2OQSA

Structure of the hdlg/sap97 pdz2 in complex with hpv-18 papillomavirus e6 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
92
structure length
92
Chain Sequence
MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTGSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disks large homolog 1
publication title Solution structure of the hDlg/SAP97 PDZ2 domain and its mechanism of interaction with HPV-18 papillomavirus E6 protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 10
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2007-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2oqsA00
1Y8TA 2JXOA 2KV8A 4UU5A 4JL7A 4MPAA 4O06A 1FC9A 2AWWA 1N7TA 1N6EA 2QKUA 1FC7A 2H3MA 3PV5A 1X5RA 3CBXA 3PDVA 2I1NA 3DJ3A 3R68A 2AWXA 2JOAA 1M5ZA 2V90A 4OEOA 4NXPA 2IWQA 1B8QA 2OPGA 5FHTA 4YYXA 3DORA 5B6LA 1Q7XA 1VA8A 2QBWA 1K32A 2F5YA 1KWAA 1P1DA 1U37A 4JOHA 4AMHA 5FB8C 4JOJA 4N6XA 4NMRA 2LOBA 5GNDA 1WI2A 3NFLA 3K50A 3QGLA 1QAVB 3DJ1A 3ID2A 2JREA 4GVDA 4KFVA 5HFDA 2DLUA 2YTWA 1XZ9A 3KHFA 5HF4A 1UFXA 2EDVA 1TP3A 5EYZA 2HE4A 1UJDA 4PQWA 3KZEA 4Q2NA 2QKTA 4GHNA 2OZFA 3OTPA 1UEQA 5HFBA 5EZ0A 1N7EA 3SUZA 3PS4A 4P0CA 2DB5A 3L4FD 2WL7A 2D92A 4K72A 5F67A 4HOPB 2VZ5A 1UF1A 4HOPA 1Q3PA 4K76A 4NNMA 2KG2A 2HGAA 1YBOA 2Z9IA 1NTEA 2Q3GA 2KOMA 5HFCA 3PDZA 5HF1A 4NMTA 2L4SA 3TSWA 2MX6A 2CS5A 3WKLA 2RRMA 2FE5A 2UZCA 1W9EA 2QT5A 1WFGA 2KBSA 5G1DA 5JXBA 1KEFA 2YT8A 2EEHA 4REYA 4FGMA 4NXQA 3CYYA 2I04A 3RL7A 3QE1A 1U38A 2CSSA 2QG1A 2DC2A 1N99A 3I1EA 1V62A 2MHOA 2OS6A 2LC7A 4WYTA 3LNXA 4E34A 4H11A 1T2MA 1GQ4A 1UITA 5HEBA 3TSVA 4NNLA 4EDJA 1GM1A 3KZDA 2M0ZA 4G69A 4JOFA 2PZDA 4JOEA 1U3BA 5E6PB 1Z87A 3B76A 4F8KA 1WF7A 2I0IA 1N6DA 3GCOA 5I7ZA 2ZPLA 3HPMA 3R69A 2EHRA 1RY4A 2W4FA 1Y7NA 3QDOA 1TP5A 1OBXA 3HPKA 2VRFA 1VJ6A 5DTHA 2O2TA 1IU0A 3GDVA 3WKMA 2VSVA 2EDZA 3CH8A 3K82A 3QIKA 4IC6A 4E3BA 5E21A 1OZIA 1RZXA 4Q6SA 2KA9A 2KJKA 3STJA 3DIWA 3ID1A 2I0LA 1L6OA 1SOZA 1UJVA 1QAVA 1UM7A 4NMSA 1UHPA 1G9OA 2KRGA 1ZUBA 1FC6A 4KFWA 4OEPA 1BE9A 4JOGA 1WJLA 1ZOKA 2LUIA 2OGPA 3MH7A 5H3JA 2DKRA 4OAJA 2KPLA 2FCFA 2JILA 3VQGA 1LCYA 1WIFA 3HVQC 1IU2A 5HEYA 2D90A 4Z33A 1MFLA 2H2CA 2DMZA 2LA8A 2M0UA 5F3XA 1MC7A 1UEWA 2KJPA 2VWRA 4NXRA 3MH6A 1W9OA 5A2PA 2M10A 3CBYA 5HEDA 3SOEA 3LNYA 2KJDA 2PDZA 1TE0A 1QAUA 2K1ZA 4Q2OA 5HFFA 1UJUA 3QJMA 1V1TA 2KYLA 1BFEA 4Q3HA 1VB7A 3PV2A 3CC0A 2PNTA 1X5QA 2M0TA 2REYA 2KOJA 1WHAA 1I92A 1IHJA 5GLJA 2EDPA 3GGEA 2Q9VA 1PDRA 2ZPMA 4Q6HA 2G2LA 3NFKA 1U39A 2AINA 2I4SA 4K75A 2ENOA 1UEPA 5G1EA 2P3WA 3RLEA 2DLSA 3GCNA 1QLCA 2H2BA 2D8IA 1X45A 5HFEA 1Z86A 1KY9A 3O46A 5E1YA 1R6JA 3RL8A 2CSJA 2DM8A 2GZVA 2IWPA 2K20A 5E22A 1VCWA 2EGKA 2KOHA 1WH1A 3SHUA 3TMHA 2FN5A 4XHVA 4R2ZA 2EGOA 4NMOA 4JOPA 1WFVA 1GQ5A 2KL1A 1X8SA 3O5NA 3SHWA 1VAEA 3TSZA 2JINA 1V5LA 2VSPA 4JOKA 1OBZA 1X6DA 3PV4A 2EEGA 2PKTA 3CBZA 1N7FA 2AWUA 4Q2QA 3BPUA 4Q2PA 3R0HA 2EEJA 3VQFA 2L4TA 3GDUA 4LMMA 3FY5A 2KQFA 4P2AB 2JIKA 1P1EA 2H3LA 2X7ZA 2JWEA 2R3YA 5E11A 1WHDA 2EGNA 3AXAA 4K78A 4NMVA 5HJ1A 2F0AA 3CS0A 2R4HA 3ZRTA 2LC6A 4RI0A 2W7RA 5HETA 1Q3OA 1RGWA 2YUYA 3DJAA 2DAZA 2OCSA 4L8NA 2QKVA 2OMJA 1WF8A 2EV8A 1W9QA 3NGHA 2HE2A 3K1RA 1RGRA 2E7KA 1N6FA 3QJNA 3EGHC 2OSGA 2PA1A 3QO6A 2G5MB 3E17A 4K6YA 3ID4A 2EAQA 1SOTA 2RCZA 2BYGA 2Z17A 1I16A 2KPKA 1WG6A 2M0VA 4JORA 3EGGC 4NMQA 4Z8JA 3GSLA 4E35A 2FNEA 3OU0A 2OQSA 3I4WA 2IWOA 1V5QA 4WYUA 1TQ3A 2I6VA 2PKUA 3MH4A 3GDSA 3GJ9A 1UM1A 2V1WA 2M3MA 1FCFA 2YUBA 1V6BA 4YDPA 3ID3A 2DJTA 2L97A 2KAWA 1UEZA 3SFJA 2YT7A 1D5GA 1NF3C 4UU6A 5HDYA 3JXTA 1WI4A 5D13A 2EEIA 2EXGA 1OBYA 3I18A 1X5NA 4NMPA 1MFGA 2IWNA 2VPHA 4GVCA 2EJYA
chains in the Genus database with same CATH superfamily
1Y8TA 2JXOA 2KV8A 4UU5A 4JL7A 4MPAA 4O06A 1FC9A 2AWWA 1N7TA 1N6EA 2QKUA 1FC7A 2H3MA 3PV5A 1X5RA 3CBXA 3PDVA 2I1NA 3DJ3A 3R68A 2AWXA 2JOAA 1M5ZA 2V90A 4OEOA 4NXPA 2IWQA 1B8QA 2OPGA 5FHTA 4YYXA 3DORA 5B6LA 1Q7XA 1VA8A 2QBWA 1K32A 2F5YA 1KWAA 1P1DA 1U37A 4JOHA 4AMHA 5FB8C 4JOJA 4N6XA 4NMRA 2LOBA 5GNDA 1WI2A 3NFLA 3K50A 3QGLA 1QAVB 3DJ1A 3ID2A 2JREA 4GVDA 4KFVA 5HFDA 2DLUA 2YTWA 1XZ9A 3KHFA 5HF4A 1UFXA 2EDVA 1TP3A 5EYZA 2HE4A 1UJDA 4PQWA 3KZEA 4Q2NA 4FLNA 2QKTA 4GHNA 2OZFA 3OTPA 1UEQA 5HFBA 5EZ0A 1N7EA 3SUZA 3PS4A 4P0CA 2DB5A 3L4FD 2WL7A 2D92A 4K72A 5F67A 4HOPB 2VZ5A 1UF1A 4HOPA 1Q3PA 4K76A 4NNMA 2KG2A 2HGAA 1YBOA 2Z9IA 1NTEA 2Q3GA 2KOMA 5HFCA 3PDZA 5HF1A 4NMTA 2L4SA 3TSWA 2MX6A 2CS5A 3WKLA 2RRMA 2FE5A 2UZCA 1W9EA 2QT5A 1WFGA 2KBSA 5G1DA 5JXBA 1KEFA 2YT8A 2EEHA 4REYA 4FGMA 4JJ0A 3CYYA 4NXQA 2I04A 3RL7A 3QE1A 1U38A 2CSSA 2QG1A 2DC2A 1N99A 3I1EA 1V62A 2MHOA 2OS6A 2LC7A 4WYTA 3LNXA 4E34A 4H11A 1T2MA 1GQ4A 1UITA 5HEBA 3TSVA 4NNLA 4EDJA 1GM1A 3KZDA 2M0ZA 4G69A 4JOFA 2PZDA 5IL9A 4JOEA 1U3BA 5E6PB 1Z87A 3B76A 4F8KA 1WF7A 2I0IA 1N6DA 3GCOA 5I7ZA 2ZPLA 3HPMA 3R69A 3KDKA 2EHRA 1RY4A 2W4FA 1Y7NA 3QDOA 1TP5A 1OBXA 3HPKA 2VRFA 1VJ6A 5DTHA 2O2TA 1IU0A 3GABA 3GDVA 3WKMA 2VSVA 2EDZA 3CH8A 3K82A 3QIKA 4IC6A 4E3BA 5E21A 1OZIA 1RZXA 4Q6SA 2KA9A 2KJKA 3STJA 3DIWA 3ID1A 2I0LA 1L6OA 1SOZA 1UJVA 1QAVA 1UM7A 4NMSA 1UHPA 1G9OA 2KRGA 3KDGA 1ZUBA 1FC6A 4KFWA 4OEPA 1BE9A 4JOGA 1WJLA 1ZOKA 2LUIA 2OGPA 3MH7A 5H3JA 2DKRA 4OAJA 3NCVA 2KPLA 2FCFA 2JILA 3VQGA 1LCYA 1WIFA 3HVQC 1IU2A 5HEYA 2D90A 4Z33A 1MFLA 2H2CA 2DMZA 2LA8A 2GEFA 2M0UA 5F3XA 1MC7A 1UEWA 2KJPA 2VWRA 4NXRA 3MH6A 1W9OA 5A2PA 2M10A 3CBYA 5HEDA 3SOEA 3LNYA 2KJDA 2PDZA 1TE0A 1QAUA 2K1ZA 4Q2OA 5HFFA 1UJUA 3QJMA 1V1TA 2KYLA 1BFEA 4Q3HA 1VB7A 3PV2A 3CC0A 2PNTA 1X5QA 2M0TA 2REYA 2KOJA 1WHAA 1I92A 1IHJA 5GLJA 2EDPA 3GGEA 2Q9VA 1PDRA 2ZPMA 4Q6HA 2G2LA 3NFKA 1U39A 2AINA 2I4SA 4K75A 2ENOA 1UEPA 5G1EA 2P3WA 3RLEA 2DLSA 3GCNA 1QLCA 2H2BA 2D8IA 1X45A 5HFEA 1Z86A 1KY9A 3O46A 5E1YA 1R6JA 3RL8A 2CSJA 2DM8A 2GZVA 2IWPA 2K20A 5E22A 5ILBA 1VCWA 2EGKA 2KOHA 1WH1A 3SHUA 3TMHA 2FN5A 4XHVA 4R2ZA 2EGOA 4NMOA 4JOPA 1WFVA 1GQ5A 2KL1A 1X8SA 3O5NA 5B42A 3SHWA 1VAEA 3TSZA 2JINA 1V5LA 2VSPA 4JOKA 1OBZA 1X6DA 3PV4A 2EEGA 2PKTA 3CBZA 1N7FA 2AWUA 4Q2QA 3BPUA 4Q2PA 3R0HA 2EEJA 3VQFA 2L4TA 3GDUA 4LMMA 3FY5A 2KQFA 4P2AB 2JIKA 1P1EA 2H3LA 2X7ZA 2JWEA 2R3YA 5E11A 1WHDA 2EGNA 3AXAA 4K78A 4NMVA 5HJ1A 2F0AA 3CS0A 2R4HA 3ZRTA 2LC6A 4RI0A 2W7RA 5HETA 1Q3OA 1RGWA 2YUYA 3DJAA 2DAZA 2OCSA 4L8NA 2QKVA 2OMJA 1WF8A 2EV8A 1W9QA 3NGHA 2HE2A 3K1RA 1RGRA 2E7KA 1N6FA 3QJNA 3EGHC 2OSGA 2PA1A 3QO6A 2G5MB 3E17A 4K6YA 3ID4A 2EAQA 1SOTA 2RCZA 2BYGA 2Z17A 1I16A 2KPKA 1WG6A 2M0VA 4JORA 3EGGC 4NMQA 4Z8JA 3GSLA 4E35A 2FNEA 3OU0A 2OQSA 3I4WA 2IWOA 1V5QA 4WYUA 1TQ3A 2I6VA 2PKUA 3MH4A 3GDSA 3GJ9A 1UM1A 2V1WA 4JJ3A 2M3MA 1FCFA 2YUBA 1V6BA 4YDPA 3ID3A 2DJTA 2L97A 2KAWA 1UEZA 3SFJA 2YT7A 1D5GA 1NF3C 4UU6A 5HDYA 1X9ZA 2JSNA 3JXTA 1WI4A 5D13A 2EEIA 2EXGA 1OBYA 3I18A 1X5NA 4NMPA 1MFGA 2IWNA 2VPHA 4GVCA 2EJYA
chains in the Genus database with same CATH topology
1Y8TA 2JXOA 2KV8A 4UU5A 4JL7A 4MPAA 4O06A 1FC9A 2AWWA 1N7TA 1N6EA 2QKUA 1FC7A 2H3MA 3PV5A 1X5RA 3CBXA 3PDVA 2I1NA 3DJ3A 3R68A 2AWXA 2JOAA 1M5ZA 2V90A 4OEOA 4NXPA 2IWQA 1B8QA 2OPGA 5FHTA 4YYXA 3DORA 5B6LA 1Q7XA 1VA8A 2QBWA 1K32A 2F5YA 1KWAA 1P1DA 1U37A 4JOHA 4AMHA 5FB8C 4JOJA 4N6XA 4NMRA 2LOBA 5GNDA 1WI2A 3NFLA 3K50A 3QGLA 1QAVB 3DJ1A 3ID2A 2JREA 4GVDA 4KFVA 5HFDA 2DLUA 2YTWA 1XZ9A 3KHFA 5HF4A 1UFXA 2EDVA 1TP3A 5EYZA 2HE4A 1UJDA 4PQWA 3KZEA 4Q2NA 4FLNA 2QKTA 4GHNA 2OZFA 3OTPA 1UEQA 5HFBA 5EZ0A 1N7EA 3SUZA 3PS4A 4P0CA 2DB5A 3L4FD 2WL7A 2D92A 4K72A 5F67A 4HOPB 2VZ5A 1UF1A 4HOPA 1Q3PA 4K76A 4NNMA 2KG2A 2HGAA 1YBOA 2Z9IA 1NTEA 2Q3GA 2KOMA 5HFCA 3PDZA 5HF1A 4NMTA 2L4SA 3TSWA 2MX6A 2CS5A 3WKLA 2RRMA 2FE5A 2UZCA 1W9EA 2QT5A 1WFGA 2KBSA 5G1DA 5JXBA 1KEFA 2YT8A 2EEHA 4REYA 4FGMA 4JJ0A 3CYYA 4NXQA 2I04A 3RL7A 3QE1A 1U38A 2CSSA 2QG1A 2DC2A 1N99A 3I1EA 1V62A 2MHOA 2OS6A 2LC7A 4WYTA 3LNXA 4E34A 4H11A 1T2MA 1GQ4A 1UITA 5HEBA 3TSVA 4NNLA 4EDJA 1GM1A 3KZDA 2M0ZA 4G69A 4JOFA 2PZDA 5IL9A 4JOEA 1U3BA 5E6PB 1Z87A 3B76A 4F8KA 1WF7A 2I0IA 1N6DA 3GCOA 5I7ZA 2ZPLA 3HPMA 3R69A 3KDKA 2EHRA 1RY4A 2W4FA 1Y7NA 3QDOA 1TP5A 1OBXA 3HPKA 2VRFA 1VJ6A 5DTHA 2O2TA 1IU0A 3GABA 3GDVA 3WKMA 2VSVA 2EDZA 3CH8A 3K82A 3QIKA 4IC6A 4E3BA 5E21A 1OZIA 1RZXA 4Q6SA 2KA9A 2KJKA 3STJA 3DIWA 3ID1A 2I0LA 1L6OA 1SOZA 1UJVA 1QAVA 1UM7A 4NMSA 1UHPA 1G9OA 2KRGA 3KDGA 1ZUBA 1FC6A 4KFWA 4OEPA 1BE9A 4JOGA 1WJLA 1ZOKA 2LUIA 2OGPA 3MH7A 5H3JA 2DKRA 4OAJA 3NCVA 2KPLA 2FCFA 2JILA 3VQGA 1LCYA 1WIFA 3HVQC 1IU2A 5HEYA 2D90A 4Z33A 1MFLA 2H2CA 2DMZA 2LA8A 2GEFA 2M0UA 5F3XA 1MC7A 1UEWA 2KJPA 2VWRA 4NXRA 3MH6A 1W9OA 5A2PA 2M10A 3CBYA 5HEDA 3SOEA 3LNYA 2KJDA 2PDZA 1TE0A 1QAUA 2K1ZA 4Q2OA 5HFFA 1UJUA 3QJMA 1V1TA 2KYLA 1BFEA 4Q3HA 1VB7A 3PV2A 3CC0A 2PNTA 1X5QA 2M0TA 2REYA 2KOJA 1WHAA 1I92A 1IHJA 5GLJA 2EDPA 3GGEA 2Q9VA 1PDRA 2ZPMA 4Q6HA 2G2LA 3NFKA 1U39A 2AINA 2I4SA 4K75A 2ENOA 1UEPA 5G1EA 2P3WA 3RLEA 2DLSA 3GCNA 1QLCA 2H2BA 2D8IA 1X45A 5HFEA 1Z86A 1KY9A 3O46A 5E1YA 1R6JA 3RL8A 2CSJA 2DM8A 2GZVA 2IWPA 2K20A 5E22A 5ILBA 1VCWA 2EGKA 2KOHA 1WH1A 3SHUA 3TMHA 2FN5A 4XHVA 4R2ZA 2EGOA 4NMOA 4JOPA 1WFVA 1GQ5A 2KL1A 1X8SA 3O5NA 5B42A 3SHWA 1VAEA 3TSZA 2JINA 1V5LA 2VSPA 4JOKA 1OBZA 1X6DA 3PV4A 2EEGA 2PKTA 3CBZA 1N7FA 2AWUA 4Q2QA 3BPUA 4Q2PA 3R0HA 2EEJA 3VQFA 2L4TA 3GDUA 4LMMA 3FY5A 2KQFA 4P2AB 2JIKA 1P1EA 2H3LA 2X7ZA 2JWEA 2R3YA 5E11A 1WHDA 2EGNA 3AXAA 4K78A 4NMVA 5HJ1A 2F0AA 3CS0A 2R4HA 3ZRTA 2LC6A 4RI0A 2W7RA 5HETA 1Q3OA 1RGWA 2YUYA 3DJAA 2DAZA 2OCSA 4L8NA 2QKVA 2OMJA 1WF8A 2EV8A 1W9QA 3NGHA 2HE2A 3K1RA 1RGRA 2E7KA 1N6FA 3QJNA 3EGHC 2OSGA 2PA1A 3QO6A 2G5MB 3E17A 4K6YA 3ID4A 2EAQA 1SOTA 2RCZA 2BYGA 2Z17A 1I16A 2KPKA 1WG6A 2M0VA 4JORA 3EGGC 4NMQA 4Z8JA 3GSLA 4E35A 2FNEA 3OU0A 2OQSA 3I4WA 2IWOA 1V5QA 4WYUA 1TQ3A 2I6VA 2PKUA 3MH4A 3GDSA 3GJ9A 1UM1A 2V1WA 4JJ3A 2M3MA 1FCFA 2YUBA 1V6BA 4YDPA 3ID3A 2DJTA 2L97A 2KAWA 1UEZA 3SFJA 2YT7A 1D5GA 1NF3C 4UU6A 5HDYA 1X9ZA 2JSNA 3JXTA 1WI4A 5D13A 2EEIA 2EXGA 1OBYA 3I18A 1X5NA 4NMPA 1MFGA 2IWNA 2VPHA 4GVCA 2EJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8T A;  2JXO A;  2KV8 A;  4UU5 A;  4JL7 A;  4MPA A;  4O06 A;  1FC9 A;  2AWW A;  1N7T A;  1N6E A;  2QKU A;  1FC7 A;  2H3M A;  3PV5 A;  1X5R A;  3CBX A;  3PDV A;  2I1N A;  3DJ3 A;  3R68 A;  2AWX A;  2JOA A;  1M5Z A;  2V90 A;  4OEO A;  4NXP A;  2IWQ A;  1B8Q A;  2OPG A;  5FHT A;  4YYX A;  3DOR A;  5B6L A;  1Q7X A;  1VA8 A;  2QBW A;  1K32 A;  2F5Y A;  1KWA A;  1P1D A;  1U37 A;  4JOH A;  4AMH A;  5FB8 C;  4JOJ A;  4N6X A;  4NMR A;  2LOB A;  5GND A;  1WI2 A;  3NFL A;  3K50 A;  3QGL A;  1QAV B;  3DJ1 A;  3ID2 A;  2JRE A;  4GVD A;  4KFV A;  5HFD A;  2DLU A;  2YTW A;  1XZ9 A;  3KHF A;  5HF4 A;  1UFX A;  2EDV A;  1TP3 A;  5EYZ A;  2HE4 A;  1UJD A;  4PQW A;  3KZE A;  4Q2N A;  2QKT A;  4GHN A;  2OZF A;  3OTP A;  1UEQ A;  5HFB A;  5EZ0 A;  1N7E A;  3SUZ A;  3PS4 A;  4P0C A;  2DB5 A;  3L4F D;  2WL7 A;  2D92 A;  4K72 A;  5F67 A;  4HOP B;  2VZ5 A;  1UF1 A;  4HOP A;  1Q3P A;  4K76 A;  4NNM A;  2KG2 A;  2HGA A;  1YBO A;  2Z9I A;  1NTE A;  2Q3G A;  2KOM A;  5HFC A;  3PDZ A;  5HF1 A;  4NMT A;  2L4S A;  3TSW A;  2MX6 A;  2CS5 A;  3WKL A;  2RRM A;  2FE5 A;  2UZC A;  1W9E A;  2QT5 A;  1WFG A;  2KBS A;  5G1D A;  5JXB A;  1KEF A;  2YT8 A;  2EEH A;  4REY A;  4FGM A;  4NXQ A;  3CYY A;  2I04 A;  3RL7 A;  3QE1 A;  1U38 A;  2CSS A;  2QG1 A;  2DC2 A;  1N99 A;  3I1E A;  1V62 A;  2MHO A;  2OS6 A;  2LC7 A;  4WYT A;  3LNX A;  4E34 A;  4H11 A;  1T2M A;  1GQ4 A;  1UIT A;  5HEB A;  3TSV A;  4NNL A;  4EDJ A;  1GM1 A;  3KZD A;  2M0Z A;  4G69 A;  4JOF A;  2PZD A;  4JOE A;  1U3B A;  5E6P B;  1Z87 A;  3B76 A;  4F8K A;  1WF7 A;  2I0I A;  1N6D A;  3GCO A;  5I7Z A;  2ZPL A;  3HPM A;  3R69 A;  2EHR A;  1RY4 A;  2W4F A;  1Y7N A;  3QDO A;  1TP5 A;  1OBX A;  3HPK A;  2VRF A;  1VJ6 A;  5DTH A;  2O2T A;  1IU0 A;  3GDV A;  3WKM A;  2VSV A;  2EDZ A;  3CH8 A;  3K82 A;  3QIK A;  4IC6 A;  4E3B A;  5E21 A;  1OZI A;  1RZX A;  4Q6S A;  2KA9 A;  2KJK A;  3STJ A;  3DIW A;  3ID1 A;  2I0L A;  1L6O A;  1SOZ A;  1UJV A;  1QAV A;  1UM7 A;  4NMS A;  1UHP A;  1G9O A;  2KRG A;  1ZUB A;  1FC6 A;  4KFW A;  4OEP A;  1BE9 A;  4JOG A;  1WJL A;  1ZOK A;  2LUI A;  2OGP A;  3MH7 A;  5H3J A;  2DKR A;  4OAJ A;  2KPL A;  2FCF A;  2JIL A;  3VQG A;  1LCY A;  1WIF A;  3HVQ C;  1IU2 A;  5HEY A;  2D90 A;  4Z33 A;  1MFL A;  2H2C A;  2DMZ A;  2LA8 A;  2M0U A;  5F3X A;  1MC7 A;  1UEW A;  2KJP A;  2VWR A;  4NXR A;  3MH6 A;  1W9O A;  5A2P A;  2M10 A;  3CBY A;  5HED A;  3SOE A;  3LNY A;  2KJD A;  2PDZ A;  1TE0 A;  1QAU A;  2K1Z A;  4Q2O A;  5HFF A;  1UJU A;  3QJM A;  1V1T A;  2KYL A;  1BFE A;  4Q3H A;  1VB7 A;  3PV2 A;  3CC0 A;  2PNT A;  1X5Q A;  2M0T A;  2REY A;  2KOJ A;  1WHA A;  1I92 A;  1IHJ A;  5GLJ A;  2EDP A;  3GGE A;  2Q9V A;  1PDR A;  2ZPM A;  4Q6H A;  2G2L A;  3NFK A;  1U39 A;  2AIN A;  2I4S A;  4K75 A;  2ENO A;  1UEP A;  5G1E A;  2P3W A;  3RLE A;  2DLS A;  3GCN A;  1QLC A;  2H2B A;  2D8I A;  1X45 A;  5HFE A;  1Z86 A;  1KY9 A;  3O46 A;  5E1Y A;  1R6J A;  3RL8 A;  2CSJ A;  2DM8 A;  2GZV A;  2IWP A;  2K20 A;  5E22 A;  1VCW A;  2EGK A;  2KOH A;  1WH1 A;  3SHU A;  3TMH A;  2FN5 A;  4XHV A;  4R2Z A;  2EGO A;  4NMO A;  4JOP A;  1WFV A;  1GQ5 A;  2KL1 A;  1X8S A;  3O5N A;  3SHW A;  1VAE A;  3TSZ A;  2JIN A;  1V5L A;  2VSP A;  4JOK A;  1OBZ A;  1X6D A;  3PV4 A;  2EEG A;  2PKT A;  3CBZ A;  1N7F A;  2AWU A;  4Q2Q A;  3BPU A;  4Q2P A;  3R0H A;  2EEJ A;  3VQF A;  2L4T A;  3GDU A;  4LMM A;  3FY5 A;  2KQF A;  4P2A B;  2JIK A;  1P1E A;  2H3L A;  2X7Z A;  2JWE A;  2R3Y A;  5E11 A;  1WHD A;  2EGN A;  3AXA A;  4K78 A;  4NMV A;  5HJ1 A;  2F0A A;  3CS0 A;  2R4H A;  3ZRT A;  2LC6 A;  4RI0 A;  2W7R A;  5HET A;  1Q3O A;  1RGW A;  2YUY A;  3DJA A;  2DAZ A;  2OCS A;  4L8N A;  2QKV A;  2OMJ A;  1WF8 A;  2EV8 A;  1W9Q A;  3NGH A;  2HE2 A;  3K1R A;  1RGR A;  2E7K A;  1N6F A;  3QJN A;  3EGH C;  2OSG A;  2PA1 A;  3QO6 A;  2G5M B;  3E17 A;  4K6Y A;  3ID4 A;  2EAQ A;  1SOT A;  2RCZ A;  2BYG A;  2Z17 A;  1I16 A;  2KPK A;  1WG6 A;  2M0V A;  4JOR A;  3EGG C;  4NMQ A;  4Z8J A;  3GSL A;  4E35 A;  2FNE A;  3OU0 A;  2OQS A;  3I4W A;  2IWO A;  1V5Q A;  4WYU A;  1TQ3 A;  2I6V A;  2PKU A;  3MH4 A;  3GDS A;  3GJ9 A;  1UM1 A;  2V1W A;  2M3M A;  1FCF A;  2YUB A;  1V6B A;  4YDP A;  3ID3 A;  2DJT A;  2L97 A;  2KAW A;  1UEZ A;  3SFJ A;  2YT7 A;  1D5G A;  1NF3 C;  4UU6 A;  5HDY A;  3JXT A;  1WI4 A;  5D13 A;  2EEI A;  2EXG A;  1OBY A;  3I18 A;  1X5N A;  4NMP A;  1MFG A;  2IWN A;  2VPH A;  4GVC A;  2EJY A; 
#chains in the Genus database with same CATH topology
 1Y8T A;  2JXO A;  2KV8 A;  4UU5 A;  4JL7 A;  4MPA A;  4O06 A;  1FC9 A;  2AWW A;  1N7T A;  1N6E A;  2QKU A;  1FC7 A;  2H3M A;  3PV5 A;  1X5R A;  3CBX A;  3PDV A;  2I1N A;  3DJ3 A;  3R68 A;  2AWX A;  2JOA A;  1M5Z A;  2V90 A;  4OEO A;  4NXP A;  2IWQ A;  1B8Q A;  2OPG A;  5FHT A;  4YYX A;  3DOR A;  5B6L A;  1Q7X A;  1VA8 A;  2QBW A;  1K32 A;  2F5Y A;  1KWA A;  1P1D A;  1U37 A;  4JOH A;  4AMH A;  5FB8 C;  4JOJ A;  4N6X A;  4NMR A;  2LOB A;  5GND A;  1WI2 A;  3NFL A;  3K50 A;  3QGL A;  1QAV B;  3DJ1 A;  3ID2 A;  2JRE A;  4GVD A;  4KFV A;  5HFD A;  2DLU A;  2YTW A;  1XZ9 A;  3KHF A;  5HF4 A;  1UFX A;  2EDV A;  1TP3 A;  5EYZ A;  2HE4 A;  1UJD A;  4PQW A;  3KZE A;  4Q2N A;  4FLN A;  2QKT A;  4GHN A;  2OZF A;  3OTP A;  1UEQ A;  5HFB A;  5EZ0 A;  1N7E A;  3SUZ A;  3PS4 A;  4P0C A;  2DB5 A;  3L4F D;  2WL7 A;  2D92 A;  4K72 A;  5F67 A;  4HOP B;  2VZ5 A;  1UF1 A;  4HOP A;  1Q3P A;  4K76 A;  4NNM A;  2KG2 A;  2HGA A;  1YBO A;  2Z9I A;  1NTE A;  2Q3G A;  2KOM A;  5HFC A;  3PDZ A;  5HF1 A;  4NMT A;  2L4S A;  3TSW A;  2MX6 A;  2CS5 A;  3WKL A;  2RRM A;  2FE5 A;  2UZC A;  1W9E A;  2QT5 A;  1WFG A;  2KBS A;  5G1D A;  5JXB A;  1KEF A;  2YT8 A;  2EEH A;  4REY A;  4FGM A;  4JJ0 A;  3CYY A;  4NXQ A;  2I04 A;  3RL7 A;  3QE1 A;  1U38 A;  2CSS A;  2QG1 A;  2DC2 A;  1N99 A;  3I1E A;  1V62 A;  2MHO A;  2OS6 A;  2LC7 A;  4WYT A;  3LNX A;  4E34 A;  4H11 A;  1T2M A;  1GQ4 A;  1UIT A;  5HEB A;  3TSV A;  4NNL A;  4EDJ A;  1GM1 A;  3KZD A;  2M0Z A;  4G69 A;  4JOF A;  2PZD A;  5IL9 A;  4JOE A;  1U3B A;  5E6P B;  1Z87 A;  3B76 A;  4F8K A;  1WF7 A;  2I0I A;  1N6D A;  3GCO A;  5I7Z A;  2ZPL A;  3HPM A;  3R69 A;  3KDK A;  2EHR A;  1RY4 A;  2W4F A;  1Y7N A;  3QDO A;  1TP5 A;  1OBX A;  3HPK A;  2VRF A;  1VJ6 A;  5DTH A;  2O2T A;  1IU0 A;  3GAB A;  3GDV A;  3WKM A;  2VSV A;  2EDZ A;  3CH8 A;  3K82 A;  3QIK A;  4IC6 A;  4E3B A;  5E21 A;  1OZI A;  1RZX A;  4Q6S A;  2KA9 A;  2KJK A;  3STJ A;  3DIW A;  3ID1 A;  2I0L A;  1L6O A;  1SOZ A;  1UJV A;  1QAV A;  1UM7 A;  4NMS A;  1UHP A;  1G9O A;  2KRG A;  3KDG A;  1ZUB A;  1FC6 A;  4KFW A;  4OEP A;  1BE9 A;  4JOG A;  1WJL A;  1ZOK A;  2LUI A;  2OGP A;  3MH7 A;  5H3J A;  2DKR A;  4OAJ A;  3NCV A;  2KPL A;  2FCF A;  2JIL A;  3VQG A;  1LCY A;  1WIF A;  3HVQ C;  1IU2 A;  5HEY A;  2D90 A;  4Z33 A;  1MFL A;  2H2C A;  2DMZ A;  2LA8 A;  2GEF A;  2M0U A;  5F3X A;  1MC7 A;  1UEW A;  2KJP A;  2VWR A;  4NXR A;  3MH6 A;  1W9O A;  5A2P A;  2M10 A;  3CBY A;  5HED A;  3SOE A;  3LNY A;  2KJD A;  2PDZ A;  1TE0 A;  1QAU A;  2K1Z A;  4Q2O A;  5HFF A;  1UJU A;  3QJM A;  1V1T A;  2KYL A;  1BFE A;  4Q3H A;  1VB7 A;  3PV2 A;  3CC0 A;  2PNT A;  1X5Q A;  2M0T A;  2REY A;  2KOJ A;  1WHA A;  1I92 A;  1IHJ A;  5GLJ A;  2EDP A;  3GGE A;  2Q9V A;  1PDR A;  2ZPM A;  4Q6H A;  2G2L A;  3NFK A;  1U39 A;  2AIN A;  2I4S A;  4K75 A;  2ENO A;  1UEP A;  5G1E A;  2P3W A;  3RLE A;  2DLS A;  3GCN A;  1QLC A;  2H2B A;  2D8I A;  1X45 A;  5HFE A;  1Z86 A;  1KY9 A;  3O46 A;  5E1Y A;  1R6J A;  3RL8 A;  2CSJ A;  2DM8 A;  2GZV A;  2IWP A;  2K20 A;  5E22 A;  5ILB A;  1VCW A;  2EGK A;  2KOH A;  1WH1 A;  3SHU A;  3TMH A;  2FN5 A;  4XHV A;  4R2Z A;  2EGO A;  4NMO A;  4JOP A;  1WFV A;  1GQ5 A;  2KL1 A;  1X8S A;  3O5N A;  5B42 A;  3SHW A;  1VAE A;  3TSZ A;  2JIN A;  1V5L A;  2VSP A;  4JOK A;  1OBZ A;  1X6D A;  3PV4 A;  2EEG A;  2PKT A;  3CBZ A;  1N7F A;  2AWU A;  4Q2Q A;  3BPU A;  4Q2P A;  3R0H A;  2EEJ A;  3VQF A;  2L4T A;  3GDU A;  4LMM A;  3FY5 A;  2KQF A;  4P2A B;  2JIK A;  1P1E A;  2H3L A;  2X7Z A;  2JWE A;  2R3Y A;  5E11 A;  1WHD A;  2EGN A;  3AXA A;  4K78 A;  4NMV A;  5HJ1 A;  2F0A A;  3CS0 A;  2R4H A;  3ZRT A;  2LC6 A;  4RI0 A;  2W7R A;  5HET A;  1Q3O A;  1RGW A;  2YUY A;  3DJA A;  2DAZ A;  2OCS A;  4L8N A;  2QKV A;  2OMJ A;  1WF8 A;  2EV8 A;  1W9Q A;  3NGH A;  2HE2 A;  3K1R A;  1RGR A;  2E7K A;  1N6F A;  3QJN A;  3EGH C;  2OSG A;  2PA1 A;  3QO6 A;  2G5M B;  3E17 A;  4K6Y A;  3ID4 A;  2EAQ A;  1SOT A;  2RCZ A;  2BYG A;  2Z17 A;  1I16 A;  2KPK A;  1WG6 A;  2M0V A;  4JOR A;  3EGG C;  4NMQ A;  4Z8J A;  3GSL A;  4E35 A;  2FNE A;  3OU0 A;  2OQS A;  3I4W A;  2IWO A;  1V5Q A;  4WYU A;  1TQ3 A;  2I6V A;  2PKU A;  3MH4 A;  3GDS A;  3GJ9 A;  1UM1 A;  2V1W A;  4JJ3 A;  2M3M A;  1FCF A;  2YUB A;  1V6B A;  4YDP A;  3ID3 A;  2DJT A;  2L97 A;  2KAW A;  1UEZ A;  3SFJ A;  2YT7 A;  1D5G A;  1NF3 C;  4UU6 A;  5HDY A;  1X9Z A;  2JSN A;  3JXT A;  1WI4 A;  5D13 A;  2EEI A;  2EXG A;  1OBY A;  3I18 A;  1X5N A;  4NMP A;  1MFG A;  2IWN A;  2VPH A;  4GVC A;  2EJY A; 
#chains in the Genus database with same CATH homology
 1Y8T A;  2JXO A;  2KV8 A;  4UU5 A;  4JL7 A;  4MPA A;  4O06 A;  1FC9 A;  2AWW A;  1N7T A;  1N6E A;  2QKU A;  1FC7 A;  2H3M A;  3PV5 A;  1X5R A;  3CBX A;  3PDV A;  2I1N A;  3DJ3 A;  3R68 A;  2AWX A;  2JOA A;  1M5Z A;  2V90 A;  4OEO A;  4NXP A;  2IWQ A;  1B8Q A;  2OPG A;  5FHT A;  4YYX A;  3DOR A;  5B6L A;  1Q7X A;  1VA8 A;  2QBW A;  1K32 A;  2F5Y A;  1KWA A;  1P1D A;  1U37 A;  4JOH A;  4AMH A;  5FB8 C;  4JOJ A;  4N6X A;  4NMR A;  2LOB A;  5GND A;  1WI2 A;  3NFL A;  3K50 A;  3QGL A;  1QAV B;  3DJ1 A;  3ID2 A;  2JRE A;  4GVD A;  4KFV A;  5HFD A;  2DLU A;  2YTW A;  1XZ9 A;  3KHF A;  5HF4 A;  1UFX A;  2EDV A;  1TP3 A;  5EYZ A;  2HE4 A;  1UJD A;  4PQW A;  3KZE A;  4Q2N A;  4FLN A;  2QKT A;  4GHN A;  2OZF A;  3OTP A;  1UEQ A;  5HFB A;  5EZ0 A;  1N7E A;  3SUZ A;  3PS4 A;  4P0C A;  2DB5 A;  3L4F D;  2WL7 A;  2D92 A;  4K72 A;  5F67 A;  4HOP B;  2VZ5 A;  1UF1 A;  4HOP A;  1Q3P A;  4K76 A;  4NNM A;  2KG2 A;  2HGA A;  1YBO A;  2Z9I A;  1NTE A;  2Q3G A;  2KOM A;  5HFC A;  3PDZ A;  5HF1 A;  4NMT A;  2L4S A;  3TSW A;  2MX6 A;  2CS5 A;  3WKL A;  2RRM A;  2FE5 A;  2UZC A;  1W9E A;  2QT5 A;  1WFG A;  2KBS A;  5G1D A;  5JXB A;  1KEF A;  2YT8 A;  2EEH A;  4REY A;  4FGM A;  4JJ0 A;  3CYY A;  4NXQ A;  2I04 A;  3RL7 A;  3QE1 A;  1U38 A;  2CSS A;  2QG1 A;  2DC2 A;  1N99 A;  3I1E A;  1V62 A;  2MHO A;  2OS6 A;  2LC7 A;  4WYT A;  3LNX A;  4E34 A;  4H11 A;  1T2M A;  1GQ4 A;  1UIT A;  5HEB A;  3TSV A;  4NNL A;  4EDJ A;  1GM1 A;  3KZD A;  2M0Z A;  4G69 A;  4JOF A;  2PZD A;  5IL9 A;  4JOE A;  1U3B A;  5E6P B;  1Z87 A;  3B76 A;  4F8K A;  1WF7 A;  2I0I A;  1N6D A;  3GCO A;  5I7Z A;  2ZPL A;  3HPM A;  3R69 A;  3KDK A;  2EHR A;  1RY4 A;  2W4F A;  1Y7N A;  3QDO A;  1TP5 A;  1OBX A;  3HPK A;  2VRF A;  1VJ6 A;  5DTH A;  2O2T A;  1IU0 A;  3GAB A;  3GDV A;  3WKM A;  2VSV A;  2EDZ A;  3CH8 A;  3K82 A;  3QIK A;  4IC6 A;  4E3B A;  5E21 A;  1OZI A;  1RZX A;  4Q6S A;  2KA9 A;  2KJK A;  3STJ A;  3DIW A;  3ID1 A;  2I0L A;  1L6O A;  1SOZ A;  1UJV A;  1QAV A;  1UM7 A;  4NMS A;  1UHP A;  1G9O A;  2KRG A;  3KDG A;  1ZUB A;  1FC6 A;  4KFW A;  4OEP A;  1BE9 A;  4JOG A;  1WJL A;  1ZOK A;  2LUI A;  2OGP A;  3MH7 A;  5H3J A;  2DKR A;  4OAJ A;  3NCV A;  2KPL A;  2FCF A;  2JIL A;  3VQG A;  1LCY A;  1WIF A;  3HVQ C;  1IU2 A;  5HEY A;  2D90 A;  4Z33 A;  1MFL A;  2H2C A;  2DMZ A;  2LA8 A;  2GEF A;  2M0U A;  5F3X A;  1MC7 A;  1UEW A;  2KJP A;  2VWR A;  4NXR A;  3MH6 A;  1W9O A;  5A2P A;  2M10 A;  3CBY A;  5HED A;  3SOE A;  3LNY A;  2KJD A;  2PDZ A;  1TE0 A;  1QAU A;  2K1Z A;  4Q2O A;  5HFF A;  1UJU A;  3QJM A;  1V1T A;  2KYL A;  1BFE A;  4Q3H A;  1VB7 A;  3PV2 A;  3CC0 A;  2PNT A;  1X5Q A;  2M0T A;  2REY A;  2KOJ A;  1WHA A;  1I92 A;  1IHJ A;  5GLJ A;  2EDP A;  3GGE A;  2Q9V A;  1PDR A;  2ZPM A;  4Q6H A;  2G2L A;  3NFK A;  1U39 A;  2AIN A;  2I4S A;  4K75 A;  2ENO A;  1UEP A;  5G1E A;  2P3W A;  3RLE A;  2DLS A;  3GCN A;  1QLC A;  2H2B A;  2D8I A;  1X45 A;  5HFE A;  1Z86 A;  1KY9 A;  3O46 A;  5E1Y A;  1R6J A;  3RL8 A;  2CSJ A;  2DM8 A;  2GZV A;  2IWP A;  2K20 A;  5E22 A;  5ILB A;  1VCW A;  2EGK A;  2KOH A;  1WH1 A;  3SHU A;  3TMH A;  2FN5 A;  4XHV A;  4R2Z A;  2EGO A;  4NMO A;  4JOP A;  1WFV A;  1GQ5 A;  2KL1 A;  1X8S A;  3O5N A;  5B42 A;  3SHW A;  1VAE A;  3TSZ A;  2JIN A;  1V5L A;  2VSP A;  4JOK A;  1OBZ A;  1X6D A;  3PV4 A;  2EEG A;  2PKT A;  3CBZ A;  1N7F A;  2AWU A;  4Q2Q A;  3BPU A;  4Q2P A;  3R0H A;  2EEJ A;  3VQF A;  2L4T A;  3GDU A;  4LMM A;  3FY5 A;  2KQF A;  4P2A B;  2JIK A;  1P1E A;  2H3L A;  2X7Z A;  2JWE A;  2R3Y A;  5E11 A;  1WHD A;  2EGN A;  3AXA A;  4K78 A;  4NMV A;  5HJ1 A;  2F0A A;  3CS0 A;  2R4H A;  3ZRT A;  2LC6 A;  4RI0 A;  2W7R A;  5HET A;  1Q3O A;  1RGW A;  2YUY A;  3DJA A;  2DAZ A;  2OCS A;  4L8N A;  2QKV A;  2OMJ A;  1WF8 A;  2EV8 A;  1W9Q A;  3NGH A;  2HE2 A;  3K1R A;  1RGR A;  2E7K A;  1N6F A;  3QJN A;  3EGH C;  2OSG A;  2PA1 A;  3QO6 A;  2G5M B;  3E17 A;  4K6Y A;  3ID4 A;  2EAQ A;  1SOT A;  2RCZ A;  2BYG A;  2Z17 A;  1I16 A;  2KPK A;  1WG6 A;  2M0V A;  4JOR A;  3EGG C;  4NMQ A;  4Z8J A;  3GSL A;  4E35 A;  2FNE A;  3OU0 A;  2OQS A;  3I4W A;  2IWO A;  1V5Q A;  4WYU A;  1TQ3 A;  2I6V A;  2PKU A;  3MH4 A;  3GDS A;  3GJ9 A;  1UM1 A;  2V1W A;  4JJ3 A;  2M3M A;  1FCF A;  2YUB A;  1V6B A;  4YDP A;  3ID3 A;  2DJT A;  2L97 A;  2KAW A;  1UEZ A;  3SFJ A;  2YT7 A;  1D5G A;  1NF3 C;  4UU6 A;  5HDY A;  1X9Z A;  2JSN A;  3JXT A;  1WI4 A;  5D13 A;  2EEI A;  2EXG A;  1OBY A;  3I18 A;  1X5N A;  4NMP A;  1MFG A;  2IWN A;  2VPH A;  4GVC A;  2EJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...