2IWNA

3rd pdz domain of multiple pdz domain protein mpdz (casp target)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
97
structure length
93
Chain Sequence
b'SMSETFDVELTKNVQGLGITIAGYIGDPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MULTIPLE PDZ DOMAIN PROTEIN
publication title Structure of Pick1 and Other Pdz Domains Obtained with the Help of Self-Binding C-Terminal Extension.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 93
sequence length 97
ec nomenclature
pdb deposition date 2006-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2iwnA00
4Q2QA 1GQ5A 1SOZA 4P2AB 3K1RA 2I0IA 2AINA 5D13A 1P1EA 4OEPA 2KJPA 3CBXA 1N99A 3QDOA 1X5NA 2JILA 4HOPA 3ZRTA 1N6DA 2H3LA 5DTHA 2EDPA 2P3WA 1IU0A 2H2CA 1L6OA 3AXAA 4K75A 3PV5A 4JOFA 3GJ9A 2VZ5A 2EV8A 2PZDA 3HPKA 5E6PB 1V5QA 5B6LA 2AWWA 2EEGA 2KPKA 2DM8A 4NMSA 1U38A 4LMMA 1RGWA 4K72A 1TP3A 2M0TA 2M3MA 5HDYA 2PNTA 2HGAA 5E1YA 4FGMA 2Z9IA 4YDPA 1V5LA 4GHNA 1IU2A 3DJ1A 2L97A 1IHJA 1GM1A 2BYGA 4K6YA 2Z17A 2LC7A 5G1DA 4KFWA 3PS4A 2IWOA 1UITA 2D8IA 2OGPA 3QJMA 5H3JA 3QO6A 2D90A 3NGHA 1MC7A 2FCFA 2ZPMA 4NMRA 3STJA 4AMHA 4Q6SA 2EGNA 1X5RA 3O5NA 2WL7A 4NMOA 4EDJA 4JOGA 2VPHA 3NFKA 1N7EA 1X8SA 1KWAA 3QJNA 1MFGA 1NF3C 1UEWA 4R2ZA 1OZIA 2M0ZA 1VAEA 2HE2A 2EDZA 4WYTA 4K76A 4XHVA 2M0VA 2JIKA 2FNEA 3ID4A 5EYZA 3KZDA 2G2LA 1WG6A 2DLSA 3HVQC 2QKVA 1VCWA 3TSZA 4O06A 2K20A 2YTWA 3SUZA 3GDUA 4E35A 3TSWA 2KBSA 2F0AA 2EAQA 4JL7A 3RL8A 5HF1A 5JXBA 3MH6A 1RGRA 2KQFA 2I6VA 2QKTA 1UM7A 2IWPA 1VA8A 4NMTA 1WF8A 2FE5A 1X45A 1ZUBA 2LC6A 2DLUA 2CS5A 2I1NA 1TP5A 1OBXA 2MX6A 3ID2A 4OAJA 1UF1A 1WHAA 3OTPA 3KHFA 2IWNA 1UM1A 5HJ1A 2Q3GA 1WI4A 1QLCA 1T2MA 3I18A 4Z33A 2K1ZA 3SHUA 5I7ZA 1YBOA 2I04A 2REYA 3QGLA 4NMPA 3R68A 2YT8A 4Q6HA 3DJAA 2KJKA 1QAVB 2I0LA 1Q3OA 1WFGA 2R3YA 2UZCA 3GCNA 3GSLA 1RY4A 2PA1A 2VSVA 3WKMA 3SFJA 2OSGA 3SOEA 3CH8A 5HFDA 2EGKA 2EJYA 4JOJA 2ZPLA 2L4TA 3MH7A 4Z8JA 2W7RA 3SHWA 2LOBA 1W9QA 1I16A 1UJDA 2KOJA 1Y8TA 4NXQA 3GDVA 2OMJA 3CS0A 2CSSA 1N6EA 5HFEA 1Z86A 3RL7A 3RLEA 2DAZA 4NXPA 3CYYA 4NNLA 2D92A 3KZEA 4HOPB 2JREA 3FY5A 2KV8A 2VSPA 4OEOA 2DC2A 5A2PA 1KEFA 2KOMA 3PDZA 5HEYA 1R6JA 1V62A 1D5GA 4JOKA 2W4FA 3PDVA 2AWXA 3ID1A 4NMVA 3I4WA 3E17A 4N6XA 3VQGA 5HEDA 1WF7A 1BFEA 3QE1A 1X5QA 1U39A 3R0HA 4NNMA 1OBYA 2KL1A 2JXOA 1X6DA 2Q9VA 1VJ6A 5G1EA 1V6BA 3DJ3A 2EEHA 2GZVA 1UJVA 3O46A 4H11A 3GCOA 1N7FA 5E11A 2V90A 2FN5A 1RZXA 2DKRA 2KOHA 5FHTA 2JWEA 5HFFA 1XZ9A 1ZOKA 1M5ZA 3K50A 2LA8A 4NMQA 4JOPA 1UFXA 2PKTA 1PDRA 2OS6A 2G5MB 4K78A 1U37A 1QAVA 4YYXA 4PQWA 1FC6A 2M0UA 2EGOA 2OCSA 2YUBA 2CSJA 5E21A 4GVDA 1UEPA 1UHPA 4WYUA 4G69A 1K32A 2PKUA 3QIKA 2YUYA 3CC0A 5HETA 1G9OA 3GGEA 4JORA 3ID3A 1FC7A 4UU5A 1I92A 2JOAA 4Q2OA 1FC9A 4RI0A 3EGGC 5E22A 1WIFA 1SOTA 2RCZA 1VB7A 3LNYA 1WH1A 1FCFA 2O2TA 2HE4A 2KAWA 2IWQA 2H3MA 4E34A 1P1DA 3I1EA 2AWUA 2EHRA 1Y7NA 4NXRA 4P0CA 3TSVA 2KPLA 4GVCA 3WKLA 3DORA 2QG1A 3NFLA 3B76A 2X7ZA 1W9OA 2KJDA 5HEBA 1N6FA 2OQSA 5F3XA 5FB8C 4KFVA 3HPMA 4Q2PA 2VWRA 5GLJA 3CBYA 2EDVA 4F8KA 5F67A 5HFCA 5EZ0A 3DIWA 1NTEA 4MPAA 3BPUA 2OPGA 3OU0A 2DJTA 2M10A 2DMZA 1QAUA 2PDZA 1TE0A 3VQFA 2KA9A 3PV4A 1Q3PA 2QT5A 1WFVA 2E7KA 4E3BA 1TQ3A 2I4SA 2OZFA 5HF4A 3L4FD 1U3BA 3EGHC 4Q3HA 1WJLA 1MFLA 3R69A 3K82A 3JXTA 4JOEA 1UJUA 2EXGA 3GDSA 2R4HA 1KY9A 2QBWA 2QKUA 3CBZA 4Q2NA 4REYA 1Q7XA 2F5YA 3LNXA 2H2BA 4L8NA 1W9EA 1BE9A 1UEQA 2DB5A 2L4SA 2JINA 2VRFA 1B8QA 2LUIA 3PV2A 5GNDA 2YT7A 4JOHA 3MH4A 2MHOA 1N7TA 5HFBA 2KRGA 2EEJA 1Z87A 1WI2A 1OBZA 2EEIA 2KYLA 1WHDA 1GQ4A 4UU6A 1UEZA 2V1WA 2ENOA 1V1TA 3TMHA 4IC6A 2KG2A 2RRMA 1LCYA
chains in the Genus database with same CATH superfamily
4Q2QA 1GQ5A 1SOZA 4P2AB 5IL9A 3K1RA 2I0IA 2AINA 5D13A 1P1EA 4OEPA 2KJPA 3CBXA 1N99A 3QDOA 1X5NA 2JILA 4HOPA 3ZRTA 1N6DA 2H3LA 5DTHA 2EDPA 2P3WA 1IU0A 2H2CA 1L6OA 3AXAA 4K75A 3PV5A 4JOFA 3GJ9A 2VZ5A 2EV8A 2PZDA 3HPKA 5E6PB 1V5QA 5B6LA 2AWWA 2EEGA 2KPKA 2DM8A 4NMSA 4JJ0A 1U38A 4LMMA 1RGWA 4K72A 1TP3A 2M0TA 2M3MA 5HDYA 2PNTA 2HGAA 5E1YA 4FGMA 2Z9IA 4YDPA 1V5LA 4GHNA 1IU2A 3DJ1A 2L97A 1IHJA 1GM1A 2BYGA 4K6YA 2Z17A 2LC7A 5G1DA 4KFWA 3PS4A 2IWOA 1UITA 2D8IA 2OGPA 3QJMA 5H3JA 3QO6A 2D90A 3NGHA 1MC7A 2FCFA 2ZPMA 4NMRA 3STJA 4AMHA 4Q6SA 2EGNA 1X5RA 3O5NA 2WL7A 4NMOA 4EDJA 4JOGA 2VPHA 3NFKA 1N7EA 1X8SA 1KWAA 3QJNA 1MFGA 1NF3C 1UEWA 4R2ZA 1OZIA 2M0ZA 1VAEA 2HE2A 2EDZA 4WYTA 4K76A 4XHVA 2M0VA 2JIKA 2FNEA 3ID4A 5EYZA 3KZDA 2G2LA 1WG6A 2DLSA 3HVQC 2QKVA 1VCWA 3TSZA 4O06A 2K20A 2YTWA 3SUZA 3GDUA 4E35A 3TSWA 2KBSA 2F0AA 2EAQA 4JL7A 3RL8A 5HF1A 5JXBA 3MH6A 1RGRA 2KQFA 2I6VA 2QKTA 1UM7A 2IWPA 1VA8A 4NMTA 1WF8A 2FE5A 1X45A 1ZUBA 2LC6A 2DLUA 2CS5A 2I1NA 1TP5A 1OBXA 2MX6A 3ID2A 4OAJA 1UF1A 1WHAA 3OTPA 3KHFA 2IWNA 1UM1A 5HJ1A 2Q3GA 1WI4A 1QLCA 1T2MA 3I18A 4Z33A 2K1ZA 3SHUA 5I7ZA 1YBOA 1X9ZA 2I04A 2REYA 3KDKA 3QGLA 4NMPA 3R68A 2YT8A 4Q6HA 3DJAA 2KJKA 1QAVB 2I0LA 1Q3OA 1WFGA 2R3YA 2UZCA 5ILBA 3GCNA 3GSLA 1RY4A 2PA1A 2VSVA 3WKMA 3SFJA 2OSGA 3SOEA 3CH8A 5HFDA 2EGKA 2EJYA 4JOJA 2ZPLA 2L4TA 3MH7A 4Z8JA 2W7RA 3SHWA 2LOBA 1W9QA 1I16A 1UJDA 2KOJA 1Y8TA 4NXQA 3GDVA 2OMJA 3NCVA 3CS0A 2CSSA 1N6EA 5HFEA 1Z86A 3RL7A 3RLEA 2DAZA 4NXPA 3CYYA 4NNLA 2D92A 3KZEA 4HOPB 2JREA 3FY5A 2KV8A 2VSPA 4OEOA 2DC2A 5A2PA 1KEFA 2KOMA 3PDZA 5HEYA 1R6JA 1V62A 1D5GA 4JOKA 2W4FA 3PDVA 2AWXA 3ID1A 4NMVA 3I4WA 3E17A 4N6XA 3VQGA 5HEDA 1WF7A 1BFEA 3QE1A 1X5QA 1U39A 3R0HA 4NNMA 1OBYA 2KL1A 2JXOA 1X6DA 2Q9VA 1VJ6A 5G1EA 1V6BA 3DJ3A 2EEHA 2GZVA 1UJVA 3O46A 4H11A 3GCOA 1N7FA 5E11A 2V90A 2FN5A 1RZXA 2DKRA 2KOHA 5FHTA 2JWEA 5HFFA 1XZ9A 1ZOKA 1M5ZA 3K50A 2LA8A 4NMQA 4JOPA 1UFXA 2PKTA 1PDRA 2OS6A 2G5MB 4K78A 1U37A 1QAVA 4YYXA 4PQWA 1FC6A 2GEFA 2M0UA 2EGOA 2OCSA 2YUBA 2CSJA 5E21A 4GVDA 1UEPA 1UHPA 4WYUA 4G69A 1K32A 2PKUA 3QIKA 2YUYA 3CC0A 5HETA 1G9OA 3GGEA 4JORA 3ID3A 1FC7A 5B42A 4UU5A 1I92A 2JOAA 4Q2OA 1FC9A 4RI0A 3EGGC 5E22A 1WIFA 1SOTA 2RCZA 1VB7A 3LNYA 1WH1A 1FCFA 2O2TA 2HE4A 2KAWA 2IWQA 2H3MA 4E34A 1P1DA 3I1EA 2AWUA 2EHRA 1Y7NA 4NXRA 4P0CA 3GABA 3TSVA 2KPLA 4GVCA 3WKLA 3DORA 2QG1A 3NFLA 3B76A 4JJ3A 2X7ZA 1W9OA 2KJDA 5HEBA 1N6FA 2OQSA 5F3XA 5FB8C 4KFVA 3HPMA 4Q2PA 2VWRA 5GLJA 3CBYA 2EDVA 4F8KA 5F67A 5HFCA 5EZ0A 3DIWA 2JSNA 1NTEA 4MPAA 3BPUA 2OPGA 3OU0A 2DJTA 2M10A 2DMZA 1QAUA 2PDZA 1TE0A 3VQFA 2KA9A 3PV4A 1Q3PA 2QT5A 1WFVA 2E7KA 4E3BA 1TQ3A 2I4SA 2OZFA 5HF4A 3L4FD 1U3BA 3EGHC 4Q3HA 1WJLA 1MFLA 3R69A 3K82A 3JXTA 4JOEA 4FLNA 1UJUA 2EXGA 3GDSA 2R4HA 1KY9A 2QBWA 2QKUA 3CBZA 3KDGA 4Q2NA 4REYA 1Q7XA 2F5YA 3LNXA 2H2BA 4L8NA 1W9EA 1BE9A 1UEQA 2DB5A 2L4SA 2JINA 2VRFA 1B8QA 2LUIA 3PV2A 5GNDA 2YT7A 4JOHA 3MH4A 2MHOA 1N7TA 5HFBA 2KRGA 2EEJA 1Z87A 1WI2A 1OBZA 2EEIA 2KYLA 1WHDA 1GQ4A 4UU6A 1UEZA 2V1WA 2ENOA 1V1TA 3TMHA 4IC6A 2KG2A 2RRMA 1LCYA
chains in the Genus database with same CATH topology
4Q2QA 1GQ5A 1SOZA 4P2AB 5IL9A 3K1RA 2I0IA 2AINA 5D13A 1P1EA 4OEPA 2KJPA 3CBXA 1N99A 3QDOA 1X5NA 2JILA 4HOPA 3ZRTA 1N6DA 2H3LA 5DTHA 2EDPA 2P3WA 1IU0A 2H2CA 1L6OA 3AXAA 4K75A 3PV5A 4JOFA 3GJ9A 2VZ5A 2EV8A 2PZDA 3HPKA 5E6PB 1V5QA 5B6LA 2AWWA 2EEGA 2KPKA 2DM8A 4NMSA 4JJ0A 1U38A 4LMMA 1RGWA 4K72A 1TP3A 2M0TA 2M3MA 5HDYA 2PNTA 2HGAA 5E1YA 4FGMA 2Z9IA 4YDPA 1V5LA 4GHNA 1IU2A 3DJ1A 2L97A 1IHJA 1GM1A 2BYGA 4K6YA 2Z17A 2LC7A 5G1DA 4KFWA 3PS4A 2IWOA 1UITA 2D8IA 2OGPA 3QJMA 5H3JA 3QO6A 2D90A 3NGHA 1MC7A 2FCFA 2ZPMA 4NMRA 3STJA 4AMHA 4Q6SA 2EGNA 1X5RA 3O5NA 2WL7A 4NMOA 4EDJA 4JOGA 2VPHA 3NFKA 1N7EA 1X8SA 1KWAA 3QJNA 1MFGA 1NF3C 1UEWA 4R2ZA 1OZIA 2M0ZA 1VAEA 2HE2A 2EDZA 4WYTA 4K76A 4XHVA 2M0VA 2JIKA 2FNEA 3ID4A 5EYZA 3KZDA 2G2LA 1WG6A 2DLSA 3HVQC 2QKVA 1VCWA 3TSZA 4O06A 2K20A 2YTWA 3SUZA 3GDUA 4E35A 3TSWA 2KBSA 2F0AA 2EAQA 4JL7A 3RL8A 5HF1A 5JXBA 3MH6A 1RGRA 2KQFA 2I6VA 2QKTA 1UM7A 2IWPA 1VA8A 4NMTA 1WF8A 2FE5A 1X45A 1ZUBA 2LC6A 2DLUA 2CS5A 2I1NA 1TP5A 1OBXA 2MX6A 3ID2A 4OAJA 1UF1A 1WHAA 3OTPA 3KHFA 2IWNA 1UM1A 5HJ1A 2Q3GA 1WI4A 1QLCA 1T2MA 3I18A 4Z33A 2K1ZA 3SHUA 5I7ZA 1YBOA 1X9ZA 2I04A 2REYA 3KDKA 3QGLA 4NMPA 3R68A 2YT8A 4Q6HA 3DJAA 2KJKA 1QAVB 2I0LA 1Q3OA 1WFGA 2R3YA 2UZCA 5ILBA 3GCNA 3GSLA 1RY4A 2PA1A 2VSVA 3WKMA 3SFJA 2OSGA 3SOEA 3CH8A 5HFDA 2EGKA 2EJYA 4JOJA 2ZPLA 2L4TA 3MH7A 4Z8JA 2W7RA 3SHWA 2LOBA 1W9QA 1I16A 1UJDA 2KOJA 1Y8TA 4NXQA 3GDVA 2OMJA 3NCVA 3CS0A 2CSSA 1N6EA 5HFEA 1Z86A 3RL7A 3RLEA 2DAZA 4NXPA 3CYYA 4NNLA 2D92A 3KZEA 4HOPB 2JREA 3FY5A 2KV8A 2VSPA 4OEOA 2DC2A 5A2PA 1KEFA 2KOMA 3PDZA 5HEYA 1R6JA 1V62A 1D5GA 4JOKA 2W4FA 3PDVA 2AWXA 3ID1A 4NMVA 3I4WA 3E17A 4N6XA 3VQGA 5HEDA 1WF7A 1BFEA 3QE1A 1X5QA 1U39A 3R0HA 4NNMA 1OBYA 2KL1A 2JXOA 1X6DA 2Q9VA 1VJ6A 5G1EA 1V6BA 3DJ3A 2EEHA 2GZVA 1UJVA 3O46A 4H11A 3GCOA 1N7FA 5E11A 2V90A 2FN5A 1RZXA 2DKRA 2KOHA 5FHTA 2JWEA 5HFFA 1XZ9A 1ZOKA 1M5ZA 3K50A 2LA8A 4NMQA 4JOPA 1UFXA 2PKTA 1PDRA 2OS6A 2G5MB 4K78A 1U37A 1QAVA 4YYXA 4PQWA 1FC6A 2GEFA 2M0UA 2EGOA 2OCSA 2YUBA 2CSJA 5E21A 4GVDA 1UEPA 1UHPA 4WYUA 4G69A 1K32A 2PKUA 3QIKA 2YUYA 3CC0A 5HETA 1G9OA 3GGEA 4JORA 3ID3A 1FC7A 5B42A 4UU5A 1I92A 2JOAA 4Q2OA 1FC9A 4RI0A 3EGGC 5E22A 1WIFA 1SOTA 2RCZA 1VB7A 3LNYA 1WH1A 1FCFA 2O2TA 2HE4A 2KAWA 2IWQA 2H3MA 4E34A 1P1DA 3I1EA 2AWUA 2EHRA 1Y7NA 4NXRA 4P0CA 3GABA 3TSVA 2KPLA 4GVCA 3WKLA 3DORA 2QG1A 3NFLA 3B76A 4JJ3A 2X7ZA 1W9OA 2KJDA 5HEBA 1N6FA 2OQSA 5F3XA 5FB8C 4KFVA 3HPMA 4Q2PA 2VWRA 5GLJA 3CBYA 2EDVA 4F8KA 5F67A 5HFCA 5EZ0A 3DIWA 2JSNA 1NTEA 4MPAA 3BPUA 2OPGA 3OU0A 2DJTA 2M10A 2DMZA 1QAUA 2PDZA 1TE0A 3VQFA 2KA9A 3PV4A 1Q3PA 2QT5A 1WFVA 2E7KA 4E3BA 1TQ3A 2I4SA 2OZFA 5HF4A 3L4FD 1U3BA 3EGHC 4Q3HA 1WJLA 1MFLA 3R69A 3K82A 3JXTA 4JOEA 4FLNA 1UJUA 2EXGA 3GDSA 2R4HA 1KY9A 2QBWA 2QKUA 3CBZA 3KDGA 4Q2NA 4REYA 1Q7XA 2F5YA 3LNXA 2H2BA 4L8NA 1W9EA 1BE9A 1UEQA 2DB5A 2L4SA 2JINA 2VRFA 1B8QA 2LUIA 3PV2A 5GNDA 2YT7A 4JOHA 3MH4A 2MHOA 1N7TA 5HFBA 2KRGA 2EEJA 1Z87A 1WI2A 1OBZA 2EEIA 2KYLA 1WHDA 1GQ4A 4UU6A 1UEZA 2V1WA 2ENOA 1V1TA 3TMHA 4IC6A 2KG2A 2RRMA 1LCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2Q A;  1GQ5 A;  1SOZ A;  4P2A B;  3K1R A;  2I0I A;  2AIN A;  5D13 A;  1P1E A;  4OEP A;  2KJP A;  3CBX A;  1N99 A;  3QDO A;  1X5N A;  2JIL A;  4HOP A;  3ZRT A;  1N6D A;  2H3L A;  5DTH A;  2EDP A;  2P3W A;  1IU0 A;  2H2C A;  1L6O A;  3AXA A;  4K75 A;  3PV5 A;  4JOF A;  3GJ9 A;  2VZ5 A;  2EV8 A;  2PZD A;  3HPK A;  5E6P B;  1V5Q A;  5B6L A;  2AWW A;  2EEG A;  2KPK A;  2DM8 A;  4NMS A;  1U38 A;  4LMM A;  1RGW A;  4K72 A;  1TP3 A;  2M0T A;  2M3M A;  5HDY A;  2PNT A;  2HGA A;  5E1Y A;  4FGM A;  2Z9I A;  4YDP A;  1V5L A;  4GHN A;  1IU2 A;  3DJ1 A;  2L97 A;  1IHJ A;  1GM1 A;  2BYG A;  4K6Y A;  2Z17 A;  2LC7 A;  5G1D A;  4KFW A;  3PS4 A;  2IWO A;  1UIT A;  2D8I A;  2OGP A;  3QJM A;  5H3J A;  3QO6 A;  2D90 A;  3NGH A;  1MC7 A;  2FCF A;  2ZPM A;  4NMR A;  3STJ A;  4AMH A;  4Q6S A;  2EGN A;  1X5R A;  3O5N A;  2WL7 A;  4NMO A;  4EDJ A;  4JOG A;  2VPH A;  3NFK A;  1N7E A;  1X8S A;  1KWA A;  3QJN A;  1MFG A;  1NF3 C;  1UEW A;  4R2Z A;  1OZI A;  2M0Z A;  1VAE A;  2HE2 A;  2EDZ A;  4WYT A;  4K76 A;  4XHV A;  2M0V A;  2JIK A;  2FNE A;  3ID4 A;  5EYZ A;  3KZD A;  2G2L A;  1WG6 A;  2DLS A;  3HVQ C;  2QKV A;  1VCW A;  3TSZ A;  4O06 A;  2K20 A;  2YTW A;  3SUZ A;  3GDU A;  4E35 A;  3TSW A;  2KBS A;  2F0A A;  2EAQ A;  4JL7 A;  3RL8 A;  5HF1 A;  5JXB A;  3MH6 A;  1RGR A;  2KQF A;  2I6V A;  2QKT A;  1UM7 A;  2IWP A;  1VA8 A;  4NMT A;  1WF8 A;  2FE5 A;  1X45 A;  1ZUB A;  2LC6 A;  2DLU A;  2CS5 A;  2I1N A;  1TP5 A;  1OBX A;  2MX6 A;  3ID2 A;  4OAJ A;  1UF1 A;  1WHA A;  3OTP A;  3KHF A;  2IWN A;  1UM1 A;  5HJ1 A;  2Q3G A;  1WI4 A;  1QLC A;  1T2M A;  3I18 A;  4Z33 A;  2K1Z A;  3SHU A;  5I7Z A;  1YBO A;  2I04 A;  2REY A;  3QGL A;  4NMP A;  3R68 A;  2YT8 A;  4Q6H A;  3DJA A;  2KJK A;  1QAV B;  2I0L A;  1Q3O A;  1WFG A;  2R3Y A;  2UZC A;  3GCN A;  3GSL A;  1RY4 A;  2PA1 A;  2VSV A;  3WKM A;  3SFJ A;  2OSG A;  3SOE A;  3CH8 A;  5HFD A;  2EGK A;  2EJY A;  4JOJ A;  2ZPL A;  2L4T A;  3MH7 A;  4Z8J A;  2W7R A;  3SHW A;  2LOB A;  1W9Q A;  1I16 A;  1UJD A;  2KOJ A;  1Y8T A;  4NXQ A;  3GDV A;  2OMJ A;  3CS0 A;  2CSS A;  1N6E A;  5HFE A;  1Z86 A;  3RL7 A;  3RLE A;  2DAZ A;  4NXP A;  3CYY A;  4NNL A;  2D92 A;  3KZE A;  4HOP B;  2JRE A;  3FY5 A;  2KV8 A;  2VSP A;  4OEO A;  2DC2 A;  5A2P A;  1KEF A;  2KOM A;  3PDZ A;  5HEY A;  1R6J A;  1V62 A;  1D5G A;  4JOK A;  2W4F A;  3PDV A;  2AWX A;  3ID1 A;  4NMV A;  3I4W A;  3E17 A;  4N6X A;  3VQG A;  5HED A;  1WF7 A;  1BFE A;  3QE1 A;  1X5Q A;  1U39 A;  3R0H A;  4NNM A;  1OBY A;  2KL1 A;  2JXO A;  1X6D A;  2Q9V A;  1VJ6 A;  5G1E A;  1V6B A;  3DJ3 A;  2EEH A;  2GZV A;  1UJV A;  3O46 A;  4H11 A;  3GCO A;  1N7F A;  5E11 A;  2V90 A;  2FN5 A;  1RZX A;  2DKR A;  2KOH A;  5FHT A;  2JWE A;  5HFF A;  1XZ9 A;  1ZOK A;  1M5Z A;  3K50 A;  2LA8 A;  4NMQ A;  4JOP A;  1UFX A;  2PKT A;  1PDR A;  2OS6 A;  2G5M B;  4K78 A;  1U37 A;  1QAV A;  4YYX A;  4PQW A;  1FC6 A;  2M0U A;  2EGO A;  2OCS A;  2YUB A;  2CSJ A;  5E21 A;  4GVD A;  1UEP A;  1UHP A;  4WYU A;  4G69 A;  1K32 A;  2PKU A;  3QIK A;  2YUY A;  3CC0 A;  5HET A;  1G9O A;  3GGE A;  4JOR A;  3ID3 A;  1FC7 A;  4UU5 A;  1I92 A;  2JOA A;  4Q2O A;  1FC9 A;  4RI0 A;  3EGG C;  5E22 A;  1WIF A;  1SOT A;  2RCZ A;  1VB7 A;  3LNY A;  1WH1 A;  1FCF A;  2O2T A;  2HE4 A;  2KAW A;  2IWQ A;  2H3M A;  4E34 A;  1P1D A;  3I1E A;  2AWU A;  2EHR A;  1Y7N A;  4NXR A;  4P0C A;  3TSV A;  2KPL A;  4GVC A;  3WKL A;  3DOR A;  2QG1 A;  3NFL A;  3B76 A;  2X7Z A;  1W9O A;  2KJD A;  5HEB A;  1N6F A;  2OQS A;  5F3X A;  5FB8 C;  4KFV A;  3HPM A;  4Q2P A;  2VWR A;  5GLJ A;  3CBY A;  2EDV A;  4F8K A;  5F67 A;  5HFC A;  5EZ0 A;  3DIW A;  1NTE A;  4MPA A;  3BPU A;  2OPG A;  3OU0 A;  2DJT A;  2M10 A;  2DMZ A;  1QAU A;  2PDZ A;  1TE0 A;  3VQF A;  2KA9 A;  3PV4 A;  1Q3P A;  2QT5 A;  1WFV A;  2E7K A;  4E3B A;  1TQ3 A;  2I4S A;  2OZF A;  5HF4 A;  3L4F D;  1U3B A;  3EGH C;  4Q3H A;  1WJL A;  1MFL A;  3R69 A;  3K82 A;  3JXT A;  4JOE A;  1UJU A;  2EXG A;  3GDS A;  2R4H A;  1KY9 A;  2QBW A;  2QKU A;  3CBZ A;  4Q2N A;  4REY A;  1Q7X A;  2F5Y A;  3LNX A;  2H2B A;  4L8N A;  1W9E A;  1BE9 A;  1UEQ A;  2DB5 A;  2L4S A;  2JIN A;  2VRF A;  1B8Q A;  2LUI A;  3PV2 A;  5GND A;  2YT7 A;  4JOH A;  3MH4 A;  2MHO A;  1N7T A;  5HFB A;  2KRG A;  2EEJ A;  1Z87 A;  1WI2 A;  1OBZ A;  2EEI A;  2KYL A;  1WHD A;  1GQ4 A;  4UU6 A;  1UEZ A;  2V1W A;  2ENO A;  1V1T A;  3TMH A;  4IC6 A;  2KG2 A;  2RRM A;  1LCY A; 
#chains in the Genus database with same CATH topology
 4Q2Q A;  1GQ5 A;  1SOZ A;  4P2A B;  5IL9 A;  3K1R A;  2I0I A;  2AIN A;  5D13 A;  1P1E A;  4OEP A;  2KJP A;  3CBX A;  1N99 A;  3QDO A;  1X5N A;  2JIL A;  4HOP A;  3ZRT A;  1N6D A;  2H3L A;  5DTH A;  2EDP A;  2P3W A;  1IU0 A;  2H2C A;  1L6O A;  3AXA A;  4K75 A;  3PV5 A;  4JOF A;  3GJ9 A;  2VZ5 A;  2EV8 A;  2PZD A;  3HPK A;  5E6P B;  1V5Q A;  5B6L A;  2AWW A;  2EEG A;  2KPK A;  2DM8 A;  4NMS A;  4JJ0 A;  1U38 A;  4LMM A;  1RGW A;  4K72 A;  1TP3 A;  2M0T A;  2M3M A;  5HDY A;  2PNT A;  2HGA A;  5E1Y A;  4FGM A;  2Z9I A;  4YDP A;  1V5L A;  4GHN A;  1IU2 A;  3DJ1 A;  2L97 A;  1IHJ A;  1GM1 A;  2BYG A;  4K6Y A;  2Z17 A;  2LC7 A;  5G1D A;  4KFW A;  3PS4 A;  2IWO A;  1UIT A;  2D8I A;  2OGP A;  3QJM A;  5H3J A;  3QO6 A;  2D90 A;  3NGH A;  1MC7 A;  2FCF A;  2ZPM A;  4NMR A;  3STJ A;  4AMH A;  4Q6S A;  2EGN A;  1X5R A;  3O5N A;  2WL7 A;  4NMO A;  4EDJ A;  4JOG A;  2VPH A;  3NFK A;  1N7E A;  1X8S A;  1KWA A;  3QJN A;  1MFG A;  1NF3 C;  1UEW A;  4R2Z A;  1OZI A;  2M0Z A;  1VAE A;  2HE2 A;  2EDZ A;  4WYT A;  4K76 A;  4XHV A;  2M0V A;  2JIK A;  2FNE A;  3ID4 A;  5EYZ A;  3KZD A;  2G2L A;  1WG6 A;  2DLS A;  3HVQ C;  2QKV A;  1VCW A;  3TSZ A;  4O06 A;  2K20 A;  2YTW A;  3SUZ A;  3GDU A;  4E35 A;  3TSW A;  2KBS A;  2F0A A;  2EAQ A;  4JL7 A;  3RL8 A;  5HF1 A;  5JXB A;  3MH6 A;  1RGR A;  2KQF A;  2I6V A;  2QKT A;  1UM7 A;  2IWP A;  1VA8 A;  4NMT A;  1WF8 A;  2FE5 A;  1X45 A;  1ZUB A;  2LC6 A;  2DLU A;  2CS5 A;  2I1N A;  1TP5 A;  1OBX A;  2MX6 A;  3ID2 A;  4OAJ A;  1UF1 A;  1WHA A;  3OTP A;  3KHF A;  2IWN A;  1UM1 A;  5HJ1 A;  2Q3G A;  1WI4 A;  1QLC A;  1T2M A;  3I18 A;  4Z33 A;  2K1Z A;  3SHU A;  5I7Z A;  1YBO A;  1X9Z A;  2I04 A;  2REY A;  3KDK A;  3QGL A;  4NMP A;  3R68 A;  2YT8 A;  4Q6H A;  3DJA A;  2KJK A;  1QAV B;  2I0L A;  1Q3O A;  1WFG A;  2R3Y A;  2UZC A;  5ILB A;  3GCN A;  3GSL A;  1RY4 A;  2PA1 A;  2VSV A;  3WKM A;  3SFJ A;  2OSG A;  3SOE A;  3CH8 A;  5HFD A;  2EGK A;  2EJY A;  4JOJ A;  2ZPL A;  2L4T A;  3MH7 A;  4Z8J A;  2W7R A;  3SHW A;  2LOB A;  1W9Q A;  1I16 A;  1UJD A;  2KOJ A;  1Y8T A;  4NXQ A;  3GDV A;  2OMJ A;  3NCV A;  3CS0 A;  2CSS A;  1N6E A;  5HFE A;  1Z86 A;  3RL7 A;  3RLE A;  2DAZ A;  4NXP A;  3CYY A;  4NNL A;  2D92 A;  3KZE A;  4HOP B;  2JRE A;  3FY5 A;  2KV8 A;  2VSP A;  4OEO A;  2DC2 A;  5A2P A;  1KEF A;  2KOM A;  3PDZ A;  5HEY A;  1R6J A;  1V62 A;  1D5G A;  4JOK A;  2W4F A;  3PDV A;  2AWX A;  3ID1 A;  4NMV A;  3I4W A;  3E17 A;  4N6X A;  3VQG A;  5HED A;  1WF7 A;  1BFE A;  3QE1 A;  1X5Q A;  1U39 A;  3R0H A;  4NNM A;  1OBY A;  2KL1 A;  2JXO A;  1X6D A;  2Q9V A;  1VJ6 A;  5G1E A;  1V6B A;  3DJ3 A;  2EEH A;  2GZV A;  1UJV A;  3O46 A;  4H11 A;  3GCO A;  1N7F A;  5E11 A;  2V90 A;  2FN5 A;  1RZX A;  2DKR A;  2KOH A;  5FHT A;  2JWE A;  5HFF A;  1XZ9 A;  1ZOK A;  1M5Z A;  3K50 A;  2LA8 A;  4NMQ A;  4JOP A;  1UFX A;  2PKT A;  1PDR A;  2OS6 A;  2G5M B;  4K78 A;  1U37 A;  1QAV A;  4YYX A;  4PQW A;  1FC6 A;  2GEF A;  2M0U A;  2EGO A;  2OCS A;  2YUB A;  2CSJ A;  5E21 A;  4GVD A;  1UEP A;  1UHP A;  4WYU A;  4G69 A;  1K32 A;  2PKU A;  3QIK A;  2YUY A;  3CC0 A;  5HET A;  1G9O A;  3GGE A;  4JOR A;  3ID3 A;  1FC7 A;  5B42 A;  4UU5 A;  1I92 A;  2JOA A;  4Q2O A;  1FC9 A;  4RI0 A;  3EGG C;  5E22 A;  1WIF A;  1SOT A;  2RCZ A;  1VB7 A;  3LNY A;  1WH1 A;  1FCF A;  2O2T A;  2HE4 A;  2KAW A;  2IWQ A;  2H3M A;  4E34 A;  1P1D A;  3I1E A;  2AWU A;  2EHR A;  1Y7N A;  4NXR A;  4P0C A;  3GAB A;  3TSV A;  2KPL A;  4GVC A;  3WKL A;  3DOR A;  2QG1 A;  3NFL A;  3B76 A;  4JJ3 A;  2X7Z A;  1W9O A;  2KJD A;  5HEB A;  1N6F A;  2OQS A;  5F3X A;  5FB8 C;  4KFV A;  3HPM A;  4Q2P A;  2VWR A;  5GLJ A;  3CBY A;  2EDV A;  4F8K A;  5F67 A;  5HFC A;  5EZ0 A;  3DIW A;  2JSN A;  1NTE A;  4MPA A;  3BPU A;  2OPG A;  3OU0 A;  2DJT A;  2M10 A;  2DMZ A;  1QAU A;  2PDZ A;  1TE0 A;  3VQF A;  2KA9 A;  3PV4 A;  1Q3P A;  2QT5 A;  1WFV A;  2E7K A;  4E3B A;  1TQ3 A;  2I4S A;  2OZF A;  5HF4 A;  3L4F D;  1U3B A;  3EGH C;  4Q3H A;  1WJL A;  1MFL A;  3R69 A;  3K82 A;  3JXT A;  4JOE A;  4FLN A;  1UJU A;  2EXG A;  3GDS A;  2R4H A;  1KY9 A;  2QBW A;  2QKU A;  3CBZ A;  3KDG A;  4Q2N A;  4REY A;  1Q7X A;  2F5Y A;  3LNX A;  2H2B A;  4L8N A;  1W9E A;  1BE9 A;  1UEQ A;  2DB5 A;  2L4S A;  2JIN A;  2VRF A;  1B8Q A;  2LUI A;  3PV2 A;  5GND A;  2YT7 A;  4JOH A;  3MH4 A;  2MHO A;  1N7T A;  5HFB A;  2KRG A;  2EEJ A;  1Z87 A;  1WI2 A;  1OBZ A;  2EEI A;  2KYL A;  1WHD A;  1GQ4 A;  4UU6 A;  1UEZ A;  2V1W A;  2ENO A;  1V1T A;  3TMH A;  4IC6 A;  2KG2 A;  2RRM A;  1LCY A; 
#chains in the Genus database with same CATH homology
 4Q2Q A;  1GQ5 A;  1SOZ A;  4P2A B;  5IL9 A;  3K1R A;  2I0I A;  2AIN A;  5D13 A;  1P1E A;  4OEP A;  2KJP A;  3CBX A;  1N99 A;  3QDO A;  1X5N A;  2JIL A;  4HOP A;  3ZRT A;  1N6D A;  2H3L A;  5DTH A;  2EDP A;  2P3W A;  1IU0 A;  2H2C A;  1L6O A;  3AXA A;  4K75 A;  3PV5 A;  4JOF A;  3GJ9 A;  2VZ5 A;  2EV8 A;  2PZD A;  3HPK A;  5E6P B;  1V5Q A;  5B6L A;  2AWW A;  2EEG A;  2KPK A;  2DM8 A;  4NMS A;  4JJ0 A;  1U38 A;  4LMM A;  1RGW A;  4K72 A;  1TP3 A;  2M0T A;  2M3M A;  5HDY A;  2PNT A;  2HGA A;  5E1Y A;  4FGM A;  2Z9I A;  4YDP A;  1V5L A;  4GHN A;  1IU2 A;  3DJ1 A;  2L97 A;  1IHJ A;  1GM1 A;  2BYG A;  4K6Y A;  2Z17 A;  2LC7 A;  5G1D A;  4KFW A;  3PS4 A;  2IWO A;  1UIT A;  2D8I A;  2OGP A;  3QJM A;  5H3J A;  3QO6 A;  2D90 A;  3NGH A;  1MC7 A;  2FCF A;  2ZPM A;  4NMR A;  3STJ A;  4AMH A;  4Q6S A;  2EGN A;  1X5R A;  3O5N A;  2WL7 A;  4NMO A;  4EDJ A;  4JOG A;  2VPH A;  3NFK A;  1N7E A;  1X8S A;  1KWA A;  3QJN A;  1MFG A;  1NF3 C;  1UEW A;  4R2Z A;  1OZI A;  2M0Z A;  1VAE A;  2HE2 A;  2EDZ A;  4WYT A;  4K76 A;  4XHV A;  2M0V A;  2JIK A;  2FNE A;  3ID4 A;  5EYZ A;  3KZD A;  2G2L A;  1WG6 A;  2DLS A;  3HVQ C;  2QKV A;  1VCW A;  3TSZ A;  4O06 A;  2K20 A;  2YTW A;  3SUZ A;  3GDU A;  4E35 A;  3TSW A;  2KBS A;  2F0A A;  2EAQ A;  4JL7 A;  3RL8 A;  5HF1 A;  5JXB A;  3MH6 A;  1RGR A;  2KQF A;  2I6V A;  2QKT A;  1UM7 A;  2IWP A;  1VA8 A;  4NMT A;  1WF8 A;  2FE5 A;  1X45 A;  1ZUB A;  2LC6 A;  2DLU A;  2CS5 A;  2I1N A;  1TP5 A;  1OBX A;  2MX6 A;  3ID2 A;  4OAJ A;  1UF1 A;  1WHA A;  3OTP A;  3KHF A;  2IWN A;  1UM1 A;  5HJ1 A;  2Q3G A;  1WI4 A;  1QLC A;  1T2M A;  3I18 A;  4Z33 A;  2K1Z A;  3SHU A;  5I7Z A;  1YBO A;  1X9Z A;  2I04 A;  2REY A;  3KDK A;  3QGL A;  4NMP A;  3R68 A;  2YT8 A;  4Q6H A;  3DJA A;  2KJK A;  1QAV B;  2I0L A;  1Q3O A;  1WFG A;  2R3Y A;  2UZC A;  5ILB A;  3GCN A;  3GSL A;  1RY4 A;  2PA1 A;  2VSV A;  3WKM A;  3SFJ A;  2OSG A;  3SOE A;  3CH8 A;  5HFD A;  2EGK A;  2EJY A;  4JOJ A;  2ZPL A;  2L4T A;  3MH7 A;  4Z8J A;  2W7R A;  3SHW A;  2LOB A;  1W9Q A;  1I16 A;  1UJD A;  2KOJ A;  1Y8T A;  4NXQ A;  3GDV A;  2OMJ A;  3NCV A;  3CS0 A;  2CSS A;  1N6E A;  5HFE A;  1Z86 A;  3RL7 A;  3RLE A;  2DAZ A;  4NXP A;  3CYY A;  4NNL A;  2D92 A;  3KZE A;  4HOP B;  2JRE A;  3FY5 A;  2KV8 A;  2VSP A;  4OEO A;  2DC2 A;  5A2P A;  1KEF A;  2KOM A;  3PDZ A;  5HEY A;  1R6J A;  1V62 A;  1D5G A;  4JOK A;  2W4F A;  3PDV A;  2AWX A;  3ID1 A;  4NMV A;  3I4W A;  3E17 A;  4N6X A;  3VQG A;  5HED A;  1WF7 A;  1BFE A;  3QE1 A;  1X5Q A;  1U39 A;  3R0H A;  4NNM A;  1OBY A;  2KL1 A;  2JXO A;  1X6D A;  2Q9V A;  1VJ6 A;  5G1E A;  1V6B A;  3DJ3 A;  2EEH A;  2GZV A;  1UJV A;  3O46 A;  4H11 A;  3GCO A;  1N7F A;  5E11 A;  2V90 A;  2FN5 A;  1RZX A;  2DKR A;  2KOH A;  5FHT A;  2JWE A;  5HFF A;  1XZ9 A;  1ZOK A;  1M5Z A;  3K50 A;  2LA8 A;  4NMQ A;  4JOP A;  1UFX A;  2PKT A;  1PDR A;  2OS6 A;  2G5M B;  4K78 A;  1U37 A;  1QAV A;  4YYX A;  4PQW A;  1FC6 A;  2GEF A;  2M0U A;  2EGO A;  2OCS A;  2YUB A;  2CSJ A;  5E21 A;  4GVD A;  1UEP A;  1UHP A;  4WYU A;  4G69 A;  1K32 A;  2PKU A;  3QIK A;  2YUY A;  3CC0 A;  5HET A;  1G9O A;  3GGE A;  4JOR A;  3ID3 A;  1FC7 A;  5B42 A;  4UU5 A;  1I92 A;  2JOA A;  4Q2O A;  1FC9 A;  4RI0 A;  3EGG C;  5E22 A;  1WIF A;  1SOT A;  2RCZ A;  1VB7 A;  3LNY A;  1WH1 A;  1FCF A;  2O2T A;  2HE4 A;  2KAW A;  2IWQ A;  2H3M A;  4E34 A;  1P1D A;  3I1E A;  2AWU A;  2EHR A;  1Y7N A;  4NXR A;  4P0C A;  3GAB A;  3TSV A;  2KPL A;  4GVC A;  3WKL A;  3DOR A;  2QG1 A;  3NFL A;  3B76 A;  4JJ3 A;  2X7Z A;  1W9O A;  2KJD A;  5HEB A;  1N6F A;  2OQS A;  5F3X A;  5FB8 C;  4KFV A;  3HPM A;  4Q2P A;  2VWR A;  5GLJ A;  3CBY A;  2EDV A;  4F8K A;  5F67 A;  5HFC A;  5EZ0 A;  3DIW A;  2JSN A;  1NTE A;  4MPA A;  3BPU A;  2OPG A;  3OU0 A;  2DJT A;  2M10 A;  2DMZ A;  1QAU A;  2PDZ A;  1TE0 A;  3VQF A;  2KA9 A;  3PV4 A;  1Q3P A;  2QT5 A;  1WFV A;  2E7K A;  4E3B A;  1TQ3 A;  2I4S A;  2OZF A;  5HF4 A;  3L4F D;  1U3B A;  3EGH C;  4Q3H A;  1WJL A;  1MFL A;  3R69 A;  3K82 A;  3JXT A;  4JOE A;  4FLN A;  1UJU A;  2EXG A;  3GDS A;  2R4H A;  1KY9 A;  2QBW A;  2QKU A;  3CBZ A;  3KDG A;  4Q2N A;  4REY A;  1Q7X A;  2F5Y A;  3LNX A;  2H2B A;  4L8N A;  1W9E A;  1BE9 A;  1UEQ A;  2DB5 A;  2L4S A;  2JIN A;  2VRF A;  1B8Q A;  2LUI A;  3PV2 A;  5GND A;  2YT7 A;  4JOH A;  3MH4 A;  2MHO A;  1N7T A;  5HFB A;  2KRG A;  2EEJ A;  1Z87 A;  1WI2 A;  1OBZ A;  2EEI A;  2KYL A;  1WHD A;  1GQ4 A;  4UU6 A;  1UEZ A;  2V1W A;  2ENO A;  1V1T A;  3TMH A;  4IC6 A;  2KG2 A;  2RRM A;  1LCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...