4P0CA

Crystal structure of nherf2 pdz1 domain in complex with lpa2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
b'MPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQMDSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na(+)/H(+) exchange regulatory cofactor NHE-RF2/Lysophosphat
publication title Structural insights into PDZ-mediated interaction of NHERF2 and LPA2, a cellular event implicated in CFTR channel regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4p0cA00
1X5RA 5F3XA 3CBYA 5I7ZA 1V62A 2K20A 2LA8A 4NMRA 3RL7A 4IC6A 4UU6A 4Q2NA 2IWNA 2PZDA 2KG2A 2IWPA 2JINA 4KFWA 2KBSA 2JREA 2RCZA 1X6DA 3DORA 2EGNA 2H2BA 4YDPA 1IHJA 4LMMA 4OAJA 1WF7A 3CS0A 1TE0A 2KOJA 1N6EA 4JOPA 1ZUBA 4NXPA 4GHNA 2DB5A 3VQFA 3B76A 4NNMA 3GDUA 5G1DA 3QO6A 4K6YA 1OZIA 1UEQA 4HOPA 2DC2A 2AWWA 2QKUA 2PA1A 2G2LA 2M3MA 3HPKA 1N99A 2CSSA 3CH8A 5HF4A 5GNDA 3GCNA 1N6FA 2CS5A 2KL1A 3DJ1A 4JOFA 5EYZA 1KY9A 1WIFA 2FCFA 3FY5A 2AINA 1X5QA 2X7ZA 5HFCA 2MX6A 4NMQA 1X45A 2JIKA 4NMVA 4K75A 1UEZA 2LC7A 3EGGC 5HEDA 2DLSA 2G5MB 4K78A 3HVQC 2EDVA 1WFGA 1KWAA 4Q6HA 4AMHA 1WHDA 4GVDA 4JOGA 5F67A 3KHFA 2H2CA 1N7EA 1IU2A 1BFEA 5HETA 5HEYA 3R68A 3QJNA 4P2AB 1RZXA 2F0AA 5HDYA 2VWRA 1VAEA 3GDVA 5E6PB 2EJYA 5JXBA 2L4SA 5HFEA 2WL7A 2YTWA 2PDZA 4NXRA 2KQFA 4NXQA 2DJTA 3O46A 1WJLA 4PQWA 1P1EA 3QIKA 1X5NA 2P3WA 3GJ9A 1TP5A 2MHOA 1W9QA 2YUBA 4K76A 2LC6A 2H3MA 1W9EA 1WH1A 4GVCA 2H3LA 2K1ZA 2ZPLA 2QKTA 1UITA 1UHPA 5HFDA 2BYGA 1WI2A 2FNEA 1LCYA 2OSGA 5E21A 2L97A 5A2PA 2EDZA 4KFVA 4L8NA 5GLJA 4JOKA 1RY4A 1I16A 2PKUA 2QBWA 1UEWA 2V90A 1V6BA 1FC7A 2LUIA 1WI4A 1I92A 3CBZA 3K50A 1OBXA 3I1EA 2O2TA 1P1DA 3SHWA 2I04A 3LNYA 4RI0A 5B6LA 4JOHA 4NNLA 4Q6SA 2IWOA 2DKRA 4HOPB 3WKLA 2QG1A 4G69A 1XZ9A 4REYA 3K1RA 3TSVA 1TP3A 2KOMA 3JXTA 1UFXA 3SFJA 4UU5A 1VCWA 3QE1A 4K72A 2KAWA 2KV8A 1QAVA 3QDOA 2KPKA 2FE5A 2I0IA 4JOJA 5FHTA 2ENOA 1GM1A 2EDPA 1TQ3A 1N7FA 1G9OA 5E1YA 4YYXA 2KPLA 4NMTA 1B8QA 2CSJA 3ID2A 3LNXA 5HFFA 2HE2A 3NGHA 1UM7A 2I4SA 4MPAA 2F5YA 2OPGA 2VZ5A 2HGAA 4NMOA 4FGMA 1M5ZA 1GQ5A 1Q3OA 4F8KA 1WG6A 3QGLA 2V1WA 5HJ1A 3OTPA 2KOHA 1WF8A 3R0HA 4OEOA 3CYYA 2W7RA 1OBZA 2EEHA 2QKVA 3BPUA 2UZCA 2I6VA 3GGEA 2EXGA 3SOEA 1W9OA 2EV8A 3CC0A 2M0UA 1MFGA 2KRGA 2EEGA 3ID3A 3PDVA 1Z86A 1X8SA 3AXAA 2Q9VA 2DLUA 4Q2PA 2KJDA 2W4FA 5G1EA 4Q2QA 1VJ6A 1V1TA 1Y8TA 2E7KA 3MH4A 3SUZA 2PNTA 1WFVA 1MFLA 4JL7A 1V5LA 2VPHA 5HFBA 1FCFA 1NF3C 1Q7XA 2AWXA 2R3YA 3MH7A 2VSVA 1UJUA 3GSLA 4H11A 3I4WA 4EDJA 3MH6A 1N6DA 3RL8A 3NFKA 2REYA 3DIWA 2LOBA 2OMJA 2EHRA 1SOZA 3TSWA 3ID4A 1UJVA 2JWEA 1R6JA 4WYUA 1RGRA 3VQGA 1UJDA 1PDRA 5HF1A 3NFLA 4E35A 5FB8C 1MC7A 3SHUA 2EEIA 2VRFA 4Q2OA 1N7TA 5D13A 2QT5A 1U39A 3CBXA 4O06A 1QAVB 4R2ZA 2R4HA 1RGWA 2AWUA 2D8IA 1U37A 2RRMA 2Z9IA 3R69A 1IU0A 2KA9A 3STJA 3E17A 2YT8A 2Q3GA 2Z17A 2YUYA 3RLEA 3PV5A 3PV2A 2OGPA 1FC9A 5E22A 3TSZA 5H3JA 3DJAA 3PDZA 1FC6A 3HPMA 2FN5A 3PV4A 1YBOA 1VB7A 3L4FD 1QAUA 2IWQA 2EAQA 4Z8JA 2L4TA 1V5QA 3K82A 5HEBA 1T2MA 1L6OA 2ZPMA 4Q3HA 2I1NA 2DMZA 1U38A 2EGOA 2DAZA 4Z33A 3ID1A 4NMPA 2M0ZA 2YT7A 1ZOKA 1BE9A 4N6XA 4OEPA 2PKTA 3ZRTA 4WYTA 2M10A 4P0CA 1U3BA 2GZVA 3I18A 4E34A 2OQSA 1UM1A 4XHVA 3GCOA 3GDSA 1Z87A 4NMSA 1KEFA 1D5GA 2KJKA 2VSPA 1VA8A 3KZDA 2I0LA 3PS4A 2OCSA 3O5NA 3TMHA 1Q3PA 1WHAA 2JILA 3KZEA 3DJ3A 1Y7NA 1QLCA 1UF1A 1K32A 1GQ4A 5EZ0A 2KYLA 1NTEA 4JORA 2KJPA 2D90A 2DM8A 3QJMA 1OBYA 2M0TA 4JOEA 2JOAA 5E11A 3OU0A 2JXOA 1SOTA 2EGKA 3EGHC 5DTHA 2EEJA 2M0VA 4E3BA 2D92A 3WKMA 2OS6A 1UEPA 2HE4A 2OZFA
chains in the Genus database with same CATH superfamily
3NCVA 1X5RA 5F3XA 3CBYA 5I7ZA 1V62A 2K20A 2LA8A 4NMRA 3RL7A 4IC6A 4UU6A 4JJ0A 4Q2NA 2IWNA 2PZDA 2KG2A 2IWPA 2JINA 4KFWA 2KBSA 2JREA 2RCZA 1X6DA 3DORA 2EGNA 2H2BA 4YDPA 1IHJA 4LMMA 4OAJA 1WF7A 3CS0A 1TE0A 2KOJA 1N6EA 4JOPA 1ZUBA 4NXPA 4GHNA 2DB5A 3VQFA 3B76A 4NNMA 3GDUA 5G1DA 3QO6A 4K6YA 1OZIA 1UEQA 4HOPA 2DC2A 2AWWA 2QKUA 2PA1A 2G2LA 2M3MA 3HPKA 1N99A 2CSSA 4JJ3A 3CH8A 5HF4A 5GNDA 3GCNA 1N6FA 2CS5A 2KL1A 3DJ1A 4JOFA 5EYZA 1KY9A 1WIFA 2FCFA 3FY5A 2AINA 1X5QA 2X7ZA 5HFCA 2MX6A 4NMQA 1X45A 2JIKA 4NMVA 4K75A 1UEZA 2LC7A 3EGGC 5HEDA 2DLSA 2G5MB 4K78A 3HVQC 2EDVA 1WFGA 1KWAA 4Q6HA 4AMHA 1WHDA 4GVDA 4JOGA 5F67A 5IL9A 3KHFA 2H2CA 1N7EA 1IU2A 1BFEA 5HETA 5HEYA 3R68A 3QJNA 4P2AB 1RZXA 2F0AA 5HDYA 2VWRA 1VAEA 3GDVA 5E6PB 2EJYA 5JXBA 2L4SA 5HFEA 2WL7A 2YTWA 2PDZA 4NXRA 2KQFA 4NXQA 2DJTA 3O46A 5ILBA 1WJLA 4PQWA 1P1EA 3QIKA 1X5NA 2P3WA 3GJ9A 1TP5A 2MHOA 1W9QA 2YUBA 4K76A 2LC6A 2H3MA 1W9EA 1WH1A 4GVCA 2H3LA 2K1ZA 2ZPLA 2QKTA 1UITA 1UHPA 5HFDA 2BYGA 1WI2A 2FNEA 1LCYA 2OSGA 5E21A 2L97A 5A2PA 2EDZA 4KFVA 4L8NA 5B42A 5GLJA 4JOKA 1RY4A 1I16A 2PKUA 2QBWA 1UEWA 2V90A 1V6BA 1FC7A 2LUIA 1WI4A 1I92A 3CBZA 3K50A 1OBXA 3I1EA 2O2TA 1P1DA 3GABA 3SHWA 2I04A 3LNYA 4RI0A 5B6LA 4JOHA 4NNLA 4Q6SA 2IWOA 2DKRA 4HOPB 3WKLA 2QG1A 4G69A 1XZ9A 4REYA 3KDGA 3K1RA 3TSVA 1TP3A 2KOMA 3JXTA 1UFXA 3SFJA 4UU5A 1VCWA 3QE1A 4K72A 2KAWA 2KV8A 1QAVA 3QDOA 2KPKA 2FE5A 2I0IA 4JOJA 5FHTA 2ENOA 1GM1A 2EDPA 1TQ3A 1N7FA 1G9OA 5E1YA 4YYXA 2KPLA 4NMTA 1B8QA 2CSJA 3ID2A 3LNXA 5HFFA 2HE2A 3NGHA 1UM7A 2I4SA 4MPAA 2F5YA 2OPGA 2VZ5A 2HGAA 4NMOA 4FGMA 1M5ZA 1GQ5A 1Q3OA 4F8KA 1WG6A 3QGLA 2V1WA 5HJ1A 3OTPA 2KOHA 1WF8A 3R0HA 4OEOA 3CYYA 2W7RA 1OBZA 3KDKA 2EEHA 2QKVA 3BPUA 2UZCA 2I6VA 3GGEA 2EXGA 3SOEA 1W9OA 2EV8A 3CC0A 2M0UA 1MFGA 2KRGA 2EEGA 3ID3A 3PDVA 1Z86A 1X8SA 3AXAA 2Q9VA 2DLUA 4Q2PA 2GEFA 2KJDA 2W4FA 5G1EA 4Q2QA 1VJ6A 1V1TA 1Y8TA 2E7KA 3MH4A 3SUZA 2PNTA 1WFVA 1MFLA 4JL7A 1V5LA 2VPHA 5HFBA 1FCFA 1NF3C 1Q7XA 2AWXA 2R3YA 3MH7A 2VSVA 1UJUA 3GSLA 4H11A 3I4WA 4EDJA 3MH6A 1N6DA 3RL8A 3NFKA 2REYA 3DIWA 2LOBA 2OMJA 2EHRA 1SOZA 3TSWA 3ID4A 1UJVA 2JWEA 1R6JA 4WYUA 1RGRA 3VQGA 1UJDA 1PDRA 5HF1A 3NFLA 4E35A 5FB8C 1MC7A 3SHUA 2EEIA 2VRFA 4Q2OA 1N7TA 5D13A 2QT5A 1U39A 3CBXA 4O06A 1QAVB 4R2ZA 2R4HA 1RGWA 2AWUA 2D8IA 1U37A 2RRMA 2Z9IA 3R69A 4FLNA 1IU0A 2KA9A 3STJA 3E17A 2YT8A 2Q3GA 2Z17A 2YUYA 3RLEA 3PV5A 3PV2A 2OGPA 1FC9A 5E22A 3TSZA 5H3JA 3DJAA 3PDZA 1FC6A 3HPMA 2FN5A 3PV4A 1YBOA 1VB7A 3L4FD 1QAUA 2IWQA 2EAQA 4Z8JA 2L4TA 1V5QA 3K82A 5HEBA 1T2MA 1L6OA 2ZPMA 4Q3HA 2I1NA 2DMZA 1U38A 2EGOA 2DAZA 4Z33A 3ID1A 4NMPA 2M0ZA 2YT7A 1ZOKA 1BE9A 4N6XA 4OEPA 2PKTA 3ZRTA 4WYTA 2M10A 4P0CA 1U3BA 2GZVA 3I18A 4E34A 2OQSA 1UM1A 4XHVA 3GCOA 3GDSA 1Z87A 4NMSA 1KEFA 1D5GA 2KJKA 2VSPA 1VA8A 3KZDA 2I0LA 3PS4A 2OCSA 3O5NA 2JSNA 3TMHA 1Q3PA 1WHAA 2JILA 3KZEA 3DJ3A 1Y7NA 1QLCA 1UF1A 1K32A 1GQ4A 5EZ0A 2KYLA 1NTEA 4JORA 2KJPA 2D90A 2DM8A 3QJMA 1OBYA 2M0TA 4JOEA 2JOAA 5E11A 3OU0A 2JXOA 1SOTA 2EGKA 3EGHC 5DTHA 2EEJA 2M0VA 4E3BA 2D92A 3WKMA 2OS6A 1UEPA 2HE4A 1X9ZA 2OZFA
chains in the Genus database with same CATH topology
3NCVA 1X5RA 5F3XA 3CBYA 5I7ZA 1V62A 2K20A 2LA8A 4NMRA 3RL7A 4IC6A 4UU6A 4JJ0A 4Q2NA 2IWNA 2PZDA 2KG2A 2IWPA 2JINA 4KFWA 2KBSA 2JREA 2RCZA 1X6DA 3DORA 2EGNA 2H2BA 4YDPA 1IHJA 4LMMA 4OAJA 1WF7A 3CS0A 1TE0A 2KOJA 1N6EA 4JOPA 1ZUBA 4NXPA 4GHNA 2DB5A 3VQFA 3B76A 4NNMA 3GDUA 5G1DA 3QO6A 4K6YA 1OZIA 1UEQA 4HOPA 2DC2A 2AWWA 2QKUA 2PA1A 2G2LA 2M3MA 3HPKA 1N99A 2CSSA 4JJ3A 3CH8A 5HF4A 5GNDA 3GCNA 1N6FA 2CS5A 2KL1A 3DJ1A 4JOFA 5EYZA 1KY9A 1WIFA 2FCFA 3FY5A 2AINA 1X5QA 2X7ZA 5HFCA 2MX6A 4NMQA 1X45A 2JIKA 4NMVA 4K75A 1UEZA 2LC7A 3EGGC 5HEDA 2DLSA 2G5MB 4K78A 3HVQC 2EDVA 1WFGA 1KWAA 4Q6HA 4AMHA 1WHDA 4GVDA 4JOGA 5F67A 5IL9A 3KHFA 2H2CA 1N7EA 1IU2A 1BFEA 5HETA 5HEYA 3R68A 3QJNA 4P2AB 1RZXA 2F0AA 5HDYA 2VWRA 1VAEA 3GDVA 5E6PB 2EJYA 5JXBA 2L4SA 5HFEA 2WL7A 2YTWA 2PDZA 4NXRA 2KQFA 4NXQA 2DJTA 3O46A 5ILBA 1WJLA 4PQWA 1P1EA 3QIKA 1X5NA 2P3WA 3GJ9A 1TP5A 2MHOA 1W9QA 2YUBA 4K76A 2LC6A 2H3MA 1W9EA 1WH1A 4GVCA 2H3LA 2K1ZA 2ZPLA 2QKTA 1UITA 1UHPA 5HFDA 2BYGA 1WI2A 2FNEA 1LCYA 2OSGA 5E21A 2L97A 5A2PA 2EDZA 4KFVA 4L8NA 5B42A 5GLJA 4JOKA 1RY4A 1I16A 2PKUA 2QBWA 1UEWA 2V90A 1V6BA 1FC7A 2LUIA 1WI4A 1I92A 3CBZA 3K50A 1OBXA 3I1EA 2O2TA 1P1DA 3GABA 3SHWA 2I04A 3LNYA 4RI0A 5B6LA 4JOHA 4NNLA 4Q6SA 2IWOA 2DKRA 4HOPB 3WKLA 2QG1A 4G69A 1XZ9A 4REYA 3KDGA 3K1RA 3TSVA 1TP3A 2KOMA 3JXTA 1UFXA 3SFJA 4UU5A 1VCWA 3QE1A 4K72A 2KAWA 2KV8A 1QAVA 3QDOA 2KPKA 2FE5A 2I0IA 4JOJA 5FHTA 2ENOA 1GM1A 2EDPA 1TQ3A 1N7FA 1G9OA 5E1YA 4YYXA 2KPLA 4NMTA 1B8QA 2CSJA 3ID2A 3LNXA 5HFFA 2HE2A 3NGHA 1UM7A 2I4SA 4MPAA 2F5YA 2OPGA 2VZ5A 2HGAA 4NMOA 4FGMA 1M5ZA 1GQ5A 1Q3OA 4F8KA 1WG6A 3QGLA 2V1WA 5HJ1A 3OTPA 2KOHA 1WF8A 3R0HA 4OEOA 3CYYA 2W7RA 1OBZA 3KDKA 2EEHA 2QKVA 3BPUA 2UZCA 2I6VA 3GGEA 2EXGA 3SOEA 1W9OA 2EV8A 3CC0A 2M0UA 1MFGA 2KRGA 2EEGA 3ID3A 3PDVA 1Z86A 1X8SA 3AXAA 2Q9VA 2DLUA 4Q2PA 2GEFA 2KJDA 2W4FA 5G1EA 4Q2QA 1VJ6A 1V1TA 1Y8TA 2E7KA 3MH4A 3SUZA 2PNTA 1WFVA 1MFLA 4JL7A 1V5LA 2VPHA 5HFBA 1FCFA 1NF3C 1Q7XA 2AWXA 2R3YA 3MH7A 2VSVA 1UJUA 3GSLA 4H11A 3I4WA 4EDJA 3MH6A 1N6DA 3RL8A 3NFKA 2REYA 3DIWA 2LOBA 2OMJA 2EHRA 1SOZA 3TSWA 3ID4A 1UJVA 2JWEA 1R6JA 4WYUA 1RGRA 3VQGA 1UJDA 1PDRA 5HF1A 3NFLA 4E35A 5FB8C 1MC7A 3SHUA 2EEIA 2VRFA 4Q2OA 1N7TA 5D13A 2QT5A 1U39A 3CBXA 4O06A 1QAVB 4R2ZA 2R4HA 1RGWA 2AWUA 2D8IA 1U37A 2RRMA 2Z9IA 3R69A 4FLNA 1IU0A 2KA9A 3STJA 3E17A 2YT8A 2Q3GA 2Z17A 2YUYA 3RLEA 3PV5A 3PV2A 2OGPA 1FC9A 5E22A 3TSZA 5H3JA 3DJAA 3PDZA 1FC6A 3HPMA 2FN5A 3PV4A 1YBOA 1VB7A 3L4FD 1QAUA 2IWQA 2EAQA 4Z8JA 2L4TA 1V5QA 3K82A 5HEBA 1T2MA 1L6OA 2ZPMA 4Q3HA 2I1NA 2DMZA 1U38A 2EGOA 2DAZA 4Z33A 3ID1A 4NMPA 2M0ZA 2YT7A 1ZOKA 1BE9A 4N6XA 4OEPA 2PKTA 3ZRTA 4WYTA 2M10A 4P0CA 1U3BA 2GZVA 3I18A 4E34A 2OQSA 1UM1A 4XHVA 3GCOA 3GDSA 1Z87A 4NMSA 1KEFA 1D5GA 2KJKA 2VSPA 1VA8A 3KZDA 2I0LA 3PS4A 2OCSA 3O5NA 2JSNA 3TMHA 1Q3PA 1WHAA 2JILA 3KZEA 3DJ3A 1Y7NA 1QLCA 1UF1A 1K32A 1GQ4A 5EZ0A 2KYLA 1NTEA 4JORA 2KJPA 2D90A 2DM8A 3QJMA 1OBYA 2M0TA 4JOEA 2JOAA 5E11A 3OU0A 2JXOA 1SOTA 2EGKA 3EGHC 5DTHA 2EEJA 2M0VA 4E3BA 2D92A 3WKMA 2OS6A 1UEPA 2HE4A 1X9ZA 2OZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5R A;  5F3X A;  3CBY A;  5I7Z A;  1V62 A;  2K20 A;  2LA8 A;  4NMR A;  3RL7 A;  4IC6 A;  4UU6 A;  4Q2N A;  2IWN A;  2PZD A;  2KG2 A;  2IWP A;  2JIN A;  4KFW A;  2KBS A;  2JRE A;  2RCZ A;  1X6D A;  3DOR A;  2EGN A;  2H2B A;  4YDP A;  1IHJ A;  4LMM A;  4OAJ A;  1WF7 A;  3CS0 A;  1TE0 A;  2KOJ A;  1N6E A;  4JOP A;  1ZUB A;  4NXP A;  4GHN A;  2DB5 A;  3VQF A;  3B76 A;  4NNM A;  3GDU A;  5G1D A;  3QO6 A;  4K6Y A;  1OZI A;  1UEQ A;  4HOP A;  2DC2 A;  2AWW A;  2QKU A;  2PA1 A;  2G2L A;  2M3M A;  3HPK A;  1N99 A;  2CSS A;  3CH8 A;  5HF4 A;  5GND A;  3GCN A;  1N6F A;  2CS5 A;  2KL1 A;  3DJ1 A;  4JOF A;  5EYZ A;  1KY9 A;  1WIF A;  2FCF A;  3FY5 A;  2AIN A;  1X5Q A;  2X7Z A;  5HFC A;  2MX6 A;  4NMQ A;  1X45 A;  2JIK A;  4NMV A;  4K75 A;  1UEZ A;  2LC7 A;  3EGG C;  5HED A;  2DLS A;  2G5M B;  4K78 A;  3HVQ C;  2EDV A;  1WFG A;  1KWA A;  4Q6H A;  4AMH A;  1WHD A;  4GVD A;  4JOG A;  5F67 A;  3KHF A;  2H2C A;  1N7E A;  1IU2 A;  1BFE A;  5HET A;  5HEY A;  3R68 A;  3QJN A;  4P2A B;  1RZX A;  2F0A A;  5HDY A;  2VWR A;  1VAE A;  3GDV A;  5E6P B;  2EJY A;  5JXB A;  2L4S A;  5HFE A;  2WL7 A;  2YTW A;  2PDZ A;  4NXR A;  2KQF A;  4NXQ A;  2DJT A;  3O46 A;  1WJL A;  4PQW A;  1P1E A;  3QIK A;  1X5N A;  2P3W A;  3GJ9 A;  1TP5 A;  2MHO A;  1W9Q A;  2YUB A;  4K76 A;  2LC6 A;  2H3M A;  1W9E A;  1WH1 A;  4GVC A;  2H3L A;  2K1Z A;  2ZPL A;  2QKT A;  1UIT A;  1UHP A;  5HFD A;  2BYG A;  1WI2 A;  2FNE A;  1LCY A;  2OSG A;  5E21 A;  2L97 A;  5A2P A;  2EDZ A;  4KFV A;  4L8N A;  5GLJ A;  4JOK A;  1RY4 A;  1I16 A;  2PKU A;  2QBW A;  1UEW A;  2V90 A;  1V6B A;  1FC7 A;  2LUI A;  1WI4 A;  1I92 A;  3CBZ A;  3K50 A;  1OBX A;  3I1E A;  2O2T A;  1P1D A;  3SHW A;  2I04 A;  3LNY A;  4RI0 A;  5B6L A;  4JOH A;  4NNL A;  4Q6S A;  2IWO A;  2DKR A;  4HOP B;  3WKL A;  2QG1 A;  4G69 A;  1XZ9 A;  4REY A;  3K1R A;  3TSV A;  1TP3 A;  2KOM A;  3JXT A;  1UFX A;  3SFJ A;  4UU5 A;  1VCW A;  3QE1 A;  4K72 A;  2KAW A;  2KV8 A;  1QAV A;  3QDO A;  2KPK A;  2FE5 A;  2I0I A;  4JOJ A;  5FHT A;  2ENO A;  1GM1 A;  2EDP A;  1TQ3 A;  1N7F A;  1G9O A;  5E1Y A;  4YYX A;  2KPL A;  4NMT A;  1B8Q A;  2CSJ A;  3ID2 A;  3LNX A;  5HFF A;  2HE2 A;  3NGH A;  1UM7 A;  2I4S A;  4MPA A;  2F5Y A;  2OPG A;  2VZ5 A;  2HGA A;  4NMO A;  4FGM A;  1M5Z A;  1GQ5 A;  1Q3O A;  4F8K A;  1WG6 A;  3QGL A;  2V1W A;  5HJ1 A;  3OTP A;  2KOH A;  1WF8 A;  3R0H A;  4OEO A;  3CYY A;  2W7R A;  1OBZ A;  2EEH A;  2QKV A;  3BPU A;  2UZC A;  2I6V A;  3GGE A;  2EXG A;  3SOE A;  1W9O A;  2EV8 A;  3CC0 A;  2M0U A;  1MFG A;  2KRG A;  2EEG A;  3ID3 A;  3PDV A;  1Z86 A;  1X8S A;  3AXA A;  2Q9V A;  2DLU A;  4Q2P A;  2KJD A;  2W4F A;  5G1E A;  4Q2Q A;  1VJ6 A;  1V1T A;  1Y8T A;  2E7K A;  3MH4 A;  3SUZ A;  2PNT A;  1WFV A;  1MFL A;  4JL7 A;  1V5L A;  2VPH A;  5HFB A;  1FCF A;  1NF3 C;  1Q7X A;  2AWX A;  2R3Y A;  3MH7 A;  2VSV A;  1UJU A;  3GSL A;  4H11 A;  3I4W A;  4EDJ A;  3MH6 A;  1N6D A;  3RL8 A;  3NFK A;  2REY A;  3DIW A;  2LOB A;  2OMJ A;  2EHR A;  1SOZ A;  3TSW A;  3ID4 A;  1UJV A;  2JWE A;  1R6J A;  4WYU A;  1RGR A;  3VQG A;  1UJD A;  1PDR A;  5HF1 A;  3NFL A;  4E35 A;  5FB8 C;  1MC7 A;  3SHU A;  2EEI A;  2VRF A;  4Q2O A;  1N7T A;  5D13 A;  2QT5 A;  1U39 A;  3CBX A;  4O06 A;  1QAV B;  4R2Z A;  2R4H A;  1RGW A;  2AWU A;  2D8I A;  1U37 A;  2RRM A;  2Z9I A;  3R69 A;  1IU0 A;  2KA9 A;  3STJ A;  3E17 A;  2YT8 A;  2Q3G A;  2Z17 A;  2YUY A;  3RLE A;  3PV5 A;  3PV2 A;  2OGP A;  1FC9 A;  5E22 A;  3TSZ A;  5H3J A;  3DJA A;  3PDZ A;  1FC6 A;  3HPM A;  2FN5 A;  3PV4 A;  1YBO A;  1VB7 A;  3L4F D;  1QAU A;  2IWQ A;  2EAQ A;  4Z8J A;  2L4T A;  1V5Q A;  3K82 A;  5HEB A;  1T2M A;  1L6O A;  2ZPM A;  4Q3H A;  2I1N A;  2DMZ A;  1U38 A;  2EGO A;  2DAZ A;  4Z33 A;  3ID1 A;  4NMP A;  2M0Z A;  2YT7 A;  1ZOK A;  1BE9 A;  4N6X A;  4OEP A;  2PKT A;  3ZRT A;  4WYT A;  2M10 A;  4P0C A;  1U3B A;  2GZV A;  3I18 A;  4E34 A;  2OQS A;  1UM1 A;  4XHV A;  3GCO A;  3GDS A;  1Z87 A;  4NMS A;  1KEF A;  1D5G A;  2KJK A;  2VSP A;  1VA8 A;  3KZD A;  2I0L A;  3PS4 A;  2OCS A;  3O5N A;  3TMH A;  1Q3P A;  1WHA A;  2JIL A;  3KZE A;  3DJ3 A;  1Y7N A;  1QLC A;  1UF1 A;  1K32 A;  1GQ4 A;  5EZ0 A;  2KYL A;  1NTE A;  4JOR A;  2KJP A;  2D90 A;  2DM8 A;  3QJM A;  1OBY A;  2M0T A;  4JOE A;  2JOA A;  5E11 A;  3OU0 A;  2JXO A;  1SOT A;  2EGK A;  3EGH C;  5DTH A;  2EEJ A;  2M0V A;  4E3B A;  2D92 A;  3WKM A;  2OS6 A;  1UEP A;  2HE4 A;  2OZF A; 
#chains in the Genus database with same CATH topology
 3NCV A;  1X5R A;  5F3X A;  3CBY A;  5I7Z A;  1V62 A;  2K20 A;  2LA8 A;  4NMR A;  3RL7 A;  4IC6 A;  4UU6 A;  4JJ0 A;  4Q2N A;  2IWN A;  2PZD A;  2KG2 A;  2IWP A;  2JIN A;  4KFW A;  2KBS A;  2JRE A;  2RCZ A;  1X6D A;  3DOR A;  2EGN A;  2H2B A;  4YDP A;  1IHJ A;  4LMM A;  4OAJ A;  1WF7 A;  3CS0 A;  1TE0 A;  2KOJ A;  1N6E A;  4JOP A;  1ZUB A;  4NXP A;  4GHN A;  2DB5 A;  3VQF A;  3B76 A;  4NNM A;  3GDU A;  5G1D A;  3QO6 A;  4K6Y A;  1OZI A;  1UEQ A;  4HOP A;  2DC2 A;  2AWW A;  2QKU A;  2PA1 A;  2G2L A;  2M3M A;  3HPK A;  1N99 A;  2CSS A;  4JJ3 A;  3CH8 A;  5HF4 A;  5GND A;  3GCN A;  1N6F A;  2CS5 A;  2KL1 A;  3DJ1 A;  4JOF A;  5EYZ A;  1KY9 A;  1WIF A;  2FCF A;  3FY5 A;  2AIN A;  1X5Q A;  2X7Z A;  5HFC A;  2MX6 A;  4NMQ A;  1X45 A;  2JIK A;  4NMV A;  4K75 A;  1UEZ A;  2LC7 A;  3EGG C;  5HED A;  2DLS A;  2G5M B;  4K78 A;  3HVQ C;  2EDV A;  1WFG A;  1KWA A;  4Q6H A;  4AMH A;  1WHD A;  4GVD A;  4JOG A;  5F67 A;  5IL9 A;  3KHF A;  2H2C A;  1N7E A;  1IU2 A;  1BFE A;  5HET A;  5HEY A;  3R68 A;  3QJN A;  4P2A B;  1RZX A;  2F0A A;  5HDY A;  2VWR A;  1VAE A;  3GDV A;  5E6P B;  2EJY A;  5JXB A;  2L4S A;  5HFE A;  2WL7 A;  2YTW A;  2PDZ A;  4NXR A;  2KQF A;  4NXQ A;  2DJT A;  3O46 A;  5ILB A;  1WJL A;  4PQW A;  1P1E A;  3QIK A;  1X5N A;  2P3W A;  3GJ9 A;  1TP5 A;  2MHO A;  1W9Q A;  2YUB A;  4K76 A;  2LC6 A;  2H3M A;  1W9E A;  1WH1 A;  4GVC A;  2H3L A;  2K1Z A;  2ZPL A;  2QKT A;  1UIT A;  1UHP A;  5HFD A;  2BYG A;  1WI2 A;  2FNE A;  1LCY A;  2OSG A;  5E21 A;  2L97 A;  5A2P A;  2EDZ A;  4KFV A;  4L8N A;  5B42 A;  5GLJ A;  4JOK A;  1RY4 A;  1I16 A;  2PKU A;  2QBW A;  1UEW A;  2V90 A;  1V6B A;  1FC7 A;  2LUI A;  1WI4 A;  1I92 A;  3CBZ A;  3K50 A;  1OBX A;  3I1E A;  2O2T A;  1P1D A;  3GAB A;  3SHW A;  2I04 A;  3LNY A;  4RI0 A;  5B6L A;  4JOH A;  4NNL A;  4Q6S A;  2IWO A;  2DKR A;  4HOP B;  3WKL A;  2QG1 A;  4G69 A;  1XZ9 A;  4REY A;  3KDG A;  3K1R A;  3TSV A;  1TP3 A;  2KOM A;  3JXT A;  1UFX A;  3SFJ A;  4UU5 A;  1VCW A;  3QE1 A;  4K72 A;  2KAW A;  2KV8 A;  1QAV A;  3QDO A;  2KPK A;  2FE5 A;  2I0I A;  4JOJ A;  5FHT A;  2ENO A;  1GM1 A;  2EDP A;  1TQ3 A;  1N7F A;  1G9O A;  5E1Y A;  4YYX A;  2KPL A;  4NMT A;  1B8Q A;  2CSJ A;  3ID2 A;  3LNX A;  5HFF A;  2HE2 A;  3NGH A;  1UM7 A;  2I4S A;  4MPA A;  2F5Y A;  2OPG A;  2VZ5 A;  2HGA A;  4NMO A;  4FGM A;  1M5Z A;  1GQ5 A;  1Q3O A;  4F8K A;  1WG6 A;  3QGL A;  2V1W A;  5HJ1 A;  3OTP A;  2KOH A;  1WF8 A;  3R0H A;  4OEO A;  3CYY A;  2W7R A;  1OBZ A;  3KDK A;  2EEH A;  2QKV A;  3BPU A;  2UZC A;  2I6V A;  3GGE A;  2EXG A;  3SOE A;  1W9O A;  2EV8 A;  3CC0 A;  2M0U A;  1MFG A;  2KRG A;  2EEG A;  3ID3 A;  3PDV A;  1Z86 A;  1X8S A;  3AXA A;  2Q9V A;  2DLU A;  4Q2P A;  2GEF A;  2KJD A;  2W4F A;  5G1E A;  4Q2Q A;  1VJ6 A;  1V1T A;  1Y8T A;  2E7K A;  3MH4 A;  3SUZ A;  2PNT A;  1WFV A;  1MFL A;  4JL7 A;  1V5L A;  2VPH A;  5HFB A;  1FCF A;  1NF3 C;  1Q7X A;  2AWX A;  2R3Y A;  3MH7 A;  2VSV A;  1UJU A;  3GSL A;  4H11 A;  3I4W A;  4EDJ A;  3MH6 A;  1N6D A;  3RL8 A;  3NFK A;  2REY A;  3DIW A;  2LOB A;  2OMJ A;  2EHR A;  1SOZ A;  3TSW A;  3ID4 A;  1UJV A;  2JWE A;  1R6J A;  4WYU A;  1RGR A;  3VQG A;  1UJD A;  1PDR A;  5HF1 A;  3NFL A;  4E35 A;  5FB8 C;  1MC7 A;  3SHU A;  2EEI A;  2VRF A;  4Q2O A;  1N7T A;  5D13 A;  2QT5 A;  1U39 A;  3CBX A;  4O06 A;  1QAV B;  4R2Z A;  2R4H A;  1RGW A;  2AWU A;  2D8I A;  1U37 A;  2RRM A;  2Z9I A;  3R69 A;  4FLN A;  1IU0 A;  2KA9 A;  3STJ A;  3E17 A;  2YT8 A;  2Q3G A;  2Z17 A;  2YUY A;  3RLE A;  3PV5 A;  3PV2 A;  2OGP A;  1FC9 A;  5E22 A;  3TSZ A;  5H3J A;  3DJA A;  3PDZ A;  1FC6 A;  3HPM A;  2FN5 A;  3PV4 A;  1YBO A;  1VB7 A;  3L4F D;  1QAU A;  2IWQ A;  2EAQ A;  4Z8J A;  2L4T A;  1V5Q A;  3K82 A;  5HEB A;  1T2M A;  1L6O A;  2ZPM A;  4Q3H A;  2I1N A;  2DMZ A;  1U38 A;  2EGO A;  2DAZ A;  4Z33 A;  3ID1 A;  4NMP A;  2M0Z A;  2YT7 A;  1ZOK A;  1BE9 A;  4N6X A;  4OEP A;  2PKT A;  3ZRT A;  4WYT A;  2M10 A;  4P0C A;  1U3B A;  2GZV A;  3I18 A;  4E34 A;  2OQS A;  1UM1 A;  4XHV A;  3GCO A;  3GDS A;  1Z87 A;  4NMS A;  1KEF A;  1D5G A;  2KJK A;  2VSP A;  1VA8 A;  3KZD A;  2I0L A;  3PS4 A;  2OCS A;  3O5N A;  2JSN A;  3TMH A;  1Q3P A;  1WHA A;  2JIL A;  3KZE A;  3DJ3 A;  1Y7N A;  1QLC A;  1UF1 A;  1K32 A;  1GQ4 A;  5EZ0 A;  2KYL A;  1NTE A;  4JOR A;  2KJP A;  2D90 A;  2DM8 A;  3QJM A;  1OBY A;  2M0T A;  4JOE A;  2JOA A;  5E11 A;  3OU0 A;  2JXO A;  1SOT A;  2EGK A;  3EGH C;  5DTH A;  2EEJ A;  2M0V A;  4E3B A;  2D92 A;  3WKM A;  2OS6 A;  1UEP A;  2HE4 A;  1X9Z A;  2OZF A; 
#chains in the Genus database with same CATH homology
 3NCV A;  1X5R A;  5F3X A;  3CBY A;  5I7Z A;  1V62 A;  2K20 A;  2LA8 A;  4NMR A;  3RL7 A;  4IC6 A;  4UU6 A;  4JJ0 A;  4Q2N A;  2IWN A;  2PZD A;  2KG2 A;  2IWP A;  2JIN A;  4KFW A;  2KBS A;  2JRE A;  2RCZ A;  1X6D A;  3DOR A;  2EGN A;  2H2B A;  4YDP A;  1IHJ A;  4LMM A;  4OAJ A;  1WF7 A;  3CS0 A;  1TE0 A;  2KOJ A;  1N6E A;  4JOP A;  1ZUB A;  4NXP A;  4GHN A;  2DB5 A;  3VQF A;  3B76 A;  4NNM A;  3GDU A;  5G1D A;  3QO6 A;  4K6Y A;  1OZI A;  1UEQ A;  4HOP A;  2DC2 A;  2AWW A;  2QKU A;  2PA1 A;  2G2L A;  2M3M A;  3HPK A;  1N99 A;  2CSS A;  4JJ3 A;  3CH8 A;  5HF4 A;  5GND A;  3GCN A;  1N6F A;  2CS5 A;  2KL1 A;  3DJ1 A;  4JOF A;  5EYZ A;  1KY9 A;  1WIF A;  2FCF A;  3FY5 A;  2AIN A;  1X5Q A;  2X7Z A;  5HFC A;  2MX6 A;  4NMQ A;  1X45 A;  2JIK A;  4NMV A;  4K75 A;  1UEZ A;  2LC7 A;  3EGG C;  5HED A;  2DLS A;  2G5M B;  4K78 A;  3HVQ C;  2EDV A;  1WFG A;  1KWA A;  4Q6H A;  4AMH A;  1WHD A;  4GVD A;  4JOG A;  5F67 A;  5IL9 A;  3KHF A;  2H2C A;  1N7E A;  1IU2 A;  1BFE A;  5HET A;  5HEY A;  3R68 A;  3QJN A;  4P2A B;  1RZX A;  2F0A A;  5HDY A;  2VWR A;  1VAE A;  3GDV A;  5E6P B;  2EJY A;  5JXB A;  2L4S A;  5HFE A;  2WL7 A;  2YTW A;  2PDZ A;  4NXR A;  2KQF A;  4NXQ A;  2DJT A;  3O46 A;  5ILB A;  1WJL A;  4PQW A;  1P1E A;  3QIK A;  1X5N A;  2P3W A;  3GJ9 A;  1TP5 A;  2MHO A;  1W9Q A;  2YUB A;  4K76 A;  2LC6 A;  2H3M A;  1W9E A;  1WH1 A;  4GVC A;  2H3L A;  2K1Z A;  2ZPL A;  2QKT A;  1UIT A;  1UHP A;  5HFD A;  2BYG A;  1WI2 A;  2FNE A;  1LCY A;  2OSG A;  5E21 A;  2L97 A;  5A2P A;  2EDZ A;  4KFV A;  4L8N A;  5B42 A;  5GLJ A;  4JOK A;  1RY4 A;  1I16 A;  2PKU A;  2QBW A;  1UEW A;  2V90 A;  1V6B A;  1FC7 A;  2LUI A;  1WI4 A;  1I92 A;  3CBZ A;  3K50 A;  1OBX A;  3I1E A;  2O2T A;  1P1D A;  3GAB A;  3SHW A;  2I04 A;  3LNY A;  4RI0 A;  5B6L A;  4JOH A;  4NNL A;  4Q6S A;  2IWO A;  2DKR A;  4HOP B;  3WKL A;  2QG1 A;  4G69 A;  1XZ9 A;  4REY A;  3KDG A;  3K1R A;  3TSV A;  1TP3 A;  2KOM A;  3JXT A;  1UFX A;  3SFJ A;  4UU5 A;  1VCW A;  3QE1 A;  4K72 A;  2KAW A;  2KV8 A;  1QAV A;  3QDO A;  2KPK A;  2FE5 A;  2I0I A;  4JOJ A;  5FHT A;  2ENO A;  1GM1 A;  2EDP A;  1TQ3 A;  1N7F A;  1G9O A;  5E1Y A;  4YYX A;  2KPL A;  4NMT A;  1B8Q A;  2CSJ A;  3ID2 A;  3LNX A;  5HFF A;  2HE2 A;  3NGH A;  1UM7 A;  2I4S A;  4MPA A;  2F5Y A;  2OPG A;  2VZ5 A;  2HGA A;  4NMO A;  4FGM A;  1M5Z A;  1GQ5 A;  1Q3O A;  4F8K A;  1WG6 A;  3QGL A;  2V1W A;  5HJ1 A;  3OTP A;  2KOH A;  1WF8 A;  3R0H A;  4OEO A;  3CYY A;  2W7R A;  1OBZ A;  3KDK A;  2EEH A;  2QKV A;  3BPU A;  2UZC A;  2I6V A;  3GGE A;  2EXG A;  3SOE A;  1W9O A;  2EV8 A;  3CC0 A;  2M0U A;  1MFG A;  2KRG A;  2EEG A;  3ID3 A;  3PDV A;  1Z86 A;  1X8S A;  3AXA A;  2Q9V A;  2DLU A;  4Q2P A;  2GEF A;  2KJD A;  2W4F A;  5G1E A;  4Q2Q A;  1VJ6 A;  1V1T A;  1Y8T A;  2E7K A;  3MH4 A;  3SUZ A;  2PNT A;  1WFV A;  1MFL A;  4JL7 A;  1V5L A;  2VPH A;  5HFB A;  1FCF A;  1NF3 C;  1Q7X A;  2AWX A;  2R3Y A;  3MH7 A;  2VSV A;  1UJU A;  3GSL A;  4H11 A;  3I4W A;  4EDJ A;  3MH6 A;  1N6D A;  3RL8 A;  3NFK A;  2REY A;  3DIW A;  2LOB A;  2OMJ A;  2EHR A;  1SOZ A;  3TSW A;  3ID4 A;  1UJV A;  2JWE A;  1R6J A;  4WYU A;  1RGR A;  3VQG A;  1UJD A;  1PDR A;  5HF1 A;  3NFL A;  4E35 A;  5FB8 C;  1MC7 A;  3SHU A;  2EEI A;  2VRF A;  4Q2O A;  1N7T A;  5D13 A;  2QT5 A;  1U39 A;  3CBX A;  4O06 A;  1QAV B;  4R2Z A;  2R4H A;  1RGW A;  2AWU A;  2D8I A;  1U37 A;  2RRM A;  2Z9I A;  3R69 A;  4FLN A;  1IU0 A;  2KA9 A;  3STJ A;  3E17 A;  2YT8 A;  2Q3G A;  2Z17 A;  2YUY A;  3RLE A;  3PV5 A;  3PV2 A;  2OGP A;  1FC9 A;  5E22 A;  3TSZ A;  5H3J A;  3DJA A;  3PDZ A;  1FC6 A;  3HPM A;  2FN5 A;  3PV4 A;  1YBO A;  1VB7 A;  3L4F D;  1QAU A;  2IWQ A;  2EAQ A;  4Z8J A;  2L4T A;  1V5Q A;  3K82 A;  5HEB A;  1T2M A;  1L6O A;  2ZPM A;  4Q3H A;  2I1N A;  2DMZ A;  1U38 A;  2EGO A;  2DAZ A;  4Z33 A;  3ID1 A;  4NMP A;  2M0Z A;  2YT7 A;  1ZOK A;  1BE9 A;  4N6X A;  4OEP A;  2PKT A;  3ZRT A;  4WYT A;  2M10 A;  4P0C A;  1U3B A;  2GZV A;  3I18 A;  4E34 A;  2OQS A;  1UM1 A;  4XHV A;  3GCO A;  3GDS A;  1Z87 A;  4NMS A;  1KEF A;  1D5G A;  2KJK A;  2VSP A;  1VA8 A;  3KZD A;  2I0L A;  3PS4 A;  2OCS A;  3O5N A;  2JSN A;  3TMH A;  1Q3P A;  1WHA A;  2JIL A;  3KZE A;  3DJ3 A;  1Y7N A;  1QLC A;  1UF1 A;  1K32 A;  1GQ4 A;  5EZ0 A;  2KYL A;  1NTE A;  4JOR A;  2KJP A;  2D90 A;  2DM8 A;  3QJM A;  1OBY A;  2M0T A;  4JOE A;  2JOA A;  5E11 A;  3OU0 A;  2JXO A;  1SOT A;  2EGK A;  3EGH C;  5DTH A;  2EEJ A;  2M0V A;  4E3B A;  2D92 A;  3WKM A;  2OS6 A;  1UEP A;  2HE4 A;  1X9Z A;  2OZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...