZA 2JILA 4NNLA 1N7TA 4XHVA 3LNXA 2F5YA 2QT5A 5HFBA 4K6YA 1WI4A 2MX6A 2IWQA 2AWWA 2H2BA 1OZIA 3GABA 2PNTA 3SFJA 2O2TA 1OBYA 1V5LA 5HEDA 2KOJA 4JJ0A 1Z86A 1Q3PA 2KOHA 2PDZA 3PDVA 2PKUA 1UJUA 3O5NA 3PV2A 5IL9A 2H3LA 3KDGA 3OU0A 1N7EA 2EEIA 1Q3OA 2ZPLA 2RCZA 2YTWA 3CBYA 2M3MA 1RZXA 1SOTA 2AWUA 4NMSA 3QO6A 1I92A 1L6OA 1MFGA 1UM1A 1PDRA 2FNEA 3GGEA 3GSLA 2KQFA 4PQWA 2L4SA 4WYTA 2KJDA 1N99A 3ID4A 3STJA 3EGHC 4JORA 1UEQA 2LOBA 3PS4A 4R2ZA 4LMMA 1WJLA 4N6XA 1Z87A 4NMOA 3OTPA 1FC7A 3AXAA 3TSZA 2F0AA 2I6VA 3PV5A 2QKTA 2IWOA 3ZRTA 2IWPA 1WI2A 4IC6A 4NXRA 3K1RA 2EXGA 2V1WA 4Q2PA 1VB7A 2M0VA 3LNYA 4L8NA 2VPHA 1WFVA 1UEZA 1TP3A 4Q2QA 3SUZA 4JOFA 3CBZA 5FHTA 2VSPA 1V1TA 3KZEA 3MH4A 2VZ5A 1UFXA 5GLJA 5E22A 5HETA 1MC7A 5A2PA 1Y7NA 2I1NA 2EDZA 3CBXA 4GVCA 5HFDA 1Y8TA 4FLNA 1IHJA 5DTHA 1UEPA 3CYYA 2AWXA 3DJ1A 5E21A 1IU0A 2DKRA 2OCSA 2LUIA 1VA8A 1N6FA 3QJNA 2EGNA 4H11A 4E35A 2DC2A 1WHDA 2EDVA 2YT7A 1WH1A 4OAJA 4Q2OA 2L97A 2FN5A 2P3WA 5D13A 2X7ZA 5FB8C 3RL7A 3B76A 3NFLA 3WKLA 1UHPA 2OMJA 1FC9A 4OEPA 5G1DA 3FY5A 4HOPB 3DIWA 3KDKA 1R6JA 1KEFA 2MHOA 2D8IA 2LC7A 1P1DA 5GNDA 1XZ9A 3I18A 3I1EA 2YUYA 1IU2A 1QAUA 2V90A 4NMQA 4YDPA 2DMZA 4Q3HA 3PDZA 5G1EA 1NTEA 3NGHA 3CH8A 4MPAA 2OZFA 2JINA 5JXBA
chains in the Genus database with same CATH topology
1P1EA 2DLUA 2GZVA 1KWAA 1WG6A 5HEYA 1BFEA 2M0UA 4EDJA 3GCOA 2W4FA 2AINA 2KL1A 2CSSA 2EHRA 3L4FD 2KV8A 3RL8A 2YT8A 3NFKA 1B8QA 3GCNA 3VQGA 4K75A 2OGPA 2G5MB 2I0LA 5HEBA 1V62A 2Q3GA 2K1ZA 3MH6A 1TP5A 2FE5A 2KAWA 5B42A 4NMVA 5ILBA 2DJTA 2HE4A 4GHNA 3DJAA 4JOKA 1RGRA 3EGGC 5H3JA 3GJ9A 1UM7A 1QAVB 1V5QA 2M0TA 5I7ZA 1W9QA 2D92A 4JOPA 1FCFA 5EZ0A 5E6PB 2ZPMA 1Q7XA 4Q6SA 2JREA 4G69A 3GDUA 4NMRA 3K82A 2ENOA 5HF4A 1ZOKA 2JOAA 3KZDA 3BPUA 4K72A 2VRFA 2OSGA 4NXPA 2M10A 4WYUA 3O46A 3SOEA 4NXQA 2PZDA 2H2CA 5E11A 5HDYA 3ID2A 1X5QA 2GEFA 1UJVA 2M0ZA 4F8KA 1RGWA 2OQSA 3HPKA 5E1YA 1OBXA 1ZUBA 2I04A 4JOGA 2PA1A 2K20A 4Q6HA 3QIKA 2PKTA 1N6EA 2OPGA 2KPKA 2KJPA 3QGLA 2EEGA 2JSNA 4Q2NA 4O06A 1X5RA 1RY4A 2I0IA 2Q9VA 3TSWA 1WFGA 4NNMA 1GQ4A 3VQFA 2KBSA 1TE0A 4Z33A 2IWNA 1N7FA 2D90A 1VJ6A 2KG2A 1W9EA 1UJDA 2KJKA 1K32A 2DLSA 2L4TA 2W7RA 2DM8A 1BE9A 2KA9A 2Z17A 1QLCA 3CC0A 4P2AB 4JL7A 1UF1A 2KYLA 3GDSA 4JJ3A 1WIFA 1WHAA 2KOMA 1QAVA 4K78A 2LA8A 3NCVA 2JIKA 1GM1A 3SHUA 1X45A 1N6DA 1X8SA 2EEHA 3DORA 3ID3A 4NMPA 2EJYA 3RLEA 3CS0A 4JOHA 2G2LA 2VWRA 1VCWA 3KHFA 2JXOA 4E34A 1T2MA 1V6BA 3HPMA 1G9OA 2EV8A 2OS6A 1SOZA 4RI0A 2R3YA 1OBZA 4FGMA 2KPLA 2CSJA 4KFVA 3R69A 5HFFA 1WF8A 3I4WA 2FCFA 4JOEA 1UITA 1W9OA 3R68A 2HGAA 1X9ZA 3HVQC 2EAQA 3QE1A 1U3BA 4JOJA 2UZCA 4OEOA 3WKMA 5F3XA 3TMHA 2I4SA 1LCYA 2EEJA 2VSVA 2EGOA 1UEWA 3JXTA 1U37A 2WL7A 5EYZA 4AMHA 1M5ZA 3PV4A 2EGKA 4YYXA 1X6DA 1I16A 4HOPA 3SHWA 2KRGA 2LC6A 4Z8JA 5F67A 1U39A 3QJMA 2E7KA 5HFEA 1YBOA 1KY9A 2QKUA 1GQ5A 2JWEA 3DJ3A 4NMTA 5HFCA 1TQ3A 4UU6A 4REYA 4GVDA 5HF1A 1U38A 1D5GA 1FC6A 3TSVA 3QDOA 3E17A 2QKVA 2QBWA 1X5NA 4P0CA 3ID1A 2H3MA 4UU5A 4KFWA 1NF3C 2REYA 1VAEA 1WF7A 5HJ1A 4K76A 2HE2A 2R4HA 2EDPA 2DB5A 2CS5A 3GDVA 2Z9IA 3K50A 5B6LA 3R0HA 4E3BA 1MFLA 2QG1A 2YUBA 2RRMA 3MH7A 2BYGA 2DAZA 2JILA 4NNLA 1N7TA 4XHVA 3LNXA 2F5YA 2QT5A 5HFBA 4K6YA 1WI4A 2MX6A 2IWQA 2AWWA 2H2BA 1OZIA 3GABA 2PNTA 3SFJA 2O2TA 1OBYA 1V5LA 5HEDA 2KOJA 4JJ0A 1Z86A 1Q3PA 2KOHA 2PDZA 3PDVA 2PKUA 1UJUA 3O5NA 3PV2A 5IL9A 2H3LA 3KDGA 3OU0A 1N7EA 2EEIA 1Q3OA 2ZPLA 2RCZA 2YTWA 3CBYA 2M3MA 1RZXA 1SOTA 2AWUA 4NMSA 3QO6A 1I92A 1L6OA 1MFGA 1UM1A 1PDRA 2FNEA 3GGEA 3GSLA 2KQFA 4PQWA 2L4SA 4WYTA 2KJDA 1N99A 3ID4A 3STJA 3EGHC 4JORA 1UEQA 2LOBA 3PS4A 4R2ZA 4LMMA 1WJLA 4N6XA 1Z87A 4NMOA 3OTPA 1FC7A 3AXAA 3TSZA 2F0AA 2I6VA 3PV5A 2QKTA 2IWOA 3ZRTA 2IWPA 1WI2A 4IC6A 4NXRA 3K1RA 2EXGA 2V1WA 4Q2PA 1VB7A 2M0VA 3LNYA 4L8NA 2VPHA 1WFVA 1UEZA 1TP3A 4Q2QA 3SUZA 4JOFA 3CBZA 5FHTA 2VSPA 1V1TA 3KZEA 3MH4A 2VZ5A 1UFXA 5GLJA 5E22A 5HETA 1MC7A 5A2PA 1Y7NA 2I1NA 2EDZA 3CBXA 4GVCA 5HFDA 1Y8TA 4FLNA 1IHJA 5DTHA 1UEPA 3CYYA 2AWXA 3DJ1A 5E21A 1IU0A 2DKRA 2OCSA 2LUIA 1VA8A 1N6FA 3QJNA 2EGNA 4H11A 4E35A 2DC2A 1WHDA 2EDVA 2YT7A 1WH1A 4OAJA 4Q2OA 2L97A 2FN5A 2P3WA 5D13A 2X7ZA 5FB8C 3RL7A 3B76A 3NFLA 3WKLA 1UHPA 2OMJA 1FC9A 4OEPA 5G1DA 3FY5A 4HOPB 3DIWA 3KDKA 1R6JA 1KEFA 2MHOA 2D8IA 2LC7A 1P1DA 5GNDA 1XZ9A 3I18A 3I1EA 2YUYA 1IU2A 1QAUA 2V90A 4NMQA 4YDPA 2DMZA 4Q3HA 3PDZA 5G1EA 1NTEA 3NGHA 3CH8A 4MPAA 2OZFA 2JINA 5JXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1E A;  2DLU A;  2GZV A;  1KWA A;  1WG6 A;  5HEY A;  1BFE A;  2M0U A;  4EDJ A;  3GCO A;  2W4F A;  2AIN A;  2KL1 A;  2CSS A;  2EHR A;  3L4F D;  2KV8 A;  3RL8 A;  2YT8 A;  3NFK A;  1B8Q A;  3GCN A;  3VQG A;  4K75 A;  2OGP A;  2G5M B;  2I0L A;  5HEB A;  1V62 A;  2Q3G A;  2K1Z A;  3MH6 A;  1TP5 A;  2FE5 A;  2KAW A;  4NMV A;  2DJT A;  2HE4 A;  4GHN A;  3DJA A;  4JOK A;  1RGR A;  3EGG C;  5H3J A;  3GJ9 A;  1UM7 A;  1QAV B;  1V5Q A;  2M0T A;  5I7Z A;  1W9Q A;  2D92 A;  4JOP A;  1FCF A;  5EZ0 A;  5E6P B;  2ZPM A;  1Q7X A;  4Q6S A;  2JRE A;  4G69 A;  3GDU A;  4NMR A;  3K82 A;  2ENO A;  5HF4 A;  1ZOK A;  2JOA A;  3KZD A;  3BPU A;  4K72 A;  2VRF A;  2OSG A;  4NXP A;  2M10 A;  4WYU A;  3O46 A;  3SOE A;  4NXQ A;  2PZD A;  2H2C A;  5E11 A;  5HDY A;  3ID2 A;  1X5Q A;  1UJV A;  2M0Z A;  4F8K A;  1RGW A;  2OQS A;  3HPK A;  5E1Y A;  1OBX A;  1ZUB A;  2I04 A;  4JOG A;  2PA1 A;  2K20 A;  4Q6H A;  3QIK A;  2PKT A;  1N6E A;  2OPG A;  2KPK A;  2KJP A;  3QGL A;  2EEG A;  4Q2N A;  4O06 A;  1X5R A;  1RY4 A;  2I0I A;  2Q9V A;  3TSW A;  1WFG A;  4NNM A;  1GQ4 A;  3VQF A;  2KBS A;  1TE0 A;  4Z33 A;  2IWN A;  1N7F A;  2D90 A;  1VJ6 A;  2KG2 A;  1W9E A;  1UJD A;  2KJK A;  1K32 A;  2DLS A;  2L4T A;  2W7R A;  2DM8 A;  1BE9 A;  2KA9 A;  2Z17 A;  1QLC A;  3CC0 A;  4P2A B;  4JL7 A;  1UF1 A;  2KYL A;  3GDS A;  1WIF A;  1WHA A;  2KOM A;  1QAV A;  4K78 A;  2LA8 A;  2JIK A;  1GM1 A;  3SHU A;  1X45 A;  1N6D A;  1X8S A;  2EEH A;  3DOR A;  3ID3 A;  4NMP A;  2EJY A;  3RLE A;  3CS0 A;  4JOH A;  2G2L A;  2VWR A;  1VCW A;  3KHF A;  2JXO A;  4E34 A;  1T2M A;  1V6B A;  3HPM A;  1G9O A;  2EV8 A;  2OS6 A;  1SOZ A;  4RI0 A;  2R3Y A;  1OBZ A;  4FGM A;  2KPL A;  2CSJ A;  4KFV A;  3R69 A;  5HFF A;  1WF8 A;  3I4W A;  2FCF A;  4JOE A;  1UIT A;  1W9O A;  3R68 A;  2HGA A;  3HVQ C;  2EAQ A;  3QE1 A;  1U3B A;  4JOJ A;  2UZC A;  4OEO A;  3WKM A;  5F3X A;  3TMH A;  2I4S A;  1LCY A;  2EEJ A;  2VSV A;  2EGO A;  1UEW A;  3JXT A;  1U37 A;  2WL7 A;  5EYZ A;  4AMH A;  1M5Z A;  3PV4 A;  2EGK A;  4YYX A;  1X6D A;  1I16 A;  4HOP A;  3SHW A;  2KRG A;  2LC6 A;  4Z8J A;  5F67 A;  1U39 A;  3QJM A;  2E7K A;  5HFE A;  1YBO A;  1KY9 A;  2QKU A;  1GQ5 A;  2JWE A;  3DJ3 A;  4NMT A;  5HFC A;  1TQ3 A;  4UU6 A;  4REY A;  4GVD A;  5HF1 A;  1U38 A;  1D5G A;  1FC6 A;  3TSV A;  3QDO A;  3E17 A;  2QKV A;  2QBW A;  1X5N A;  4P0C A;  3ID1 A;  2H3M A;  4UU5 A;  4KFW A;  1NF3 C;  2REY A;  1VAE A;  1WF7 A;  5HJ1 A;  4K76 A;  2HE2 A;  2R4H A;  2EDP A;  2DB5 A;  2CS5 A;  3GDV A;  2Z9I A;  3K50 A;  5B6L A;  3R0H A;  4E3B A;  1MFL A;  2QG1 A;  2YUB A;  2RRM A;  3MH7 A;  2BYG A;  2DAZ A;  2JIL A;  4NNL A;  1N7T A;  4XHV A;  3LNX A;  2F5Y A;  2QT5 A;  5HFB A;  4K6Y A;  1WI4 A;  2MX6 A;  2IWQ A;  2AWW A;  2H2B A;  1OZI A;  2PNT A;  3SFJ A;  2O2T A;  1OBY A;  1V5L A;  5HED A;  2KOJ A;  1Z86 A;  1Q3P A;  2KOH A;  2PDZ A;  3PDV A;  2PKU A;  1UJU A;  3O5N A;  3PV2 A;  2H3L A;  3OU0 A;  1N7E A;  2EEI A;  1Q3O A;  2ZPL A;  2RCZ A;  2YTW A;  3CBY A;  2M3M A;  1RZX A;  1SOT A;  2AWU A;  4NMS A;  3QO6 A;  1I92 A;  1L6O A;  1MFG A;  1UM1 A;  1PDR A;  2FNE A;  3GGE A;  3GSL A;  2KQF A;  4PQW A;  2L4S A;  4WYT A;  2KJD A;  1N99 A;  3ID4 A;  3STJ A;  3EGH C;  4JOR A;  1UEQ A;  2LOB A;  3PS4 A;  4R2Z A;  4LMM A;  1WJL A;  4N6X A;  1Z87 A;  4NMO A;  3OTP A;  1FC7 A;  3AXA A;  3TSZ A;  2F0A A;  2I6V A;  3PV5 A;  2QKT A;  2IWO A;  3ZRT A;  2IWP A;  1WI2 A;  4IC6 A;  4NXR A;  3K1R A;  2EXG A;  2V1W A;  4Q2P A;  1VB7 A;  2M0V A;  3LNY A;  4L8N A;  2VPH A;  1WFV A;  1UEZ A;  1TP3 A;  4Q2Q A;  3SUZ A;  4JOF A;  3CBZ A;  5FHT A;  2VSP A;  1V1T A;  3KZE A;  3MH4 A;  2VZ5 A;  1UFX A;  5GLJ A;  5E22 A;  5HET A;  1MC7 A;  5A2P A;  1Y7N A;  2I1N A;  2EDZ A;  3CBX A;  4GVC A;  5HFD A;  1Y8T A;  1IHJ A;  5DTH A;  1UEP A;  3CYY A;  2AWX A;  3DJ1 A;  5E21 A;  1IU0 A;  2DKR A;  2OCS A;  2LUI A;  1VA8 A;  1N6F A;  3QJN A;  2EGN A;  4H11 A;  4E35 A;  2DC2 A;  1WHD A;  2EDV A;  2YT7 A;  1WH1 A;  4OAJ A;  4Q2O A;  2L97 A;  2FN5 A;  2P3W A;  5D13 A;  2X7Z A;  5FB8 C;  3RL7 A;  3B76 A;  3NFL A;  3WKL A;  1UHP A;  2OMJ A;  1FC9 A;  4OEP A;  5G1D A;  3FY5 A;  4HOP B;  3DIW A;  1R6J A;  1KEF A;  2MHO A;  2D8I A;  2LC7 A;  1P1D A;  5GND A;  1XZ9 A;  3I18 A;  3I1E A;  2YUY A;  1IU2 A;  1QAU A;  2V90 A;  4NMQ A;  4YDP A;  2DMZ A;  4Q3H A;  3PDZ A;  5G1E A;  1NTE A;  3NGH A;  3CH8 A;  4MPA A;  2OZF A;  2JIN A;  5JXB A; 
#chains in the Genus database with same CATH topology
 1P1E A;  2DLU A;  2GZV A;  1KWA A;  1WG6 A;  5HEY A;  1BFE A;  2M0U A;  4EDJ A;  3GCO A;  2W4F A;  2AIN A;  2KL1 A;  2CSS A;  2EHR A;  3L4F D;  2KV8 A;  3RL8 A;  2YT8 A;  3NFK A;  1B8Q A;  3GCN A;  3VQG A;  4K75 A;  2OGP A;  2G5M B;  2I0L A;  5HEB A;  1V62 A;  2Q3G A;  2K1Z A;  3MH6 A;  1TP5 A;  2FE5 A;  2KAW A;  5B42 A;  4NMV A;  5ILB A;  2DJT A;  2HE4 A;  4GHN A;  3DJA A;  4JOK A;  1RGR A;  3EGG C;  5H3J A;  3GJ9 A;  1UM7 A;  1QAV B;  1V5Q A;  2M0T A;  5I7Z A;  1W9Q A;  2D92 A;  4JOP A;  1FCF A;  5EZ0 A;  5E6P B;  2ZPM A;  1Q7X A;  4Q6S A;  2JRE A;  4G69 A;  3GDU A;  4NMR A;  3K82 A;  2ENO A;  5HF4 A;  1ZOK A;  2JOA A;  3KZD A;  3BPU A;  4K72 A;  2VRF A;  2OSG A;  4NXP A;  2M10 A;  4WYU A;  3O46 A;  3SOE A;  4NXQ A;  2PZD A;  2H2C A;  5E11 A;  5HDY A;  3ID2 A;  1X5Q A;  2GEF A;  1UJV A;  2M0Z A;  4F8K A;  1RGW A;  2OQS A;  3HPK A;  5E1Y A;  1OBX A;  1ZUB A;  2I04 A;  4JOG A;  2PA1 A;  2K20 A;  4Q6H A;  3QIK A;  2PKT A;  1N6E A;  2OPG A;  2KPK A;  2KJP A;  3QGL A;  2EEG A;  2JSN A;  4Q2N A;  4O06 A;  1X5R A;  1RY4 A;  2I0I A;  2Q9V A;  3TSW A;  1WFG A;  4NNM A;  1GQ4 A;  3VQF A;  2KBS A;  1TE0 A;  4Z33 A;  2IWN A;  1N7F A;  2D90 A;  1VJ6 A;  2KG2 A;  1W9E A;  1UJD A;  2KJK A;  1K32 A;  2DLS A;  2L4T A;  2W7R A;  2DM8 A;  1BE9 A;  2KA9 A;  2Z17 A;  1QLC A;  3CC0 A;  4P2A B;  4JL7 A;  1UF1 A;  2KYL A;  3GDS A;  4JJ3 A;  1WIF A;  1WHA A;  2KOM A;  1QAV A;  4K78 A;  2LA8 A;  3NCV A;  2JIK A;  1GM1 A;  3SHU A;  1X45 A;  1N6D A;  1X8S A;  2EEH A;  3DOR A;  3ID3 A;  4NMP A;  2EJY A;  3RLE A;  3CS0 A;  4JOH A;  2G2L A;  2VWR A;  1VCW A;  3KHF A;  2JXO A;  4E34 A;  1T2M A;  1V6B A;  3HPM A;  1G9O A;  2EV8 A;  2OS6 A;  1SOZ A;  4RI0 A;  2R3Y A;  1OBZ A;  4FGM A;  2KPL A;  2CSJ A;  4KFV A;  3R69 A;  5HFF A;  1WF8 A;  3I4W A;  2FCF A;  4JOE A;  1UIT A;  1W9O A;  3R68 A;  2HGA A;  1X9Z A;  3HVQ C;  2EAQ A;  3QE1 A;  1U3B A;  4JOJ A;  2UZC A;  4OEO A;  3WKM A;  5F3X A;  3TMH A;  2I4S A;  1LCY A;  2EEJ A;  2VSV A;  2EGO A;  1UEW A;  3JXT A;  1U37 A;  2WL7 A;  5EYZ A;  4AMH A;  1M5Z A;  3PV4 A;  2EGK A;  4YYX A;  1X6D A;  1I16 A;  4HOP A;  3SHW A;  2KRG A;  2LC6 A;  4Z8J A;  5F67 A;  1U39 A;  3QJM A;  2E7K A;  5HFE A;  1YBO A;  1KY9 A;  2QKU A;  1GQ5 A;  2JWE A;  3DJ3 A;  4NMT A;  5HFC A;  1TQ3 A;  4UU6 A;  4REY A;  4GVD A;  5HF1 A;  1U38 A;  1D5G A;  1FC6 A;  3TSV A;  3QDO A;  3E17 A;  2QKV A;  2QBW A;  1X5N A;  4P0C A;  3ID1 A;  2H3M A;  4UU5 A;  4KFW A;  1NF3 C;  2REY A;  1VAE A;  1WF7 A;  5HJ1 A;  4K76 A;  2HE2 A;  2R4H A;  2EDP A;  2DB5 A;  2CS5 A;  3GDV A;  2Z9I A;  3K50 A;  5B6L A;  3R0H A;  4E3B A;  1MFL A;  2QG1 A;  2YUB A;  2RRM A;  3MH7 A;  2BYG A;  2DAZ A;  2JIL A;  4NNL A;  1N7T A;  4XHV A;  3LNX A;  2F5Y A;  2QT5 A;  5HFB A;  4K6Y A;  1WI4 A;  2MX6 A;  2IWQ A;  2AWW A;  2H2B A;  1OZI A;  3GAB A;  2PNT A;  3SFJ A;  2O2T A;  1OBY A;  1V5L A;  5HED A;  2KOJ A;  4JJ0 A;  1Z86 A;  1Q3P A;  2KOH A;  2PDZ A;  3PDV A;  2PKU A;  1UJU A;  3O5N A;  3PV2 A;  5IL9 A;  2H3L A;  3KDG A;  3OU0 A;  1N7E A;  2EEI A;  1Q3O A;  2ZPL A;  2RCZ A;  2YTW A;  3CBY A;  2M3M A;  1RZX A;  1SOT A;  2AWU A;  4NMS A;  3QO6 A;  1I92 A;  1L6O A;  1MFG A;  1UM1 A;  1PDR A;  2FNE A;  3GGE A;  3GSL A;  2KQF A;  4PQW A;  2L4S A;  4WYT A;  2KJD A;  1N99 A;  3ID4 A;  3STJ A;  3EGH C;  4JOR A;  1UEQ A;  2LOB A;  3PS4 A;  4R2Z A;  4LMM A;  1WJL A;  4N6X A;  1Z87 A;  4NMO A;  3OTP A;  1FC7 A;  3AXA A;  3TSZ A;  2F0A A;  2I6V A;  3PV5 A;  2QKT A;  2IWO A;  3ZRT A;  2IWP A;  1WI2 A;  4IC6 A;  4NXR A;  3K1R A;  2EXG A;  2V1W A;  4Q2P A;  1VB7 A;  2M0V A;  3LNY A;  4L8N A;  2VPH A;  1WFV A;  1UEZ A;  1TP3 A;  4Q2Q A;  3SUZ A;  4JOF A;  3CBZ A;  5FHT A;  2VSP A;  1V1T A;  3KZE A;  3MH4 A;  2VZ5 A;  1UFX A;  5GLJ A;  5E22 A;  5HET A;  1MC7 A;  5A2P A;  1Y7N A;  2I1N A;  2EDZ A;  3CBX A;  4GVC A;  5HFD A;  1Y8T A;  4FLN A;  1IHJ A;  5DTH A;  1UEP A;  3CYY A;  2AWX A;  3DJ1 A;  5E21 A;  1IU0 A;  2DKR A;  2OCS A;  2LUI A;  1VA8 A;  1N6F A;  3QJN A;  2EGN A;  4H11 A;  4E35 A;  2DC2 A;  1WHD A;  2EDV A;  2YT7 A;  1WH1 A;  4OAJ A;  4Q2O A;  2L97 A;  2FN5 A;  2P3W A;  5D13 A;  2X7Z A;  5FB8 C;  3RL7 A;  3B76 A;  3NFL A;  3WKL A;  1UHP A;  2OMJ A;  1FC9 A;  4OEP A;  5G1D A;  3FY5 A;  4HOP B;  3DIW A;  3KDK A;  1R6J A;  1KEF A;  2MHO A;  2D8I A;  2LC7 A;  1P1D A;  5GND A;  1XZ9 A;  3I18 A;  3I1E A;  2YUY A;  1IU2 A;  1QAU A;  2V90 A;  4NMQ A;  4YDP A;  2DMZ A;  4Q3H A;  3PDZ A;  5G1E A;  1NTE A;  3NGH A;  3CH8 A;  4MPA A;  2OZF A;  2JIN A;  5JXB A; 
#chains in the Genus database with same CATH homology
 1P1E A;  2DLU A;  2GZV A;  1KWA A;  1WG6 A;  5HEY A;  1BFE A;  2M0U A;  4EDJ A;  3GCO A;  2W4F A;  2AIN A;  2KL1 A;  2CSS A;  2EHR A;  3L4F D;  2KV8 A;  3RL8 A;  2YT8 A;  3NFK A;  1B8Q A;  3GCN A;  3VQG A;  4K75 A;  2OGP A;  2G5M B;  2I0L A;  5HEB A;  1V62 A;  2Q3G A;  2K1Z A;  3MH6 A;  1TP5 A;  2FE5 A;  2KAW A;  5B42 A;  4NMV A;  5ILB A;  2DJT A;  2HE4 A;  4GHN A;  3DJA A;  4JOK A;  1RGR A;  3EGG C;  5H3J A;  3GJ9 A;  1UM7 A;  1QAV B;  1V5Q A;  2M0T A;  5I7Z A;  1W9Q A;  2D92 A;  4JOP A;  1FCF A;  5EZ0 A;  5E6P B;  2ZPM A;  1Q7X A;  4Q6S A;  2JRE A;  4G69 A;  3GDU A;  4NMR A;  3K82 A;  2ENO A;  5HF4 A;  1ZOK A;  2JOA A;  3KZD A;  3BPU A;  4K72 A;  2VRF A;  2OSG A;  4NXP A;  2M10 A;  4WYU A;  3O46 A;  3SOE A;  4NXQ A;  2PZD A;  2H2C A;  5E11 A;  5HDY A;  3ID2 A;  1X5Q A;  2GEF A;  1UJV A;  2M0Z A;  4F8K A;  1RGW A;  2OQS A;  3HPK A;  5E1Y A;  1OBX A;  1ZUB A;  2I04 A;  4JOG A;  2PA1 A;  2K20 A;  4Q6H A;  3QIK A;  2PKT A;  1N6E A;  2OPG A;  2KPK A;  2KJP A;  3QGL A;  2EEG A;  2JSN A;  4Q2N A;  4O06 A;  1X5R A;  1RY4 A;  2I0I A;  2Q9V A;  3TSW A;  1WFG A;  4NNM A;  1GQ4 A;  3VQF A;  2KBS A;  1TE0 A;  4Z33 A;  2IWN A;  1N7F A;  2D90 A;  1VJ6 A;  2KG2 A;  1W9E A;  1UJD A;  2KJK A;  1K32 A;  2DLS A;  2L4T A;  2W7R A;  2DM8 A;  1BE9 A;  2KA9 A;  2Z17 A;  1QLC A;  3CC0 A;  4P2A B;  4JL7 A;  1UF1 A;  2KYL A;  3GDS A;  4JJ3 A;  1WIF A;  1WHA A;  2KOM A;  1QAV A;  4K78 A;  2LA8 A;  3NCV A;  2JIK A;  1GM1 A;  3SHU A;  1X45 A;  1N6D A;  1X8S A;  2EEH A;  3DOR A;  3ID3 A;  4NMP A;  2EJY A;  3RLE A;  3CS0 A;  4JOH A;  2G2L A;  2VWR A;  1VCW A;  3KHF A;  2JXO A;  4E34 A;  1T2M A;  1V6B A;  3HPM A;  1G9O A;  2EV8 A;  2OS6 A;  1SOZ A;  4RI0 A;  2R3Y A;  1OBZ A;  4FGM A;  2KPL A;  2CSJ A;  4KFV A;  3R69 A;  5HFF A;  1WF8 A;  3I4W A;  2FCF A;  4JOE A;  1UIT A;  1W9O A;  3R68 A;  2HGA A;  1X9Z A;  3HVQ C;  2EAQ A;  3QE1 A;  1U3B A;  4JOJ A;  2UZC A;  4OEO A;  3WKM A;  5F3X A;  3TMH A;  2I4S A;  1LCY A;  2EEJ A;  2VSV A;  2EGO A;  1UEW A;  3JXT A;  1U37 A;  2WL7 A;  5EYZ A;  4AMH A;  1M5Z A;  3PV4 A;  2EGK A;  4YYX A;  1X6D A;  1I16 A;  4HOP A;  3SHW A;  2KRG A;  2LC6 A;  4Z8J A;  5F67 A;  1U39 A;  3QJM A;  2E7K A;  5HFE A;  1YBO A;  1KY9 A;  2QKU A;  1GQ5 A;  2JWE A;  3DJ3 A;  4NMT A;  5HFC A;  1TQ3 A;  4UU6 A;  4REY A;  4GVD A;  5HF1 A;  1U38 A;  1D5G A;  1FC6 A;  3TSV A;  3QDO A;  3E17 A;  2QKV A;  2QBW A;  1X5N A;  4P0C A;  3ID1 A;  2H3M A;  4UU5 A;  4KFW A;  1NF3 C;  2REY A;  1VAE A;  1WF7 A;  5HJ1 A;  4K76 A;  2HE2 A;  2R4H A;  2EDP A;  2DB5 A;  2CS5 A;  3GDV A;  2Z9I A;  3K50 A;  5B6L A;  3R0H A;  4E3B A;  1MFL A;  2QG1 A;  2YUB A;  2RRM A;  3MH7 A;  2BYG A;  2DAZ A;  2JIL A;  4NNL A;  1N7T A;  4XHV A;  3LNX A;  2F5Y A;  2QT5 A;  5HFB A;  4K6Y A;  1WI4 A;  2MX6 A;  2IWQ A;  2AWW A;  2H2B A;  1OZI A;  3GAB A;  2PNT A;  3SFJ A;  2O2T A;  1OBY A;  1V5L A;  5HED A;  2KOJ A;  4JJ0 A;  1Z86 A;  1Q3P A;  2KOH A;  2PDZ A;  3PDV A;  2PKU A;  1UJU A;  3O5N A;  3PV2 A;  5IL9 A;  2H3L A;  3KDG A;  3OU0 A;  1N7E A;  2EEI A;  1Q3O A;  2ZPL A;  2RCZ A;  2YTW A;  3CBY A;  2M3M A;  1RZX A;  1SOT A;  2AWU A;  4NMS A;  3QO6 A;  1I92 A;  1L6O A;  1MFG A;  1UM1 A;  1PDR A;  2FNE A;  3GGE A;  3GSL A;  2KQF A;  4PQW A;  2L4S A;  4WYT A;  2KJD A;  1N99 A;  3ID4 A;  3STJ A;  3EGH C;  4JOR A;  1UEQ A;  2LOB A;  3PS4 A;  4R2Z A;  4LMM A;  1WJL A;  4N6X A;  1Z87 A;  4NMO A;  3OTP A;  1FC7 A;  3AXA A;  3TSZ A;  2F0A A;  2I6V A;  3PV5 A;  2QKT A;  2IWO A;  3ZRT A;  2IWP A;  1WI2 A;  4IC6 A;  4NXR A;  3K1R A;  2EXG A;  2V1W A;  4Q2P A;  1VB7 A;  2M0V A;  3LNY A;  4L8N A;  2VPH A;  1WFV A;  1UEZ A;  1TP3 A;  4Q2Q A;  3SUZ A;  4JOF A;  3CBZ A;  5FHT A;  2VSP A;  1V1T A;  3KZE A;  3MH4 A;  2VZ5 A;  1UFX A;  5GLJ A;  5E22 A;  5HET A;  1MC7 A;  5A2P A;  1Y7N A;  2I1N A;  2EDZ A;  3CBX A;  4GVC A;  5HFD A;  1Y8T A;  4FLN A;  1IHJ A;  5DTH A;  1UEP A;  3CYY A;  2AWX A;  3DJ1 A;  5E21 A;  1IU0 A;  2DKR A;  2OCS A;  2LUI A;  1VA8 A;  1N6F A;  3QJN A;  2EGN A;  4H11 A;  4E35 A;  2DC2 A;  1WHD A;  2EDV A;  2YT7 A;  1WH1 A;  4OAJ A;  4Q2O A;  2L97 A;  2FN5 A;  2P3W A;  5D13 A;  2X7Z A;  5FB8 C;  3RL7 A;  3B76 A;  3NFL A;  3WKL A;  1UHP A;  2OMJ A;  1FC9 A;  4OEP A;  5G1D A;  3FY5 A;  4HOP B;  3DIW A;  3KDK A;  1R6J A;  1KEF A;  2MHO A;  2D8I A;  2LC7 A;  1P1D A;  5GND A;  1XZ9 A;  3I18 A;  3I1E A;  2YUY A;  1IU2 A;  1QAU A;  2V90 A;  4NMQ A;  4YDP A;  2DMZ A;  4Q3H A;  3PDZ A;  5G1E A;  1NTE A;  3NGH A;  3CH8 A;  4MPA A;  2OZF A;  2JIN A;  5JXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...