4K78A

Cftr associated ligand (cal) e317a pdz domain bound to peptide ical36-qdtrl (ansrwqdtrl)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
86
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISAIHPGQPADRGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein/protein binding
total genus 19
structure length 86
sequence length 87
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4k78A00
1OZIA 3OU0A 2VZ5A 3RL7A 4JOGA 2JXOA 1BE9A 2I0LA 2HE4A 4JOEA 2EJYA 1UFXA 1TP3A 2KOMA 2OS6A 2KL1A 3QGLA 2OGPA 2OSGA 2FE5A 1P1DA 4REYA 1L6OA 1TE0A 5HJ1A 4NMPA 3RLEA 1GQ4A 2YT8A 4P2AB 2M10A 3QJMA 1UEPA 1Q3OA 1Y7NA 2PKUA 1N6DA 2LA8A 2KPKA 2EGOA 2JILA 2REYA 2MHOA 2H2CA 4GVDA 1UHPA 3ID3A 1Q3PA 4XHVA 1WF7A 3CS0A 1YBOA 2PZDA 4JOPA 4P0CA 2QBWA 2IWPA 4L8NA 2JREA 2EDZA 3QE1A 1QAUA 1Y8TA 2FNEA 2I4SA 2I04A 2X7ZA 4NXRA 1R6JA 1RY4A 1I92A 2M3MA 3STJA 3GDUA 2DLSA 1FCFA 5HDYA 1FC7A 2O2TA 2M0VA 1VCWA 1Z86A 4HOPA 2EHRA 3OTPA 2QG1A 1Q7XA 2KOHA 4Q2PA 5HFCA 5A2PA 3BPUA 3CBXA 1OBZA 5H3JA 1WIFA 4NXQA 1MFGA 2W7RA 1N6FA 3QO6A 1TP5A 2I6VA 3CH8A 5E22A 4WYUA 3MH4A 5HETA 2QKTA 2QKVA 1T2MA 2MX6A 3TSVA 2YUYA 1U38A 3GDSA 4JOKA 1UEWA 1B8QA 3EGGC 4KFWA 1N7EA 1U39A 3O5NA 1UJDA 1X5RA 4O06A 1WHAA 3SUZA 2AINA 1W9EA 1V5LA 2KOJA 4JORA 1ZUBA 1GM1A 1SOTA 1QAVB 2W4FA 2L97A 4NMOA 1SOZA 1X6DA 3DORA 4MPAA 2HE2A 2EEHA 4Q6HA 1N7TA 3CC0A 2DJTA 2OMJA 1VJ6A 3K50A 2ZPLA 3NGHA 1ZOKA 3PV5A 1UEQA 3TMHA 1WI4A 1KY9A 1X45A 2LOBA 2PA1A 1KEFA 3PV2A 3CBYA 1X8SA 3ID4A 5HF1A 2OZFA 1V62A 4NMVA 3GCNA 3TSWA 1XZ9A 1MFLA 3GGEA 2PDZA 2IWQA 2EV8A 1WH1A 3SFJA 3L4FD 3MH6A 4E34A 5HFDA 2KA9A 2OPGA 2G2LA 4R2ZA 5I7ZA 1UJVA 1WFGA 1RZXA 2Z9IA 5B6LA 2PNTA 2D92A 2GZVA 2VSPA 2VWRA 3DJ3A 3K82A 1MC7A 2QT5A 2Q3GA 4K78A 4YYXA 4HOPB 3CBZA 2LC6A 2DKRA 5EYZA 1V6BA 4K6YA 2Z17A 1X5NA 1WHDA 4OEOA 2DLUA 1FC9A 2AWUA 1PDRA 3DIWA 2H3MA 1UF1A 5EZ0A 2JWEA 4E3BA 1IU0A 3QIKA 4JL7A 3KZDA 3O46A 4NMQA 2DC2A 3QJNA 4GHNA 2FCFA 2V1WA 4E35A 2D8IA 3GJ9A 4NMRA 4Q3HA 4WYTA 1BFEA 2H2BA 1UM1A 2KAWA 3PDZA 3R68A 3VQFA 3WKLA 4PQWA 2KJDA 5G1DA 2M0TA 2EDPA 4GVCA 5DTHA 5HEYA 4Z33A 5JXBA 3LNYA 2CSSA 2E7KA 3ID1A 4Q6SA 2R4HA 3LNXA 4FGMA 5G1EA 2WL7A 1RGWA 4JOJA 3JXTA 2KRGA 2KV8A 2OCSA 2ENOA 4OEPA 2I0IA 2L4SA 1UITA 2IWNA 2EGNA 3KHFA 4F8KA 3R0HA 2JINA 1UEZA 3K1RA 4UU5A 4Z8JA 2VPHA 4YDPA 2VRFA 3E17A 4OAJA 5E11A 4G69A 1G9OA 5HF4A 2CS5A 5HEDA 1TQ3A 3DJAA 2PKTA 2HGAA 2P3WA 2KYLA 2I1NA 2KJKA 2H3LA 1X5QA 5FB8C 3VQGA 2DMZA 1IU2A 1WI2A 2EEIA 4H11A 2OQSA 3B76A 1W9OA 1WF8A 3KZEA 3PS4A 2KQFA 4K76A 4NNLA 1QLCA 2EAQA 1IHJA 3SHWA 2QKUA 2K20A 2LUIA 2IWOA 4AMHA 5HFEA 5FHTA 3GCOA 3I18A 3PV4A 3SHUA 2BYGA 1VA8A 3GDVA 3I1EA 4EDJA 3HVQC 2KPLA 2RRMA 2DM8A 2M0ZA 4NMTA 1NF3C 5D13A 2EGKA 1N6EA 2UZCA 2ZPMA 4N6XA 1U3BA 1M5ZA 4UU6A 1LCYA 2DB5A 4JOHA 5HFBA 2L4TA 1W9QA 2AWXA 2D90A 1RGRA 2JOAA 5E6PB 4Q2NA 2K1ZA 4NMSA 2F0AA 1OBYA 3CYYA 1N99A 2R3YA 3EGHC 2LC7A 4JOFA 1WJLA 2YUBA 2RCZA 1WFVA 1UJUA 3I4WA 2CSJA 4NXPA 1N7FA 4Q2OA 3FY5A 5HFFA 2YT7A 3AXAA 4LMMA 2AWWA 4IC6A 2VSVA 3NFKA 3QDOA 2KBSA 2FN5A 3ID2A 5E1YA 2EEJA 2V90A 1V1TA 2KJPA 5F67A 2YTWA 5GLJA 1I16A 3HPMA 4NNMA 4RI0A 3ZRTA 5GNDA 3R69A 2DAZA 4K72A 1OBXA 3RL8A 3TSZA 1GQ5A 2F5YA 1Z87A 3SOEA 1VAEA 4KFVA 2EDVA 1V5QA 1WG6A 2G5MB 3DJ1A 1K32A 3HPKA 3WKMA 3GSLA 1NTEA 2KG2A 1UM7A 2EEGA 1QAVA 3NFLA 3PDVA 3MH7A 2JIKA 4Q2QA 5HEBA 5E21A 1D5GA 5F3XA 1KWAA 1U37A 1VB7A 1FC6A 2Q9VA 4K75A 2EXGA 1P1EA 2M0UA
chains in the Genus database with same CATH superfamily
1OZIA 3OU0A 2VZ5A 3RL7A 4JOGA 2JXOA 1BE9A 2I0LA 2HE4A 4JOEA 2EJYA 1UFXA 1TP3A 2KOMA 2OS6A 2KL1A 3QGLA 2OGPA 2OSGA 2FE5A 1P1DA 4REYA 1L6OA 1TE0A 5HJ1A 4NMPA 3RLEA 1GQ4A 2YT8A 4P2AB 2M10A 3QJMA 1UEPA 5B42A 1Q3OA 1Y7NA 2PKUA 1N6DA 2LA8A 2KPKA 2EGOA 2JILA 5ILBA 2REYA 2MHOA 2H2CA 4GVDA 1UHPA 3ID3A 1Q3PA 3GABA 4XHVA 1WF7A 3CS0A 1YBOA 2PZDA 4JOPA 4P0CA 2QBWA 2IWPA 4L8NA 2JREA 2EDZA 3QE1A 1QAUA 1Y8TA 2FNEA 2I4SA 2I04A 2X7ZA 4NXRA 1R6JA 1RY4A 1I92A 2M3MA 3STJA 3GDUA 2DLSA 1FCFA 5HDYA 1FC7A 2O2TA 2M0VA 1VCWA 1Z86A 4FLNA 4HOPA 2EHRA 3OTPA 2QG1A 1Q7XA 2KOHA 4Q2PA 5HFCA 5A2PA 3BPUA 3CBXA 1OBZA 5H3JA 1WIFA 4NXQA 1MFGA 2W7RA 1N6FA 3QO6A 1TP5A 2I6VA 3CH8A 5E22A 4WYUA 3MH4A 5HETA 2QKTA 2QKVA 1T2MA 2MX6A 3TSVA 2YUYA 1U38A 3GDSA 4JOKA 1UEWA 1B8QA 3EGGC 4KFWA 1N7EA 1U39A 3O5NA 1UJDA 1X5RA 4O06A 1WHAA 3KDKA 3SUZA 2AINA 1W9EA 1V5LA 2KOJA 4JORA 1ZUBA 1GM1A 1SOTA 1QAVB 2W4FA 2L97A 4NMOA 1SOZA 1X6DA 3DORA 4MPAA 2HE2A 2EEHA 4Q6HA 1N7TA 3CC0A 2DJTA 2OMJA 1VJ6A 3K50A 2ZPLA 3NGHA 1ZOKA 3PV5A 1UEQA 3TMHA 1WI4A 1KY9A 1X45A 2LOBA 2PA1A 1KEFA 3PV2A 3CBYA 1X8SA 3ID4A 4JJ3A 5HF1A 2OZFA 1V62A 4NMVA 3GCNA 3TSWA 1XZ9A 1MFLA 3GGEA 2PDZA 2IWQA 2EV8A 1WH1A 3SFJA 3L4FD 3MH6A 4E34A 5HFDA 2KA9A 2OPGA 2G2LA 4R2ZA 5I7ZA 1UJVA 1WFGA 1RZXA 2Z9IA 2JSNA 5B6LA 2PNTA 2D92A 2GZVA 2VSPA 2VWRA 3DJ3A 3K82A 3KDGA 1MC7A 2QT5A 2Q3GA 4K78A 4YYXA 4HOPB 3CBZA 2LC6A 2DKRA 5EYZA 1V6BA 4K6YA 2Z17A 1X5NA 1WHDA 4OEOA 2DLUA 1FC9A 2AWUA 1PDRA 3DIWA 2H3MA 1UF1A 5EZ0A 2JWEA 4E3BA 1IU0A 3QIKA 4JL7A 3KZDA 3O46A 4NMQA 2DC2A 3QJNA 4GHNA 2FCFA 2V1WA 4E35A 2D8IA 3GJ9A 4NMRA 4Q3HA 4WYTA 1BFEA 2H2BA 1UM1A 2KAWA 3PDZA 3R68A 3VQFA 3WKLA 4PQWA 2KJDA 5G1DA 2M0TA 2EDPA 4GVCA 5DTHA 5HEYA 4Z33A 5JXBA 3LNYA 2CSSA 2E7KA 3ID1A 4Q6SA 2R4HA 3LNXA 4FGMA 5G1EA 2WL7A 1RGWA 4JOJA 3JXTA 2KRGA 2KV8A 2OCSA 5IL9A 2ENOA 4OEPA 2I0IA 2L4SA 1UITA 2IWNA 2EGNA 3KHFA 4F8KA 3R0HA 2JINA 1UEZA 3K1RA 4UU5A 4Z8JA 2VPHA 4YDPA 2VRFA 3E17A 4OAJA 5E11A 4G69A 1G9OA 5HF4A 2CS5A 5HEDA 1TQ3A 3DJAA 2PKTA 2HGAA 2P3WA 2KYLA 2I1NA 2KJKA 2H3LA 1X5QA 5FB8C 3VQGA 2DMZA 1IU2A 1WI2A 2EEIA 4H11A 2OQSA 3B76A 1W9OA 1WF8A 3KZEA 3PS4A 2KQFA 4K76A 4NNLA 1QLCA 2EAQA 1IHJA 3SHWA 2QKUA 4JJ0A 2K20A 2LUIA 2IWOA 4AMHA 5HFEA 5FHTA 3GCOA 3I18A 3PV4A 3SHUA 2BYGA 1VA8A 3GDVA 3I1EA 4EDJA 3HVQC 2KPLA 2RRMA 2DM8A 2M0ZA 4NMTA 1NF3C 5D13A 2EGKA 1N6EA 2UZCA 2ZPMA 4N6XA 1U3BA 1M5ZA 4UU6A 3NCVA 1LCYA 2DB5A 4JOHA 5HFBA 2L4TA 1W9QA 2AWXA 2D90A 1RGRA 2JOAA 5E6PB 4Q2NA 2K1ZA 4NMSA 2F0AA 1OBYA 3CYYA 1N99A 2R3YA 3EGHC 2LC7A 4JOFA 1WJLA 2YUBA 2RCZA 1WFVA 1UJUA 3I4WA 2CSJA 4NXPA 1N7FA 4Q2OA 3FY5A 5HFFA 2YT7A 3AXAA 4LMMA 1X9ZA 2AWWA 4IC6A 2VSVA 3NFKA 3QDOA 2KBSA 2FN5A 3ID2A 5E1YA 2EEJA 2V90A 1V1TA 2KJPA 5F67A 2YTWA 5GLJA 1I16A 3HPMA 4NNMA 4RI0A 3ZRTA 5GNDA 3R69A 2DAZA 4K72A 1OBXA 3RL8A 3TSZA 1GQ5A 2F5YA 1Z87A 3SOEA 1VAEA 4KFVA 2EDVA 1V5QA 1WG6A 2G5MB 3DJ1A 1K32A 3HPKA 3WKMA 3GSLA 1NTEA 2KG2A 1UM7A 2EEGA 1QAVA 3NFLA 3PDVA 3MH7A 2JIKA 4Q2QA 5HEBA 5E21A 1D5GA 5F3XA 1KWAA 1U37A 1VB7A 1FC6A 2Q9VA 4K75A 2EXGA 2GEFA 1P1EA 2M0UA
chains in the Genus database with same CATH topology
1OZIA 3OU0A 2VZ5A 3RL7A 4JOGA 2JXOA 1BE9A 2I0LA 2HE4A 4JOEA 2EJYA 1UFXA 1TP3A 2KOMA 2OS6A 2KL1A 3QGLA 2OGPA 2OSGA 2FE5A 1P1DA 4REYA 1L6OA 1TE0A 5HJ1A 4NMPA 3RLEA 1GQ4A 2YT8A 4P2AB 2M10A 3QJMA 1UEPA 5B42A 1Q3OA 1Y7NA 2PKUA 1N6DA 2LA8A 2KPKA 2EGOA 2JILA 5ILBA 2REYA 2MHOA 2H2CA 4GVDA 1UHPA 3ID3A 1Q3PA 3GABA 4XHVA 1WF7A 3CS0A 1YBOA 2PZDA 4JOPA 4P0CA 2QBWA 2IWPA 4L8NA 2JREA 2EDZA 3QE1A 1QAUA 1Y8TA 2FNEA 2I4SA 2I04A 2X7ZA 4NXRA 1R6JA 1RY4A 1I92A 2M3MA 3STJA 3GDUA 2DLSA 1FCFA 5HDYA 1FC7A 2O2TA 2M0VA 1VCWA 1Z86A 4FLNA 4HOPA 2EHRA 3OTPA 2QG1A 1Q7XA 2KOHA 4Q2PA 5HFCA 5A2PA 3BPUA 3CBXA 1OBZA 5H3JA 1WIFA 4NXQA 1MFGA 2W7RA 1N6FA 3QO6A 1TP5A 2I6VA 3CH8A 5E22A 4WYUA 3MH4A 5HETA 2QKTA 2QKVA 1T2MA 2MX6A 3TSVA 2YUYA 1U38A 3GDSA 4JOKA 1UEWA 1B8QA 3EGGC 4KFWA 1N7EA 1U39A 3O5NA 1UJDA 1X5RA 4O06A 1WHAA 3KDKA 3SUZA 2AINA 1W9EA 1V5LA 2KOJA 4JORA 1ZUBA 1GM1A 1SOTA 1QAVB 2W4FA 2L97A 4NMOA 1SOZA 1X6DA 3DORA 4MPAA 2HE2A 2EEHA 4Q6HA 1N7TA 3CC0A 2DJTA 2OMJA 1VJ6A 3K50A 2ZPLA 3NGHA 1ZOKA 3PV5A 1UEQA 3TMHA 1WI4A 1KY9A 1X45A 2LOBA 2PA1A 1KEFA 3PV2A 3CBYA 1X8SA 3ID4A 4JJ3A 5HF1A 2OZFA 1V62A 4NMVA 3GCNA 3TSWA 1XZ9A 1MFLA 3GGEA 2PDZA 2IWQA 2EV8A 1WH1A 3SFJA 3L4FD 3MH6A 4E34A 5HFDA 2KA9A 2OPGA 2G2LA 4R2ZA 5I7ZA 1UJVA 1WFGA 1RZXA 2Z9IA 2JSNA 5B6LA 2PNTA 2D92A 2GZVA 2VSPA 2VWRA 3DJ3A 3K82A 3KDGA 1MC7A 2QT5A 2Q3GA 4K78A 4YYXA 4HOPB 3CBZA 2LC6A 2DKRA 5EYZA 1V6BA 4K6YA 2Z17A 1X5NA 1WHDA 4OEOA 2DLUA 1FC9A 2AWUA 1PDRA 3DIWA 2H3MA 1UF1A 5EZ0A 2JWEA 4E3BA 1IU0A 3QIKA 4JL7A 3KZDA 3O46A 4NMQA 2DC2A 3QJNA 4GHNA 2FCFA 2V1WA 4E35A 2D8IA 3GJ9A 4NMRA 4Q3HA 4WYTA 1BFEA 2H2BA 1UM1A 2KAWA 3PDZA 3R68A 3VQFA 3WKLA 4PQWA 2KJDA 5G1DA 2M0TA 2EDPA 4GVCA 5DTHA 5HEYA 4Z33A 5JXBA 3LNYA 2CSSA 2E7KA 3ID1A 4Q6SA 2R4HA 3LNXA 4FGMA 5G1EA 2WL7A 1RGWA 4JOJA 3JXTA 2KRGA 2KV8A 2OCSA 5IL9A 2ENOA 4OEPA 2I0IA 2L4SA 1UITA 2IWNA 2EGNA 3KHFA 4F8KA 3R0HA 2JINA 1UEZA 3K1RA 4UU5A 4Z8JA 2VPHA 4YDPA 2VRFA 3E17A 4OAJA 5E11A 4G69A 1G9OA 5HF4A 2CS5A 5HEDA 1TQ3A 3DJAA 2PKTA 2HGAA 2P3WA 2KYLA 2I1NA 2KJKA 2H3LA 1X5QA 5FB8C 3VQGA 2DMZA 1IU2A 1WI2A 2EEIA 4H11A 2OQSA 3B76A 1W9OA 1WF8A 3KZEA 3PS4A 2KQFA 4K76A 4NNLA 1QLCA 2EAQA 1IHJA 3SHWA 2QKUA 4JJ0A 2K20A 2LUIA 2IWOA 4AMHA 5HFEA 5FHTA 3GCOA 3I18A 3PV4A 3SHUA 2BYGA 1VA8A 3GDVA 3I1EA 4EDJA 3HVQC 2KPLA 2RRMA 2DM8A 2M0ZA 4NMTA 1NF3C 5D13A 2EGKA 1N6EA 2UZCA 2ZPMA 4N6XA 1U3BA 1M5ZA 4UU6A 3NCVA 1LCYA 2DB5A 4JOHA 5HFBA 2L4TA 1W9QA 2AWXA 2D90A 1RGRA 2JOAA 5E6PB 4Q2NA 2K1ZA 4NMSA 2F0AA 1OBYA 3CYYA 1N99A 2R3YA 3EGHC 2LC7A 4JOFA 1WJLA 2YUBA 2RCZA 1WFVA 1UJUA 3I4WA 2CSJA 4NXPA 1N7FA 4Q2OA 3FY5A 5HFFA 2YT7A 3AXAA 4LMMA 1X9ZA 2AWWA 4IC6A 2VSVA 3NFKA 3QDOA 2KBSA 2FN5A 3ID2A 5E1YA 2EEJA 2V90A 1V1TA 2KJPA 5F67A 2YTWA 5GLJA 1I16A 3HPMA 4NNMA 4RI0A 3ZRTA 5GNDA 3R69A 2DAZA 4K72A 1OBXA 3RL8A 3TSZA 1GQ5A 2F5YA 1Z87A 3SOEA 1VAEA 4KFVA 2EDVA 1V5QA 1WG6A 2G5MB 3DJ1A 1K32A 3HPKA 3WKMA 3GSLA 1NTEA 2KG2A 1UM7A 2EEGA 1QAVA 3NFLA 3PDVA 3MH7A 2JIKA 4Q2QA 5HEBA 5E21A 1D5GA 5F3XA 1KWAA 1U37A 1VB7A 1FC6A 2Q9VA 4K75A 2EXGA 2GEFA 1P1EA 2M0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZI A;  3OU0 A;  2VZ5 A;  3RL7 A;  4JOG A;  2JXO A;  1BE9 A;  2I0L A;  2HE4 A;  4JOE A;  2EJY A;  1UFX A;  1TP3 A;  2KOM A;  2OS6 A;  2KL1 A;  3QGL A;  2OGP A;  2OSG A;  2FE5 A;  1P1D A;  4REY A;  1L6O A;  1TE0 A;  5HJ1 A;  4NMP A;  3RLE A;  1GQ4 A;  2YT8 A;  4P2A B;  2M10 A;  3QJM A;  1UEP A;  1Q3O A;  1Y7N A;  2PKU A;  1N6D A;  2LA8 A;  2KPK A;  2EGO A;  2JIL A;  2REY A;  2MHO A;  2H2C A;  4GVD A;  1UHP A;  3ID3 A;  1Q3P A;  4XHV A;  1WF7 A;  3CS0 A;  1YBO A;  2PZD A;  4JOP A;  4P0C A;  2QBW A;  2IWP A;  4L8N A;  2JRE A;  2EDZ A;  3QE1 A;  1QAU A;  1Y8T A;  2FNE A;  2I4S A;  2I04 A;  2X7Z A;  4NXR A;  1R6J A;  1RY4 A;  1I92 A;  2M3M A;  3STJ A;  3GDU A;  2DLS A;  1FCF A;  5HDY A;  1FC7 A;  2O2T A;  2M0V A;  1VCW A;  1Z86 A;  4HOP A;  2EHR A;  3OTP A;  2QG1 A;  1Q7X A;  2KOH A;  4Q2P A;  5HFC A;  5A2P A;  3BPU A;  3CBX A;  1OBZ A;  5H3J A;  1WIF A;  4NXQ A;  1MFG A;  2W7R A;  1N6F A;  3QO6 A;  1TP5 A;  2I6V A;  3CH8 A;  5E22 A;  4WYU A;  3MH4 A;  5HET A;  2QKT A;  2QKV A;  1T2M A;  2MX6 A;  3TSV A;  2YUY A;  1U38 A;  3GDS A;  4JOK A;  1UEW A;  1B8Q A;  3EGG C;  4KFW A;  1N7E A;  1U39 A;  3O5N A;  1UJD A;  1X5R A;  4O06 A;  1WHA A;  3SUZ A;  2AIN A;  1W9E A;  1V5L A;  2KOJ A;  4JOR A;  1ZUB A;  1GM1 A;  1SOT A;  1QAV B;  2W4F A;  2L97 A;  4NMO A;  1SOZ A;  1X6D A;  3DOR A;  4MPA A;  2HE2 A;  2EEH A;  4Q6H A;  1N7T A;  3CC0 A;  2DJT A;  2OMJ A;  1VJ6 A;  3K50 A;  2ZPL A;  3NGH A;  1ZOK A;  3PV5 A;  1UEQ A;  3TMH A;  1WI4 A;  1KY9 A;  1X45 A;  2LOB A;  2PA1 A;  1KEF A;  3PV2 A;  3CBY A;  1X8S A;  3ID4 A;  5HF1 A;  2OZF A;  1V62 A;  4NMV A;  3GCN A;  3TSW A;  1XZ9 A;  1MFL A;  3GGE A;  2PDZ A;  2IWQ A;  2EV8 A;  1WH1 A;  3SFJ A;  3L4F D;  3MH6 A;  4E34 A;  5HFD A;  2KA9 A;  2OPG A;  2G2L A;  4R2Z A;  5I7Z A;  1UJV A;  1WFG A;  1RZX A;  2Z9I A;  5B6L A;  2PNT A;  2D92 A;  2GZV A;  2VSP A;  2VWR A;  3DJ3 A;  3K82 A;  1MC7 A;  2QT5 A;  2Q3G A;  4K78 A;  4YYX A;  4HOP B;  3CBZ A;  2LC6 A;  2DKR A;  5EYZ A;  1V6B A;  4K6Y A;  2Z17 A;  1X5N A;  1WHD A;  4OEO A;  2DLU A;  1FC9 A;  2AWU A;  1PDR A;  3DIW A;  2H3M A;  1UF1 A;  5EZ0 A;  2JWE A;  4E3B A;  1IU0 A;  3QIK A;  4JL7 A;  3KZD A;  3O46 A;  4NMQ A;  2DC2 A;  3QJN A;  4GHN A;  2FCF A;  2V1W A;  4E35 A;  2D8I A;  3GJ9 A;  4NMR A;  4Q3H A;  4WYT A;  1BFE A;  2H2B A;  1UM1 A;  2KAW A;  3PDZ A;  3R68 A;  3VQF A;  3WKL A;  4PQW A;  2KJD A;  5G1D A;  2M0T A;  2EDP A;  4GVC A;  5DTH A;  5HEY A;  4Z33 A;  5JXB A;  3LNY A;  2CSS A;  2E7K A;  3ID1 A;  4Q6S A;  2R4H A;  3LNX A;  4FGM A;  5G1E A;  2WL7 A;  1RGW A;  4JOJ A;  3JXT A;  2KRG A;  2KV8 A;  2OCS A;  2ENO A;  4OEP A;  2I0I A;  2L4S A;  1UIT A;  2IWN A;  2EGN A;  3KHF A;  4F8K A;  3R0H A;  2JIN A;  1UEZ A;  3K1R A;  4UU5 A;  4Z8J A;  2VPH A;  4YDP A;  2VRF A;  3E17 A;  4OAJ A;  5E11 A;  4G69 A;  1G9O A;  5HF4 A;  2CS5 A;  5HED A;  1TQ3 A;  3DJA A;  2PKT A;  2HGA A;  2P3W A;  2KYL A;  2I1N A;  2KJK A;  2H3L A;  1X5Q A;  5FB8 C;  3VQG A;  2DMZ A;  1IU2 A;  1WI2 A;  2EEI A;  4H11 A;  2OQS A;  3B76 A;  1W9O A;  1WF8 A;  3KZE A;  3PS4 A;  2KQF A;  4K76 A;  4NNL A;  1QLC A;  2EAQ A;  1IHJ A;  3SHW A;  2QKU A;  2K20 A;  2LUI A;  2IWO A;  4AMH A;  5HFE A;  5FHT A;  3GCO A;  3I18 A;  3PV4 A;  3SHU A;  2BYG A;  1VA8 A;  3GDV A;  3I1E A;  4EDJ A;  3HVQ C;  2KPL A;  2RRM A;  2DM8 A;  2M0Z A;  4NMT A;  1NF3 C;  5D13 A;  2EGK A;  1N6E A;  2UZC A;  2ZPM A;  4N6X A;  1U3B A;  1M5Z A;  4UU6 A;  1LCY A;  2DB5 A;  4JOH A;  5HFB A;  2L4T A;  1W9Q A;  2AWX A;  2D90 A;  1RGR A;  2JOA A;  5E6P B;  4Q2N A;  2K1Z A;  4NMS A;  2F0A A;  1OBY A;  3CYY A;  1N99 A;  2R3Y A;  3EGH C;  2LC7 A;  4JOF A;  1WJL A;  2YUB A;  2RCZ A;  1WFV A;  1UJU A;  3I4W A;  2CSJ A;  4NXP A;  1N7F A;  4Q2O A;  3FY5 A;  5HFF A;  2YT7 A;  3AXA A;  4LMM A;  2AWW A;  4IC6 A;  2VSV A;  3NFK A;  3QDO A;  2KBS A;  2FN5 A;  3ID2 A;  5E1Y A;  2EEJ A;  2V90 A;  1V1T A;  2KJP A;  5F67 A;  2YTW A;  5GLJ A;  1I16 A;  3HPM A;  4NNM A;  4RI0 A;  3ZRT A;  5GND A;  3R69 A;  2DAZ A;  4K72 A;  1OBX A;  3RL8 A;  3TSZ A;  1GQ5 A;  2F5Y A;  1Z87 A;  3SOE A;  1VAE A;  4KFV A;  2EDV A;  1V5Q A;  1WG6 A;  2G5M B;  3DJ1 A;  1K32 A;  3HPK A;  3WKM A;  3GSL A;  1NTE A;  2KG2 A;  1UM7 A;  2EEG A;  1QAV A;  3NFL A;  3PDV A;  3MH7 A;  2JIK A;  4Q2Q A;  5HEB A;  5E21 A;  1D5G A;  5F3X A;  1KWA A;  1U37 A;  1VB7 A;  1FC6 A;  2Q9V A;  4K75 A;  2EXG A;  1P1E A;  2M0U A; 
#chains in the Genus database with same CATH topology
 1OZI A;  3OU0 A;  2VZ5 A;  3RL7 A;  4JOG A;  2JXO A;  1BE9 A;  2I0L A;  2HE4 A;  4JOE A;  2EJY A;  1UFX A;  1TP3 A;  2KOM A;  2OS6 A;  2KL1 A;  3QGL A;  2OGP A;  2OSG A;  2FE5 A;  1P1D A;  4REY A;  1L6O A;  1TE0 A;  5HJ1 A;  4NMP A;  3RLE A;  1GQ4 A;  2YT8 A;  4P2A B;  2M10 A;  3QJM A;  1UEP A;  5B42 A;  1Q3O A;  1Y7N A;  2PKU A;  1N6D A;  2LA8 A;  2KPK A;  2EGO A;  2JIL A;  5ILB A;  2REY A;  2MHO A;  2H2C A;  4GVD A;  1UHP A;  3ID3 A;  1Q3P A;  3GAB A;  4XHV A;  1WF7 A;  3CS0 A;  1YBO A;  2PZD A;  4JOP A;  4P0C A;  2QBW A;  2IWP A;  4L8N A;  2JRE A;  2EDZ A;  3QE1 A;  1QAU A;  1Y8T A;  2FNE A;  2I4S A;  2I04 A;  2X7Z A;  4NXR A;  1R6J A;  1RY4 A;  1I92 A;  2M3M A;  3STJ A;  3GDU A;  2DLS A;  1FCF A;  5HDY A;  1FC7 A;  2O2T A;  2M0V A;  1VCW A;  1Z86 A;  4FLN A;  4HOP A;  2EHR A;  3OTP A;  2QG1 A;  1Q7X A;  2KOH A;  4Q2P A;  5HFC A;  5A2P A;  3BPU A;  3CBX A;  1OBZ A;  5H3J A;  1WIF A;  4NXQ A;  1MFG A;  2W7R A;  1N6F A;  3QO6 A;  1TP5 A;  2I6V A;  3CH8 A;  5E22 A;  4WYU A;  3MH4 A;  5HET A;  2QKT A;  2QKV A;  1T2M A;  2MX6 A;  3TSV A;  2YUY A;  1U38 A;  3GDS A;  4JOK A;  1UEW A;  1B8Q A;  3EGG C;  4KFW A;  1N7E A;  1U39 A;  3O5N A;  1UJD A;  1X5R A;  4O06 A;  1WHA A;  3KDK A;  3SUZ A;  2AIN A;  1W9E A;  1V5L A;  2KOJ A;  4JOR A;  1ZUB A;  1GM1 A;  1SOT A;  1QAV B;  2W4F A;  2L97 A;  4NMO A;  1SOZ A;  1X6D A;  3DOR A;  4MPA A;  2HE2 A;  2EEH A;  4Q6H A;  1N7T A;  3CC0 A;  2DJT A;  2OMJ A;  1VJ6 A;  3K50 A;  2ZPL A;  3NGH A;  1ZOK A;  3PV5 A;  1UEQ A;  3TMH A;  1WI4 A;  1KY9 A;  1X45 A;  2LOB A;  2PA1 A;  1KEF A;  3PV2 A;  3CBY A;  1X8S A;  3ID4 A;  4JJ3 A;  5HF1 A;  2OZF A;  1V62 A;  4NMV A;  3GCN A;  3TSW A;  1XZ9 A;  1MFL A;  3GGE A;  2PDZ A;  2IWQ A;  2EV8 A;  1WH1 A;  3SFJ A;  3L4F D;  3MH6 A;  4E34 A;  5HFD A;  2KA9 A;  2OPG A;  2G2L A;  4R2Z A;  5I7Z A;  1UJV A;  1WFG A;  1RZX A;  2Z9I A;  2JSN A;  5B6L A;  2PNT A;  2D92 A;  2GZV A;  2VSP A;  2VWR A;  3DJ3 A;  3K82 A;  3KDG A;  1MC7 A;  2QT5 A;  2Q3G A;  4K78 A;  4YYX A;  4HOP B;  3CBZ A;  2LC6 A;  2DKR A;  5EYZ A;  1V6B A;  4K6Y A;  2Z17 A;  1X5N A;  1WHD A;  4OEO A;  2DLU A;  1FC9 A;  2AWU A;  1PDR A;  3DIW A;  2H3M A;  1UF1 A;  5EZ0 A;  2JWE A;  4E3B A;  1IU0 A;  3QIK A;  4JL7 A;  3KZD A;  3O46 A;  4NMQ A;  2DC2 A;  3QJN A;  4GHN A;  2FCF A;  2V1W A;  4E35 A;  2D8I A;  3GJ9 A;  4NMR A;  4Q3H A;  4WYT A;  1BFE A;  2H2B A;  1UM1 A;  2KAW A;  3PDZ A;  3R68 A;  3VQF A;  3WKL A;  4PQW A;  2KJD A;  5G1D A;  2M0T A;  2EDP A;  4GVC A;  5DTH A;  5HEY A;  4Z33 A;  5JXB A;  3LNY A;  2CSS A;  2E7K A;  3ID1 A;  4Q6S A;  2R4H A;  3LNX A;  4FGM A;  5G1E A;  2WL7 A;  1RGW A;  4JOJ A;  3JXT A;  2KRG A;  2KV8 A;  2OCS A;  5IL9 A;  2ENO A;  4OEP A;  2I0I A;  2L4S A;  1UIT A;  2IWN A;  2EGN A;  3KHF A;  4F8K A;  3R0H A;  2JIN A;  1UEZ A;  3K1R A;  4UU5 A;  4Z8J A;  2VPH A;  4YDP A;  2VRF A;  3E17 A;  4OAJ A;  5E11 A;  4G69 A;  1G9O A;  5HF4 A;  2CS5 A;  5HED A;  1TQ3 A;  3DJA A;  2PKT A;  2HGA A;  2P3W A;  2KYL A;  2I1N A;  2KJK A;  2H3L A;  1X5Q A;  5FB8 C;  3VQG A;  2DMZ A;  1IU2 A;  1WI2 A;  2EEI A;  4H11 A;  2OQS A;  3B76 A;  1W9O A;  1WF8 A;  3KZE A;  3PS4 A;  2KQF A;  4K76 A;  4NNL A;  1QLC A;  2EAQ A;  1IHJ A;  3SHW A;  2QKU A;  4JJ0 A;  2K20 A;  2LUI A;  2IWO A;  4AMH A;  5HFE A;  5FHT A;  3GCO A;  3I18 A;  3PV4 A;  3SHU A;  2BYG A;  1VA8 A;  3GDV A;  3I1E A;  4EDJ A;  3HVQ C;  2KPL A;  2RRM A;  2DM8 A;  2M0Z A;  4NMT A;  1NF3 C;  5D13 A;  2EGK A;  1N6E A;  2UZC A;  2ZPM A;  4N6X A;  1U3B A;  1M5Z A;  4UU6 A;  3NCV A;  1LCY A;  2DB5 A;  4JOH A;  5HFB A;  2L4T A;  1W9Q A;  2AWX A;  2D90 A;  1RGR A;  2JOA A;  5E6P B;  4Q2N A;  2K1Z A;  4NMS A;  2F0A A;  1OBY A;  3CYY A;  1N99 A;  2R3Y A;  3EGH C;  2LC7 A;  4JOF A;  1WJL A;  2YUB A;  2RCZ A;  1WFV A;  1UJU A;  3I4W A;  2CSJ A;  4NXP A;  1N7F A;  4Q2O A;  3FY5 A;  5HFF A;  2YT7 A;  3AXA A;  4LMM A;  1X9Z A;  2AWW A;  4IC6 A;  2VSV A;  3NFK A;  3QDO A;  2KBS A;  2FN5 A;  3ID2 A;  5E1Y A;  2EEJ A;  2V90 A;  1V1T A;  2KJP A;  5F67 A;  2YTW A;  5GLJ A;  1I16 A;  3HPM A;  4NNM A;  4RI0 A;  3ZRT A;  5GND A;  3R69 A;  2DAZ A;  4K72 A;  1OBX A;  3RL8 A;  3TSZ A;  1GQ5 A;  2F5Y A;  1Z87 A;  3SOE A;  1VAE A;  4KFV A;  2EDV A;  1V5Q A;  1WG6 A;  2G5M B;  3DJ1 A;  1K32 A;  3HPK A;  3WKM A;  3GSL A;  1NTE A;  2KG2 A;  1UM7 A;  2EEG A;  1QAV A;  3NFL A;  3PDV A;  3MH7 A;  2JIK A;  4Q2Q A;  5HEB A;  5E21 A;  1D5G A;  5F3X A;  1KWA A;  1U37 A;  1VB7 A;  1FC6 A;  2Q9V A;  4K75 A;  2EXG A;  2GEF A;  1P1E A;  2M0U A; 
#chains in the Genus database with same CATH homology
 1OZI A;  3OU0 A;  2VZ5 A;  3RL7 A;  4JOG A;  2JXO A;  1BE9 A;  2I0L A;  2HE4 A;  4JOE A;  2EJY A;  1UFX A;  1TP3 A;  2KOM A;  2OS6 A;  2KL1 A;  3QGL A;  2OGP A;  2OSG A;  2FE5 A;  1P1D A;  4REY A;  1L6O A;  1TE0 A;  5HJ1 A;  4NMP A;  3RLE A;  1GQ4 A;  2YT8 A;  4P2A B;  2M10 A;  3QJM A;  1UEP A;  5B42 A;  1Q3O A;  1Y7N A;  2PKU A;  1N6D A;  2LA8 A;  2KPK A;  2EGO A;  2JIL A;  5ILB A;  2REY A;  2MHO A;  2H2C A;  4GVD A;  1UHP A;  3ID3 A;  1Q3P A;  3GAB A;  4XHV A;  1WF7 A;  3CS0 A;  1YBO A;  2PZD A;  4JOP A;  4P0C A;  2QBW A;  2IWP A;  4L8N A;  2JRE A;  2EDZ A;  3QE1 A;  1QAU A;  1Y8T A;  2FNE A;  2I4S A;  2I04 A;  2X7Z A;  4NXR A;  1R6J A;  1RY4 A;  1I92 A;  2M3M A;  3STJ A;  3GDU A;  2DLS A;  1FCF A;  5HDY A;  1FC7 A;  2O2T A;  2M0V A;  1VCW A;  1Z86 A;  4FLN A;  4HOP A;  2EHR A;  3OTP A;  2QG1 A;  1Q7X A;  2KOH A;  4Q2P A;  5HFC A;  5A2P A;  3BPU A;  3CBX A;  1OBZ A;  5H3J A;  1WIF A;  4NXQ A;  1MFG A;  2W7R A;  1N6F A;  3QO6 A;  1TP5 A;  2I6V A;  3CH8 A;  5E22 A;  4WYU A;  3MH4 A;  5HET A;  2QKT A;  2QKV A;  1T2M A;  2MX6 A;  3TSV A;  2YUY A;  1U38 A;  3GDS A;  4JOK A;  1UEW A;  1B8Q A;  3EGG C;  4KFW A;  1N7E A;  1U39 A;  3O5N A;  1UJD A;  1X5R A;  4O06 A;  1WHA A;  3KDK A;  3SUZ A;  2AIN A;  1W9E A;  1V5L A;  2KOJ A;  4JOR A;  1ZUB A;  1GM1 A;  1SOT A;  1QAV B;  2W4F A;  2L97 A;  4NMO A;  1SOZ A;  1X6D A;  3DOR A;  4MPA A;  2HE2 A;  2EEH A;  4Q6H A;  1N7T A;  3CC0 A;  2DJT A;  2OMJ A;  1VJ6 A;  3K50 A;  2ZPL A;  3NGH A;  1ZOK A;  3PV5 A;  1UEQ A;  3TMH A;  1WI4 A;  1KY9 A;  1X45 A;  2LOB A;  2PA1 A;  1KEF A;  3PV2 A;  3CBY A;  1X8S A;  3ID4 A;  4JJ3 A;  5HF1 A;  2OZF A;  1V62 A;  4NMV A;  3GCN A;  3TSW A;  1XZ9 A;  1MFL A;  3GGE A;  2PDZ A;  2IWQ A;  2EV8 A;  1WH1 A;  3SFJ A;  3L4F D;  3MH6 A;  4E34 A;  5HFD A;  2KA9 A;  2OPG A;  2G2L A;  4R2Z A;  5I7Z A;  1UJV A;  1WFG A;  1RZX A;  2Z9I A;  2JSN A;  5B6L A;  2PNT A;  2D92 A;  2GZV A;  2VSP A;  2VWR A;  3DJ3 A;  3K82 A;  3KDG A;  1MC7 A;  2QT5 A;  2Q3G A;  4K78 A;  4YYX A;  4HOP B;  3CBZ A;  2LC6 A;  2DKR A;  5EYZ A;  1V6B A;  4K6Y A;  2Z17 A;  1X5N A;  1WHD A;  4OEO A;  2DLU A;  1FC9 A;  2AWU A;  1PDR A;  3DIW A;  2H3M A;  1UF1 A;  5EZ0 A;  2JWE A;  4E3B A;  1IU0 A;  3QIK A;  4JL7 A;  3KZD A;  3O46 A;  4NMQ A;  2DC2 A;  3QJN A;  4GHN A;  2FCF A;  2V1W A;  4E35 A;  2D8I A;  3GJ9 A;  4NMR A;  4Q3H A;  4WYT A;  1BFE A;  2H2B A;  1UM1 A;  2KAW A;  3PDZ A;  3R68 A;  3VQF A;  3WKL A;  4PQW A;  2KJD A;  5G1D A;  2M0T A;  2EDP A;  4GVC A;  5DTH A;  5HEY A;  4Z33 A;  5JXB A;  3LNY A;  2CSS A;  2E7K A;  3ID1 A;  4Q6S A;  2R4H A;  3LNX A;  4FGM A;  5G1E A;  2WL7 A;  1RGW A;  4JOJ A;  3JXT A;  2KRG A;  2KV8 A;  2OCS A;  5IL9 A;  2ENO A;  4OEP A;  2I0I A;  2L4S A;  1UIT A;  2IWN A;  2EGN A;  3KHF A;  4F8K A;  3R0H A;  2JIN A;  1UEZ A;  3K1R A;  4UU5 A;  4Z8J A;  2VPH A;  4YDP A;  2VRF A;  3E17 A;  4OAJ A;  5E11 A;  4G69 A;  1G9O A;  5HF4 A;  2CS5 A;  5HED A;  1TQ3 A;  3DJA A;  2PKT A;  2HGA A;  2P3W A;  2KYL A;  2I1N A;  2KJK A;  2H3L A;  1X5Q A;  5FB8 C;  3VQG A;  2DMZ A;  1IU2 A;  1WI2 A;  2EEI A;  4H11 A;  2OQS A;  3B76 A;  1W9O A;  1WF8 A;  3KZE A;  3PS4 A;  2KQF A;  4K76 A;  4NNL A;  1QLC A;  2EAQ A;  1IHJ A;  3SHW A;  2QKU A;  4JJ0 A;  2K20 A;  2LUI A;  2IWO A;  4AMH A;  5HFE A;  5FHT A;  3GCO A;  3I18 A;  3PV4 A;  3SHU A;  2BYG A;  1VA8 A;  3GDV A;  3I1E A;  4EDJ A;  3HVQ C;  2KPL A;  2RRM A;  2DM8 A;  2M0Z A;  4NMT A;  1NF3 C;  5D13 A;  2EGK A;  1N6E A;  2UZC A;  2ZPM A;  4N6X A;  1U3B A;  1M5Z A;  4UU6 A;  3NCV A;  1LCY A;  2DB5 A;  4JOH A;  5HFB A;  2L4T A;  1W9Q A;  2AWX A;  2D90 A;  1RGR A;  2JOA A;  5E6P B;  4Q2N A;  2K1Z A;  4NMS A;  2F0A A;  1OBY A;  3CYY A;  1N99 A;  2R3Y A;  3EGH C;  2LC7 A;  4JOF A;  1WJL A;  2YUB A;  2RCZ A;  1WFV A;  1UJU A;  3I4W A;  2CSJ A;  4NXP A;  1N7F A;  4Q2O A;  3FY5 A;  5HFF A;  2YT7 A;  3AXA A;  4LMM A;  1X9Z A;  2AWW A;  4IC6 A;  2VSV A;  3NFK A;  3QDO A;  2KBS A;  2FN5 A;  3ID2 A;  5E1Y A;  2EEJ A;  2V90 A;  1V1T A;  2KJP A;  5F67 A;  2YTW A;  5GLJ A;  1I16 A;  3HPM A;  4NNM A;  4RI0 A;  3ZRT A;  5GND A;  3R69 A;  2DAZ A;  4K72 A;  1OBX A;  3RL8 A;  3TSZ A;  1GQ5 A;  2F5Y A;  1Z87 A;  3SOE A;  1VAE A;  4KFV A;  2EDV A;  1V5Q A;  1WG6 A;  2G5M B;  3DJ1 A;  1K32 A;  3HPK A;  3WKM A;  3GSL A;  1NTE A;  2KG2 A;  1UM7 A;  2EEG A;  1QAV A;  3NFL A;  3PDV A;  3MH7 A;  2JIK A;  4Q2Q A;  5HEB A;  5E21 A;  1D5G A;  5F3X A;  1KWA A;  1U37 A;  1VB7 A;  1FC6 A;  2Q9V A;  4K75 A;  2EXG A;  2GEF A;  1P1E A;  2M0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...