1M5ZA

The pdz7 of glutamate receptor interacting protein binds to its target via a novel hydrophobic surface area
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
91
structure length
91
Chain Sequence
b'SPTPVELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPA receptor interacting protein
publication title The PDZ7 of Glutamate Receptor Interacting Protein Binds to its Target via a Novel Hydrophobic Surface Area
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 11
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2002-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1m5zA00
3O5NA 1Q3OA 4JOJA 1V5QA 1X5RA 1VAEA 1VB7A 4REYA 1UJUA 4NMPA 1W9OA 4JOHA 3KHFA 1UEZA 1TE0A 4NXPA 1UEQA 2VPHA 2EDZA 3PDZA 2ZPLA 5FHTA 2KJKA 1QAVA 3CC0A 5E21A 1N7FA 4HOPA 2IWPA 3ID1A 3CBXA 1U3BA 1V5LA 3GCOA 3DJ1A 4WYTA 1V62A 5F67A 1WF8A 2KG2A 1PDRA 2JREA 2R3YA 3MH7A 4Q6SA 3DJ3A 2L4TA 1I16A 2FN5A 2EEGA 4PQWA 2JXOA 4RI0A 1UJDA 2LOBA 2LC6A 4OEOA 3CS0A 5HEDA 2H3LA 4WYUA 1UM1A 3QDOA 1FC9A 1T2MA 2OCSA 4Q2OA 3SHUA 3CBYA 1V1TA 4F8KA 2EHRA 4LMMA 3DJAA 3GCNA 4FGMA 2FCFA 2R4HA 3OTPA 2D90A 2O2TA 3PS4A 1UF1A 2LUIA 2MX6A 1GM1A 2VZ5A 4E35A 5JXBA 3QGLA 1P1DA 3HPKA 3R69A 1KEFA 4NMTA 3K82A 2YUYA 2LC7A 3PV2A 2JIKA 5G1EA 1Y8TA 2I6VA 2ENOA 2H2BA 4K72A 1UFXA 2KYLA 1X6DA 2FE5A 2REYA 2DM8A 3VQGA 2P3WA 3R68A 1BFEA 2BYGA 4JOFA 1NF3C 2IWNA 1W9QA 1WF7A 1R6JA 2DAZA 1N6DA 4N6XA 3I18A 2EEJA 3I4WA 4YYXA 3RL7A 2L97A 1OZIA 2QBWA 4E34A 4JOKA 4H11A 4G69A 2KQFA 1UEPA 1FC7A 3MH4A 2KRGA 3BPUA 4OEPA 2K1ZA 1MC7A 2DKRA 2YTWA 5DTHA 5HJ1A 4MPAA 2MHOA 2KOMA 4JORA 3QO6A 4NMVA 1ZOKA 1MFGA 3EGHC 2KPKA 2K20A 5HETA 4NMSA 2UZCA 1WG6A 3FY5A 2GZVA 2OZFA 1Q7XA 5HFCA 1FC6A 1MFLA 2VWRA 3GSLA 2PKUA 1WI2A 2AWWA 1G9OA 2W4FA 1W9EA 2I0IA 2G2LA 1XZ9A 2VSVA 1Z86A 4E3BA 2PA1A 3PV4A 2QT5A 2EXGA 2M0TA 1VA8A 1ZUBA 3LNXA 1NTEA 3OU0A 2DC2A 2PNTA 1OBXA 2ZPMA 1V6BA 2RCZA 1KWAA 2HE4A 4UU5A 3DIWA 3RLEA 2DJTA 1UM7A 2EJYA 2M0ZA 5F3XA 4P2AB 5E22A 5GLJA 3EGGC 1D5GA 1YBOA 2G5MB 3DORA 2PKTA 1K32A 4K78A 2KAWA 4R2ZA 5G1DA 3HVQC 1WHAA 1FCFA 4IC6A 2IWOA 2JINA 1RY4A 3GGEA 2QKVA 3VQFA 4GVDA 3TSWA 4EDJA 3JXTA 3QJNA 1Y7NA 1Z87A 1VJ6A 1UHPA 2QG1A 2QKUA 1TP3A 3CH8A 2JOAA 2OQSA 2V90A 2M10A 3SHWA 1N7EA 2AWXA 2EGOA 3QJMA 4NMOA 1GQ5A 1X45A 2EDPA 4Z8JA 2LA8A 1OBYA 1U39A 2M0VA 2WL7A 3GDUA 3SFJA 2OGPA 1P1EA 5HFDA 3L4FD 4NNMA 2AINA 2EGKA 1WH1A 2I1NA 3B76A 1N7TA 1X8SA 3CBZA 1IHJA 1L6OA 2KPLA 3GDSA 2I0LA 2KJPA 2EGNA 3HPMA 4O06A 4NXQA 5E6PB 2OMJA 1GQ4A 2KOJA 4GHNA 5HF1A 1RGRA 3R0HA 5E11A 2CSSA 2CSJA 1QAUA 4KFVA 1WIFA 2YT8A 4Q3HA 1X5QA 1RGWA 1U37A 3LNYA 2EEHA 2Q3GA 4K75A 5I7ZA 2Q9VA 4JOPA 3SOEA 3E17A 1WFVA 3TSZA 1B8QA 3NGHA 1UJVA 2D8IA 2W7RA 2Z9IA 4XHVA 2F5YA 2RRMA 2EAQA 1OBZA 2KBSA 2OSGA 2M0UA 4OAJA 4Q6HA 3AXAA 1M5ZA 1VCWA 2F0AA 2DLSA 5D13A 1SOTA 4NMQA 3RL8A 2HGAA 5H3JA 2DMZA 5HEBA 3KZEA 4AMHA 2H3MA 4NXRA 1QLCA 4Q2NA 3SUZA 3PDVA 2X7ZA 2DLUA 4JOEA 4UU6A 2D92A 4Q2QA 5HF4A 4L8NA 2OS6A 2KV8A 1SOZA 2E7KA 5FB8C 3I1EA 1U38A 3NFLA 2JILA 5HFFA 1IU2A 1RZXA 1WJLA 4Q2PA 4K6YA 1X5NA 5E1YA 3QE1A 1WFGA 3GDVA 3ZRTA 2JWEA 2QKTA 5HDYA 2AWUA 3CYYA 2EDVA 2OPGA 5GNDA 1N6FA 5HFBA 3ID4A 2I4SA 2KA9A 2PZDA 3GJ9A 4K76A 1Q3PA 2EEIA 1WHDA 3WKLA 1WI4A 5HFEA 4P0CA 2IWQA 4GVCA 4JOGA 1TQ3A 1TP5A 3TMHA 3O46A 5EZ0A 2EV8A 2VSPA 5HEYA 2Z17A 4Z33A 2KJDA 2H2CA 4NNLA 1IU0A 1LCYA 2FNEA 4KFWA 2KL1A 2V1WA 3NFKA 4YDPA 2DB5A 2I04A 2CS5A 5B6LA 3WKMA 3K50A 2PDZA 5A2PA 1BE9A 2L4SA 3ID2A 3MH6A 1N6EA 3KZDA 1UEWA 2YT7A 3STJA 1N99A 1I92A 3TSVA 2HE2A 3QIKA 4NMRA 2YUBA 3ID3A 4JL7A 1UITA 1QAVB 2KOHA 5EYZA 2VRFA 3K1RA 3PV5A 4HOPB 1KY9A 2M3MA
chains in the Genus database with same CATH superfamily
3O5NA 1Q3OA 4JOJA 1V5QA 1X5RA 1VAEA 1VB7A 3NCVA 4REYA 1UJUA 4NMPA 1W9OA 4JOHA 3KHFA 1UEZA 1TE0A 4NXPA 1UEQA 2VPHA 2EDZA 4FLNA 3PDZA 2ZPLA 5FHTA 2KJKA 1QAVA 3CC0A 5E21A 1N7FA 4HOPA 2IWPA 3ID1A 3CBXA 1U3BA 1V5LA 3GCOA 3DJ1A 4WYTA 1V62A 5F67A 1WF8A 4JJ3A 2KG2A 1PDRA 2JREA 2R3YA 3MH7A 4Q6SA 3DJ3A 2L4TA 1I16A 2FN5A 2EEGA 4PQWA 2JXOA 4RI0A 1UJDA 2LOBA 2LC6A 4OEOA 3CS0A 5HEDA 2H3LA 5B42A 4WYUA 1UM1A 3QDOA 1FC9A 1T2MA 2OCSA 3KDGA 4Q2OA 3SHUA 3CBYA 1V1TA 4F8KA 2EHRA 4LMMA 3DJAA 3GCNA 4FGMA 2FCFA 2R4HA 3OTPA 2D90A 2O2TA 3PS4A 1UF1A 2LUIA 2MX6A 1GM1A 2VZ5A 4E35A 5JXBA 3QGLA 1P1DA 3HPKA 3R69A 1KEFA 4NMTA 3K82A 2YUYA 2LC7A 3PV2A 2JIKA 5G1EA 1Y8TA 2I6VA 2ENOA 2H2BA 4K72A 1UFXA 2KYLA 1X6DA 2FE5A 2REYA 2DM8A 3VQGA 2P3WA 3R68A 1BFEA 2BYGA 4JOFA 1NF3C 2IWNA 1W9QA 1WF7A 1R6JA 2DAZA 1N6DA 4N6XA 3I18A 2EEJA 3I4WA 4YYXA 3RL7A 2L97A 1OZIA 2QBWA 4E34A 4JOKA 4H11A 4G69A 2KQFA 1UEPA 1FC7A 3MH4A 2KRGA 3BPUA 4OEPA 2K1ZA 1MC7A 2DKRA 2YTWA 5DTHA 5HJ1A 4MPAA 2MHOA 2KOMA 4JORA 3QO6A 4NMVA 1ZOKA 1MFGA 3EGHC 2KPKA 2K20A 5HETA 4NMSA 2UZCA 1WG6A 3FY5A 2GZVA 2OZFA 1Q7XA 5HFCA 1FC6A 1MFLA 2VWRA 3GSLA 2PKUA 1WI2A 2AWWA 1G9OA 2W4FA 1W9EA 2I0IA 2G2LA 1XZ9A 2VSVA 1Z86A 4E3BA 2PA1A 3PV4A 2QT5A 2EXGA 2M0TA 1VA8A 1ZUBA 3LNXA 1NTEA 3OU0A 2DC2A 2PNTA 1OBXA 2ZPMA 1V6BA 2RCZA 1KWAA 2HE4A 4UU5A 3DIWA 3RLEA 2DJTA 1UM7A 2EJYA 2M0ZA 5F3XA 4P2AB 5E22A 1X9ZA 5GLJA 3EGGC 1D5GA 1YBOA 2G5MB 3DORA 2PKTA 1K32A 4K78A 2KAWA 4R2ZA 5G1DA 3HVQC 5ILBA 1WHAA 4JJ0A 1FCFA 4IC6A 2IWOA 2JINA 1RY4A 3GGEA 2QKVA 3VQFA 4GVDA 3TSWA 4EDJA 3JXTA 3QJNA 1Y7NA 1Z87A 1VJ6A 1UHPA 2QG1A 2QKUA 1TP3A 3CH8A 2JOAA 2OQSA 2V90A 2M10A 3SHWA 1N7EA 2AWXA 2EGOA 3QJMA 4NMOA 1GQ5A 1X45A 2EDPA 4Z8JA 2LA8A 1OBYA 1U39A 2M0VA 2WL7A 3GDUA 3SFJA 2OGPA 1P1EA 5HFDA 3L4FD 4NNMA 2AINA 2EGKA 1WH1A 2I1NA 3B76A 1N7TA 1X8SA 3CBZA 1IHJA 1L6OA 2KPLA 3GDSA 2I0LA 2KJPA 2EGNA 3HPMA 4O06A 4NXQA 5E6PB 2OMJA 1GQ4A 2KOJA 4GHNA 5HF1A 1RGRA 3R0HA 5E11A 2CSSA 2CSJA 1QAUA 4KFVA 1WIFA 2YT8A 4Q3HA 1X5QA 1RGWA 1U37A 3LNYA 2EEHA 2Q3GA 4K75A 5I7ZA 2Q9VA 4JOPA 3SOEA 3E17A 1WFVA 3TSZA 1B8QA 3NGHA 1UJVA 2D8IA 2W7RA 2Z9IA 4XHVA 2F5YA 2RRMA 2EAQA 1OBZA 2KBSA 2OSGA 2M0UA 4OAJA 4Q6HA 3AXAA 1M5ZA 1VCWA 2F0AA 2DLSA 5D13A 1SOTA 4NMQA 3RL8A 2HGAA 5H3JA 2DMZA 5HEBA 3KZEA 4AMHA 2H3MA 4NXRA 1QLCA 4Q2NA 3SUZA 3PDVA 2X7ZA 2DLUA 4JOEA 3KDKA 4UU6A 2D92A 4Q2QA 2GEFA 5HF4A 3GABA 4L8NA 2OS6A 2KV8A 1SOZA 2E7KA 5FB8C 3I1EA 1U38A 3NFLA 2JILA 5HFFA 1IU2A 1RZXA 1WJLA 4Q2PA 4K6YA 1X5NA 5E1YA 3QE1A 1WFGA 3GDVA 3ZRTA 2JWEA 2QKTA 5IL9A 5HDYA 2AWUA 3CYYA 2JSNA 2EDVA 2OPGA 5GNDA 1N6FA 5HFBA 3ID4A 2I4SA 2KA9A 2PZDA 3GJ9A 4K76A 1Q3PA 2EEIA 1WHDA 3WKLA 1WI4A 5HFEA 4P0CA 2IWQA 4GVCA 4JOGA 1TQ3A 1TP5A 3TMHA 3O46A 5EZ0A 2EV8A 2VSPA 5HEYA 2Z17A 4Z33A 2KJDA 2H2CA 4NNLA 1IU0A 1LCYA 2FNEA 4KFWA 2KL1A 2V1WA 3NFKA 4YDPA 2DB5A 2I04A 2CS5A 5B6LA 3WKMA 3K50A 2PDZA 5A2PA 1BE9A 2L4SA 3ID2A 3MH6A 1N6EA 3KZDA 1UEWA 2YT7A 3STJA 1N99A 1I92A 3TSVA 2HE2A 3QIKA 4NMRA 2YUBA 3ID3A 4JL7A 1UITA 1QAVB 2KOHA 5EYZA 2VRFA 3K1RA 3PV5A 4HOPB 1KY9A 2M3MA
chains in the Genus database with same CATH topology
3O5NA 1Q3OA 4JOJA 1V5QA 1X5RA 1VAEA 1VB7A 3NCVA 4REYA 1UJUA 4NMPA 1W9OA 4JOHA 3KHFA 1UEZA 1TE0A 4NXPA 1UEQA 2VPHA 2EDZA 4FLNA 3PDZA 2ZPLA 5FHTA 2KJKA 1QAVA 3CC0A 5E21A 1N7FA 4HOPA 2IWPA 3ID1A 3CBXA 1U3BA 1V5LA 3GCOA 3DJ1A 4WYTA 1V62A 5F67A 1WF8A 4JJ3A 2KG2A 1PDRA 2JREA 2R3YA 3MH7A 4Q6SA 3DJ3A 2L4TA 1I16A 2FN5A 2EEGA 4PQWA 2JXOA 4RI0A 1UJDA 2LOBA 2LC6A 4OEOA 3CS0A 5HEDA 2H3LA 5B42A 4WYUA 1UM1A 3QDOA 1FC9A 1T2MA 2OCSA 3KDGA 4Q2OA 3SHUA 3CBYA 1V1TA 4F8KA 2EHRA 4LMMA 3DJAA 3GCNA 4FGMA 2FCFA 2R4HA 3OTPA 2D90A 2O2TA 3PS4A 1UF1A 2LUIA 2MX6A 1GM1A 2VZ5A 4E35A 5JXBA 3QGLA 1P1DA 3HPKA 3R69A 1KEFA 4NMTA 3K82A 2YUYA 2LC7A 3PV2A 2JIKA 5G1EA 1Y8TA 2I6VA 2ENOA 2H2BA 4K72A 1UFXA 2KYLA 1X6DA 2FE5A 2REYA 2DM8A 3VQGA 2P3WA 3R68A 1BFEA 2BYGA 4JOFA 1NF3C 2IWNA 1W9QA 1WF7A 1R6JA 2DAZA 1N6DA 4N6XA 3I18A 2EEJA 3I4WA 4YYXA 3RL7A 2L97A 1OZIA 2QBWA 4E34A 4JOKA 4H11A 4G69A 2KQFA 1UEPA 1FC7A 3MH4A 2KRGA 3BPUA 4OEPA 2K1ZA 1MC7A 2DKRA 2YTWA 5DTHA 5HJ1A 4MPAA 2MHOA 2KOMA 4JORA 3QO6A 4NMVA 1ZOKA 1MFGA 3EGHC 2KPKA 2K20A 5HETA 4NMSA 2UZCA 1WG6A 3FY5A 2GZVA 2OZFA 1Q7XA 5HFCA 1FC6A 1MFLA 2VWRA 3GSLA 2PKUA 1WI2A 2AWWA 1G9OA 2W4FA 1W9EA 2I0IA 2G2LA 1XZ9A 2VSVA 1Z86A 4E3BA 2PA1A 3PV4A 2QT5A 2EXGA 2M0TA 1VA8A 1ZUBA 3LNXA 1NTEA 3OU0A 2DC2A 2PNTA 1OBXA 2ZPMA 1V6BA 2RCZA 1KWAA 2HE4A 4UU5A 3DIWA 3RLEA 2DJTA 1UM7A 2EJYA 2M0ZA 5F3XA 4P2AB 5E22A 1X9ZA 5GLJA 3EGGC 1D5GA 1YBOA 2G5MB 3DORA 2PKTA 1K32A 4K78A 2KAWA 4R2ZA 5G1DA 3HVQC 5ILBA 1WHAA 4JJ0A 1FCFA 4IC6A 2IWOA 2JINA 1RY4A 3GGEA 2QKVA 3VQFA 4GVDA 3TSWA 4EDJA 3JXTA 3QJNA 1Y7NA 1Z87A 1VJ6A 1UHPA 2QG1A 2QKUA 1TP3A 3CH8A 2JOAA 2OQSA 2V90A 2M10A 3SHWA 1N7EA 2AWXA 2EGOA 3QJMA 4NMOA 1GQ5A 1X45A 2EDPA 4Z8JA 2LA8A 1OBYA 1U39A 2M0VA 2WL7A 3GDUA 3SFJA 2OGPA 1P1EA 5HFDA 3L4FD 4NNMA 2AINA 2EGKA 1WH1A 2I1NA 3B76A 1N7TA 1X8SA 3CBZA 1IHJA 1L6OA 2KPLA 3GDSA 2I0LA 2KJPA 2EGNA 3HPMA 4O06A 4NXQA 5E6PB 2OMJA 1GQ4A 2KOJA 4GHNA 5HF1A 1RGRA 3R0HA 5E11A 2CSSA 2CSJA 1QAUA 4KFVA 1WIFA 2YT8A 4Q3HA 1X5QA 1RGWA 1U37A 3LNYA 2EEHA 2Q3GA 4K75A 5I7ZA 2Q9VA 4JOPA 3SOEA 3E17A 1WFVA 3TSZA 1B8QA 3NGHA 1UJVA 2D8IA 2W7RA 2Z9IA 4XHVA 2F5YA 2RRMA 2EAQA 1OBZA 2KBSA 2OSGA 2M0UA 4OAJA 4Q6HA 3AXAA 1M5ZA 1VCWA 2F0AA 2DLSA 5D13A 1SOTA 4NMQA 3RL8A 2HGAA 5H3JA 2DMZA 5HEBA 3KZEA 4AMHA 2H3MA 4NXRA 1QLCA 4Q2NA 3SUZA 3PDVA 2X7ZA 2DLUA 4JOEA 3KDKA 4UU6A 2D92A 4Q2QA 2GEFA 5HF4A 3GABA 4L8NA 2OS6A 2KV8A 1SOZA 2E7KA 5FB8C 3I1EA 1U38A 3NFLA 2JILA 5HFFA 1IU2A 1RZXA 1WJLA 4Q2PA 4K6YA 1X5NA 5E1YA 3QE1A 1WFGA 3GDVA 3ZRTA 2JWEA 2QKTA 5IL9A 5HDYA 2AWUA 3CYYA 2JSNA 2EDVA 2OPGA 5GNDA 1N6FA 5HFBA 3ID4A 2I4SA 2KA9A 2PZDA 3GJ9A 4K76A 1Q3PA 2EEIA 1WHDA 3WKLA 1WI4A 5HFEA 4P0CA 2IWQA 4GVCA 4JOGA 1TQ3A 1TP5A 3TMHA 3O46A 5EZ0A 2EV8A 2VSPA 5HEYA 2Z17A 4Z33A 2KJDA 2H2CA 4NNLA 1IU0A 1LCYA 2FNEA 4KFWA 2KL1A 2V1WA 3NFKA 4YDPA 2DB5A 2I04A 2CS5A 5B6LA 3WKMA 3K50A 2PDZA 5A2PA 1BE9A 2L4SA 3ID2A 3MH6A 1N6EA 3KZDA 1UEWA 2YT7A 3STJA 1N99A 1I92A 3TSVA 2HE2A 3QIKA 4NMRA 2YUBA 3ID3A 4JL7A 1UITA 1QAVB 2KOHA 5EYZA 2VRFA 3K1RA 3PV5A 4HOPB 1KY9A 2M3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5N A;  1Q3O A;  4JOJ A;  1V5Q A;  1X5R A;  1VAE A;  1VB7 A;  4REY A;  1UJU A;  4NMP A;  1W9O A;  4JOH A;  3KHF A;  1UEZ A;  1TE0 A;  4NXP A;  1UEQ A;  2VPH A;  2EDZ A;  3PDZ A;  2ZPL A;  5FHT A;  2KJK A;  1QAV A;  3CC0 A;  5E21 A;  1N7F A;  4HOP A;  2IWP A;  3ID1 A;  3CBX A;  1U3B A;  1V5L A;  3GCO A;  3DJ1 A;  4WYT A;  1V62 A;  5F67 A;  1WF8 A;  2KG2 A;  1PDR A;  2JRE A;  2R3Y A;  3MH7 A;  4Q6S A;  3DJ3 A;  2L4T A;  1I16 A;  2FN5 A;  2EEG A;  4PQW A;  2JXO A;  4RI0 A;  1UJD A;  2LOB A;  2LC6 A;  4OEO A;  3CS0 A;  5HED A;  2H3L A;  4WYU A;  1UM1 A;  3QDO A;  1FC9 A;  1T2M A;  2OCS A;  4Q2O A;  3SHU A;  3CBY A;  1V1T A;  4F8K A;  2EHR A;  4LMM A;  3DJA A;  3GCN A;  4FGM A;  2FCF A;  2R4H A;  3OTP A;  2D90 A;  2O2T A;  3PS4 A;  1UF1 A;  2LUI A;  2MX6 A;  1GM1 A;  2VZ5 A;  4E35 A;  5JXB A;  3QGL A;  1P1D A;  3HPK A;  3R69 A;  1KEF A;  4NMT A;  3K82 A;  2YUY A;  2LC7 A;  3PV2 A;  2JIK A;  5G1E A;  1Y8T A;  2I6V A;  2ENO A;  2H2B A;  4K72 A;  1UFX A;  2KYL A;  1X6D A;  2FE5 A;  2REY A;  2DM8 A;  3VQG A;  2P3W A;  3R68 A;  1BFE A;  2BYG A;  4JOF A;  1NF3 C;  2IWN A;  1W9Q A;  1WF7 A;  1R6J A;  2DAZ A;  1N6D A;  4N6X A;  3I18 A;  2EEJ A;  3I4W A;  4YYX A;  3RL7 A;  2L97 A;  1OZI A;  2QBW A;  4E34 A;  4JOK A;  4H11 A;  4G69 A;  2KQF A;  1UEP A;  1FC7 A;  3MH4 A;  2KRG A;  3BPU A;  4OEP A;  2K1Z A;  1MC7 A;  2DKR A;  2YTW A;  5DTH A;  5HJ1 A;  4MPA A;  2MHO A;  2KOM A;  4JOR A;  3QO6 A;  4NMV A;  1ZOK A;  1MFG A;  3EGH C;  2KPK A;  2K20 A;  5HET A;  4NMS A;  2UZC A;  1WG6 A;  3FY5 A;  2GZV A;  2OZF A;  1Q7X A;  5HFC A;  1FC6 A;  1MFL A;  2VWR A;  3GSL A;  2PKU A;  1WI2 A;  2AWW A;  1G9O A;  2W4F A;  1W9E A;  2I0I A;  2G2L A;  1XZ9 A;  2VSV A;  1Z86 A;  4E3B A;  2PA1 A;  3PV4 A;  2QT5 A;  2EXG A;  2M0T A;  1VA8 A;  1ZUB A;  3LNX A;  1NTE A;  3OU0 A;  2DC2 A;  2PNT A;  1OBX A;  2ZPM A;  1V6B A;  2RCZ A;  1KWA A;  2HE4 A;  4UU5 A;  3DIW A;  3RLE A;  2DJT A;  1UM7 A;  2EJY A;  2M0Z A;  5F3X A;  4P2A B;  5E22 A;  5GLJ A;  3EGG C;  1D5G A;  1YBO A;  2G5M B;  3DOR A;  2PKT A;  1K32 A;  4K78 A;  2KAW A;  4R2Z A;  5G1D A;  3HVQ C;  1WHA A;  1FCF A;  4IC6 A;  2IWO A;  2JIN A;  1RY4 A;  3GGE A;  2QKV A;  3VQF A;  4GVD A;  3TSW A;  4EDJ A;  3JXT A;  3QJN A;  1Y7N A;  1Z87 A;  1VJ6 A;  1UHP A;  2QG1 A;  2QKU A;  1TP3 A;  3CH8 A;  2JOA A;  2OQS A;  2V90 A;  2M10 A;  3SHW A;  1N7E A;  2AWX A;  2EGO A;  3QJM A;  4NMO A;  1GQ5 A;  1X45 A;  2EDP A;  4Z8J A;  2LA8 A;  1OBY A;  1U39 A;  2M0V A;  2WL7 A;  3GDU A;  3SFJ A;  2OGP A;  1P1E A;  5HFD A;  3L4F D;  4NNM A;  2AIN A;  2EGK A;  1WH1 A;  2I1N A;  3B76 A;  1N7T A;  1X8S A;  3CBZ A;  1IHJ A;  1L6O A;  2KPL A;  3GDS A;  2I0L A;  2KJP A;  2EGN A;  3HPM A;  4O06 A;  4NXQ A;  5E6P B;  2OMJ A;  1GQ4 A;  2KOJ A;  4GHN A;  5HF1 A;  1RGR A;  3R0H A;  5E11 A;  2CSS A;  2CSJ A;  1QAU A;  4KFV A;  1WIF A;  2YT8 A;  4Q3H A;  1X5Q A;  1RGW A;  1U37 A;  3LNY A;  2EEH A;  2Q3G A;  4K75 A;  5I7Z A;  2Q9V A;  4JOP A;  3SOE A;  3E17 A;  1WFV A;  3TSZ A;  1B8Q A;  3NGH A;  1UJV A;  2D8I A;  2W7R A;  2Z9I A;  4XHV A;  2F5Y A;  2RRM A;  2EAQ A;  1OBZ A;  2KBS A;  2OSG A;  2M0U A;  4OAJ A;  4Q6H A;  3AXA A;  1M5Z A;  1VCW A;  2F0A A;  2DLS A;  5D13 A;  1SOT A;  4NMQ A;  3RL8 A;  2HGA A;  5H3J A;  2DMZ A;  5HEB A;  3KZE A;  4AMH A;  2H3M A;  4NXR A;  1QLC A;  4Q2N A;  3SUZ A;  3PDV A;  2X7Z A;  2DLU A;  4JOE A;  4UU6 A;  2D92 A;  4Q2Q A;  5HF4 A;  4L8N A;  2OS6 A;  2KV8 A;  1SOZ A;  2E7K A;  5FB8 C;  3I1E A;  1U38 A;  3NFL A;  2JIL A;  5HFF A;  1IU2 A;  1RZX A;  1WJL A;  4Q2P A;  4K6Y A;  1X5N A;  5E1Y A;  3QE1 A;  1WFG A;  3GDV A;  3ZRT A;  2JWE A;  2QKT A;  5HDY A;  2AWU A;  3CYY A;  2EDV A;  2OPG A;  5GND A;  1N6F A;  5HFB A;  3ID4 A;  2I4S A;  2KA9 A;  2PZD A;  3GJ9 A;  4K76 A;  1Q3P A;  2EEI A;  1WHD A;  3WKL A;  1WI4 A;  5HFE A;  4P0C A;  2IWQ A;  4GVC A;  4JOG A;  1TQ3 A;  1TP5 A;  3TMH A;  3O46 A;  5EZ0 A;  2EV8 A;  2VSP A;  5HEY A;  2Z17 A;  4Z33 A;  2KJD A;  2H2C A;  4NNL A;  1IU0 A;  1LCY A;  2FNE A;  4KFW A;  2KL1 A;  2V1W A;  3NFK A;  4YDP A;  2DB5 A;  2I04 A;  2CS5 A;  5B6L A;  3WKM A;  3K50 A;  2PDZ A;  5A2P A;  1BE9 A;  2L4S A;  3ID2 A;  3MH6 A;  1N6E A;  3KZD A;  1UEW A;  2YT7 A;  3STJ A;  1N99 A;  1I92 A;  3TSV A;  2HE2 A;  3QIK A;  4NMR A;  2YUB A;  3ID3 A;  4JL7 A;  1UIT A;  1QAV B;  2KOH A;  5EYZ A;  2VRF A;  3K1R A;  3PV5 A;  4HOP B;  1KY9 A;  2M3M A; 
#chains in the Genus database with same CATH topology
 3O5N A;  1Q3O A;  4JOJ A;  1V5Q A;  1X5R A;  1VAE A;  1VB7 A;  3NCV A;  4REY A;  1UJU A;  4NMP A;  1W9O A;  4JOH A;  3KHF A;  1UEZ A;  1TE0 A;  4NXP A;  1UEQ A;  2VPH A;  2EDZ A;  4FLN A;  3PDZ A;  2ZPL A;  5FHT A;  2KJK A;  1QAV A;  3CC0 A;  5E21 A;  1N7F A;  4HOP A;  2IWP A;  3ID1 A;  3CBX A;  1U3B A;  1V5L A;  3GCO A;  3DJ1 A;  4WYT A;  1V62 A;  5F67 A;  1WF8 A;  4JJ3 A;  2KG2 A;  1PDR A;  2JRE A;  2R3Y A;  3MH7 A;  4Q6S A;  3DJ3 A;  2L4T A;  1I16 A;  2FN5 A;  2EEG A;  4PQW A;  2JXO A;  4RI0 A;  1UJD A;  2LOB A;  2LC6 A;  4OEO A;  3CS0 A;  5HED A;  2H3L A;  5B42 A;  4WYU A;  1UM1 A;  3QDO A;  1FC9 A;  1T2M A;  2OCS A;  3KDG A;  4Q2O A;  3SHU A;  3CBY A;  1V1T A;  4F8K A;  2EHR A;  4LMM A;  3DJA A;  3GCN A;  4FGM A;  2FCF A;  2R4H A;  3OTP A;  2D90 A;  2O2T A;  3PS4 A;  1UF1 A;  2LUI A;  2MX6 A;  1GM1 A;  2VZ5 A;  4E35 A;  5JXB A;  3QGL A;  1P1D A;  3HPK A;  3R69 A;  1KEF A;  4NMT A;  3K82 A;  2YUY A;  2LC7 A;  3PV2 A;  2JIK A;  5G1E A;  1Y8T A;  2I6V A;  2ENO A;  2H2B A;  4K72 A;  1UFX A;  2KYL A;  1X6D A;  2FE5 A;  2REY A;  2DM8 A;  3VQG A;  2P3W A;  3R68 A;  1BFE A;  2BYG A;  4JOF A;  1NF3 C;  2IWN A;  1W9Q A;  1WF7 A;  1R6J A;  2DAZ A;  1N6D A;  4N6X A;  3I18 A;  2EEJ A;  3I4W A;  4YYX A;  3RL7 A;  2L97 A;  1OZI A;  2QBW A;  4E34 A;  4JOK A;  4H11 A;  4G69 A;  2KQF A;  1UEP A;  1FC7 A;  3MH4 A;  2KRG A;  3BPU A;  4OEP A;  2K1Z A;  1MC7 A;  2DKR A;  2YTW A;  5DTH A;  5HJ1 A;  4MPA A;  2MHO A;  2KOM A;  4JOR A;  3QO6 A;  4NMV A;  1ZOK A;  1MFG A;  3EGH C;  2KPK A;  2K20 A;  5HET A;  4NMS A;  2UZC A;  1WG6 A;  3FY5 A;  2GZV A;  2OZF A;  1Q7X A;  5HFC A;  1FC6 A;  1MFL A;  2VWR A;  3GSL A;  2PKU A;  1WI2 A;  2AWW A;  1G9O A;  2W4F A;  1W9E A;  2I0I A;  2G2L A;  1XZ9 A;  2VSV A;  1Z86 A;  4E3B A;  2PA1 A;  3PV4 A;  2QT5 A;  2EXG A;  2M0T A;  1VA8 A;  1ZUB A;  3LNX A;  1NTE A;  3OU0 A;  2DC2 A;  2PNT A;  1OBX A;  2ZPM A;  1V6B A;  2RCZ A;  1KWA A;  2HE4 A;  4UU5 A;  3DIW A;  3RLE A;  2DJT A;  1UM7 A;  2EJY A;  2M0Z A;  5F3X A;  4P2A B;  5E22 A;  1X9Z A;  5GLJ A;  3EGG C;  1D5G A;  1YBO A;  2G5M B;  3DOR A;  2PKT A;  1K32 A;  4K78 A;  2KAW A;  4R2Z A;  5G1D A;  3HVQ C;  5ILB A;  1WHA A;  4JJ0 A;  1FCF A;  4IC6 A;  2IWO A;  2JIN A;  1RY4 A;  3GGE A;  2QKV A;  3VQF A;  4GVD A;  3TSW A;  4EDJ A;  3JXT A;  3QJN A;  1Y7N A;  1Z87 A;  1VJ6 A;  1UHP A;  2QG1 A;  2QKU A;  1TP3 A;  3CH8 A;  2JOA A;  2OQS A;  2V90 A;  2M10 A;  3SHW A;  1N7E A;  2AWX A;  2EGO A;  3QJM A;  4NMO A;  1GQ5 A;  1X45 A;  2EDP A;  4Z8J A;  2LA8 A;  1OBY A;  1U39 A;  2M0V A;  2WL7 A;  3GDU A;  3SFJ A;  2OGP A;  1P1E A;  5HFD A;  3L4F D;  4NNM A;  2AIN A;  2EGK A;  1WH1 A;  2I1N A;  3B76 A;  1N7T A;  1X8S A;  3CBZ A;  1IHJ A;  1L6O A;  2KPL A;  3GDS A;  2I0L A;  2KJP A;  2EGN A;  3HPM A;  4O06 A;  4NXQ A;  5E6P B;  2OMJ A;  1GQ4 A;  2KOJ A;  4GHN A;  5HF1 A;  1RGR A;  3R0H A;  5E11 A;  2CSS A;  2CSJ A;  1QAU A;  4KFV A;  1WIF A;  2YT8 A;  4Q3H A;  1X5Q A;  1RGW A;  1U37 A;  3LNY A;  2EEH A;  2Q3G A;  4K75 A;  5I7Z A;  2Q9V A;  4JOP A;  3SOE A;  3E17 A;  1WFV A;  3TSZ A;  1B8Q A;  3NGH A;  1UJV A;  2D8I A;  2W7R A;  2Z9I A;  4XHV A;  2F5Y A;  2RRM A;  2EAQ A;  1OBZ A;  2KBS A;  2OSG A;  2M0U A;  4OAJ A;  4Q6H A;  3AXA A;  1M5Z A;  1VCW A;  2F0A A;  2DLS A;  5D13 A;  1SOT A;  4NMQ A;  3RL8 A;  2HGA A;  5H3J A;  2DMZ A;  5HEB A;  3KZE A;  4AMH A;  2H3M A;  4NXR A;  1QLC A;  4Q2N A;  3SUZ A;  3PDV A;  2X7Z A;  2DLU A;  4JOE A;  3KDK A;  4UU6 A;  2D92 A;  4Q2Q A;  2GEF A;  5HF4 A;  3GAB A;  4L8N A;  2OS6 A;  2KV8 A;  1SOZ A;  2E7K A;  5FB8 C;  3I1E A;  1U38 A;  3NFL A;  2JIL A;  5HFF A;  1IU2 A;  1RZX A;  1WJL A;  4Q2P A;  4K6Y A;  1X5N A;  5E1Y A;  3QE1 A;  1WFG A;  3GDV A;  3ZRT A;  2JWE A;  2QKT A;  5IL9 A;  5HDY A;  2AWU A;  3CYY A;  2JSN A;  2EDV A;  2OPG A;  5GND A;  1N6F A;  5HFB A;  3ID4 A;  2I4S A;  2KA9 A;  2PZD A;  3GJ9 A;  4K76 A;  1Q3P A;  2EEI A;  1WHD A;  3WKL A;  1WI4 A;  5HFE A;  4P0C A;  2IWQ A;  4GVC A;  4JOG A;  1TQ3 A;  1TP5 A;  3TMH A;  3O46 A;  5EZ0 A;  2EV8 A;  2VSP A;  5HEY A;  2Z17 A;  4Z33 A;  2KJD A;  2H2C A;  4NNL A;  1IU0 A;  1LCY A;  2FNE A;  4KFW A;  2KL1 A;  2V1W A;  3NFK A;  4YDP A;  2DB5 A;  2I04 A;  2CS5 A;  5B6L A;  3WKM A;  3K50 A;  2PDZ A;  5A2P A;  1BE9 A;  2L4S A;  3ID2 A;  3MH6 A;  1N6E A;  3KZD A;  1UEW A;  2YT7 A;  3STJ A;  1N99 A;  1I92 A;  3TSV A;  2HE2 A;  3QIK A;  4NMR A;  2YUB A;  3ID3 A;  4JL7 A;  1UIT A;  1QAV B;  2KOH A;  5EYZ A;  2VRF A;  3K1R A;  3PV5 A;  4HOP B;  1KY9 A;  2M3M A; 
#chains in the Genus database with same CATH homology
 3O5N A;  1Q3O A;  4JOJ A;  1V5Q A;  1X5R A;  1VAE A;  1VB7 A;  3NCV A;  4REY A;  1UJU A;  4NMP A;  1W9O A;  4JOH A;  3KHF A;  1UEZ A;  1TE0 A;  4NXP A;  1UEQ A;  2VPH A;  2EDZ A;  4FLN A;  3PDZ A;  2ZPL A;  5FHT A;  2KJK A;  1QAV A;  3CC0 A;  5E21 A;  1N7F A;  4HOP A;  2IWP A;  3ID1 A;  3CBX A;  1U3B A;  1V5L A;  3GCO A;  3DJ1 A;  4WYT A;  1V62 A;  5F67 A;  1WF8 A;  4JJ3 A;  2KG2 A;  1PDR A;  2JRE A;  2R3Y A;  3MH7 A;  4Q6S A;  3DJ3 A;  2L4T A;  1I16 A;  2FN5 A;  2EEG A;  4PQW A;  2JXO A;  4RI0 A;  1UJD A;  2LOB A;  2LC6 A;  4OEO A;  3CS0 A;  5HED A;  2H3L A;  5B42 A;  4WYU A;  1UM1 A;  3QDO A;  1FC9 A;  1T2M A;  2OCS A;  3KDG A;  4Q2O A;  3SHU A;  3CBY A;  1V1T A;  4F8K A;  2EHR A;  4LMM A;  3DJA A;  3GCN A;  4FGM A;  2FCF A;  2R4H A;  3OTP A;  2D90 A;  2O2T A;  3PS4 A;  1UF1 A;  2LUI A;  2MX6 A;  1GM1 A;  2VZ5 A;  4E35 A;  5JXB A;  3QGL A;  1P1D A;  3HPK A;  3R69 A;  1KEF A;  4NMT A;  3K82 A;  2YUY A;  2LC7 A;  3PV2 A;  2JIK A;  5G1E A;  1Y8T A;  2I6V A;  2ENO A;  2H2B A;  4K72 A;  1UFX A;  2KYL A;  1X6D A;  2FE5 A;  2REY A;  2DM8 A;  3VQG A;  2P3W A;  3R68 A;  1BFE A;  2BYG A;  4JOF A;  1NF3 C;  2IWN A;  1W9Q A;  1WF7 A;  1R6J A;  2DAZ A;  1N6D A;  4N6X A;  3I18 A;  2EEJ A;  3I4W A;  4YYX A;  3RL7 A;  2L97 A;  1OZI A;  2QBW A;  4E34 A;  4JOK A;  4H11 A;  4G69 A;  2KQF A;  1UEP A;  1FC7 A;  3MH4 A;  2KRG A;  3BPU A;  4OEP A;  2K1Z A;  1MC7 A;  2DKR A;  2YTW A;  5DTH A;  5HJ1 A;  4MPA A;  2MHO A;  2KOM A;  4JOR A;  3QO6 A;  4NMV A;  1ZOK A;  1MFG A;  3EGH C;  2KPK A;  2K20 A;  5HET A;  4NMS A;  2UZC A;  1WG6 A;  3FY5 A;  2GZV A;  2OZF A;  1Q7X A;  5HFC A;  1FC6 A;  1MFL A;  2VWR A;  3GSL A;  2PKU A;  1WI2 A;  2AWW A;  1G9O A;  2W4F A;  1W9E A;  2I0I A;  2G2L A;  1XZ9 A;  2VSV A;  1Z86 A;  4E3B A;  2PA1 A;  3PV4 A;  2QT5 A;  2EXG A;  2M0T A;  1VA8 A;  1ZUB A;  3LNX A;  1NTE A;  3OU0 A;  2DC2 A;  2PNT A;  1OBX A;  2ZPM A;  1V6B A;  2RCZ A;  1KWA A;  2HE4 A;  4UU5 A;  3DIW A;  3RLE A;  2DJT A;  1UM7 A;  2EJY A;  2M0Z A;  5F3X A;  4P2A B;  5E22 A;  1X9Z A;  5GLJ A;  3EGG C;  1D5G A;  1YBO A;  2G5M B;  3DOR A;  2PKT A;  1K32 A;  4K78 A;  2KAW A;  4R2Z A;  5G1D A;  3HVQ C;  5ILB A;  1WHA A;  4JJ0 A;  1FCF A;  4IC6 A;  2IWO A;  2JIN A;  1RY4 A;  3GGE A;  2QKV A;  3VQF A;  4GVD A;  3TSW A;  4EDJ A;  3JXT A;  3QJN A;  1Y7N A;  1Z87 A;  1VJ6 A;  1UHP A;  2QG1 A;  2QKU A;  1TP3 A;  3CH8 A;  2JOA A;  2OQS A;  2V90 A;  2M10 A;  3SHW A;  1N7E A;  2AWX A;  2EGO A;  3QJM A;  4NMO A;  1GQ5 A;  1X45 A;  2EDP A;  4Z8J A;  2LA8 A;  1OBY A;  1U39 A;  2M0V A;  2WL7 A;  3GDU A;  3SFJ A;  2OGP A;  1P1E A;  5HFD A;  3L4F D;  4NNM A;  2AIN A;  2EGK A;  1WH1 A;  2I1N A;  3B76 A;  1N7T A;  1X8S A;  3CBZ A;  1IHJ A;  1L6O A;  2KPL A;  3GDS A;  2I0L A;  2KJP A;  2EGN A;  3HPM A;  4O06 A;  4NXQ A;  5E6P B;  2OMJ A;  1GQ4 A;  2KOJ A;  4GHN A;  5HF1 A;  1RGR A;  3R0H A;  5E11 A;  2CSS A;  2CSJ A;  1QAU A;  4KFV A;  1WIF A;  2YT8 A;  4Q3H A;  1X5Q A;  1RGW A;  1U37 A;  3LNY A;  2EEH A;  2Q3G A;  4K75 A;  5I7Z A;  2Q9V A;  4JOP A;  3SOE A;  3E17 A;  1WFV A;  3TSZ A;  1B8Q A;  3NGH A;  1UJV A;  2D8I A;  2W7R A;  2Z9I A;  4XHV A;  2F5Y A;  2RRM A;  2EAQ A;  1OBZ A;  2KBS A;  2OSG A;  2M0U A;  4OAJ A;  4Q6H A;  3AXA A;  1M5Z A;  1VCW A;  2F0A A;  2DLS A;  5D13 A;  1SOT A;  4NMQ A;  3RL8 A;  2HGA A;  5H3J A;  2DMZ A;  5HEB A;  3KZE A;  4AMH A;  2H3M A;  4NXR A;  1QLC A;  4Q2N A;  3SUZ A;  3PDV A;  2X7Z A;  2DLU A;  4JOE A;  3KDK A;  4UU6 A;  2D92 A;  4Q2Q A;  2GEF A;  5HF4 A;  3GAB A;  4L8N A;  2OS6 A;  2KV8 A;  1SOZ A;  2E7K A;  5FB8 C;  3I1E A;  1U38 A;  3NFL A;  2JIL A;  5HFF A;  1IU2 A;  1RZX A;  1WJL A;  4Q2P A;  4K6Y A;  1X5N A;  5E1Y A;  3QE1 A;  1WFG A;  3GDV A;  3ZRT A;  2JWE A;  2QKT A;  5IL9 A;  5HDY A;  2AWU A;  3CYY A;  2JSN A;  2EDV A;  2OPG A;  5GND A;  1N6F A;  5HFB A;  3ID4 A;  2I4S A;  2KA9 A;  2PZD A;  3GJ9 A;  4K76 A;  1Q3P A;  2EEI A;  1WHD A;  3WKL A;  1WI4 A;  5HFE A;  4P0C A;  2IWQ A;  4GVC A;  4JOG A;  1TQ3 A;  1TP5 A;  3TMH A;  3O46 A;  5EZ0 A;  2EV8 A;  2VSP A;  5HEY A;  2Z17 A;  4Z33 A;  2KJD A;  2H2C A;  4NNL A;  1IU0 A;  1LCY A;  2FNE A;  4KFW A;  2KL1 A;  2V1W A;  3NFK A;  4YDP A;  2DB5 A;  2I04 A;  2CS5 A;  5B6L A;  3WKM A;  3K50 A;  2PDZ A;  5A2P A;  1BE9 A;  2L4S A;  3ID2 A;  3MH6 A;  1N6E A;  3KZD A;  1UEW A;  2YT7 A;  3STJ A;  1N99 A;  1I92 A;  3TSV A;  2HE2 A;  3QIK A;  4NMR A;  2YUB A;  3ID3 A;  4JL7 A;  1UIT A;  1QAV B;  2KOH A;  5EYZ A;  2VRF A;  3K1R A;  3PV5 A;  4HOP B;  1KY9 A;  2M3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...