2VZ5A

Structure of the pdz domain of tax1 (human t-cell leukemia virus type i) binding protein 3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
111
Chain Sequence
SMVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSSMLSETEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAX1-BINDING PROTEIN 3
publication title The Structure of the Pdz Domain of Tax1BP
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 23
structure length 111
sequence length 118
ec nomenclature
pdb deposition date 2008-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2vz5A00
2F0AA 3PDZA 1X8SA 2D92A 4WYTA 4WYUA 5E6PB 3TSVA 1Q3PA 1OBYA 1UHPA 4G69A 1N7FA 3KZEA 4NNLA 4OEPA 3O46A 2HGAA 3K1RA 1Y7NA 2EDVA 4F8KA 2DC2A 1Y8TA 1IHJA 2P3WA 3OU0A 1W9OA 2UZCA 3K50A 1UEZA 3QIKA 3LNYA 3CS0A 2KJPA 1SOZA 4Q6SA 3ID1A 5HETA 5FHTA 5HFBA 1WF7A 1TQ3A 1N6DA 1X45A 2M0TA 5EZ0A 2VRFA 3ID4A 3EGHC 2R3YA 3O5NA 2QKVA 2WL7A 4JL7A 2JREA 2LC6A 4K72A 2LA8A 2AINA 2PKUA 1FC7A 3CC0A 1VB7A 4Q2OA 3JXTA 1MFLA 2EEHA 2DKRA 2M0UA 5F67A 4JORA 2AWUA 4NMOA 1T2MA 1WFVA 2JIKA 5A2PA 5EYZA 4YDPA 4E34A 3MH4A 3CH8A 5HF4A 2JOAA 2KJDA 1RY4A 2IWPA 2PDZA 4NMSA 3RL7A 1WJLA 4JOKA 2F5YA 4Z33A 1GQ4A 2Q3GA 2OCSA 1M5ZA 2ENOA 5HJ1A 3CBXA 4JOHA 3SHWA 1UFXA 3EGGC 3R0HA 3PS4A 3TSWA 5DTHA 2PA1A 2I4SA 5JXBA 1QAUA 2OQSA 2KOJA 4REYA 4E3BA 2CS5A 1K32A 3VQFA 2AWXA 2W7RA 2AWWA 1X5QA 4NMPA 4FGMA 4Q2QA 3FY5A 2VWRA 1UM1A 2L97A 5HFCA 3R68A 3SHUA 2OSGA 1UEQA 4L8NA 3E17A 4XHVA 2JINA 1V62A 2G5MB 1U38A 2EEGA 5B6LA 1N7EA 4MPAA 5HEDA 2EDZA 2QT5A 4P2AB 2PZDA 2M0VA 1OZIA 4YYXA 2EEIA 2EGOA 2EGKA 3WKLA 1V6BA 5F3XA 1XZ9A 2DAZA 1NTEA 2E7KA 2OPGA 1W9EA 2H2CA 5GLJA 2QG1A 2DLUA 2ZPLA 4NMVA 1UJVA 1ZUBA 4R2ZA 2KPKA 2KAWA 4K6YA 4Q6HA 1KY9A 1Z87A 1WIFA 3GCNA 1KEFA 1WG6A 4O06A 1P1DA 1UITA 2M3MA 2GZVA 4LMMA 3AXAA 3GJ9A 2H2BA 1UJDA 2H3MA 1FC6A 4JOFA 5E22A 2IWQA 1GM1A 2MHOA 1U37A 3GGEA 3CBZA 1Z86A 1V5QA 1IU0A 2EXGA 1QAVB 2KOMA 2Z9IA 1UM7A 3GSLA 3ID2A 2LOBA 2VZ5A 2V90A 2Q9VA 5H3JA 1N6EA 1WFGA 3QJMA 1UJUA 3LNXA 3MH7A 4K75A 3QGLA 4PQWA 3NGHA 1L6OA 4UU5A 1N99A 1TP5A 1FC9A 1WH1A 2YT7A 5HF1A 4E35A 2VPHA 5HFDA 1Q7XA 3I4WA 3HVQC 2LC7A 2OZFA 2YTWA 1TP3A 4IC6A 1R6JA 4JOJA 1G9OA 2LUIA 2QKUA 5HFEA 1LCYA 1X5NA 4Z8JA 1BFEA 1W9QA 2KOHA 4KFVA 2DLSA 2VSPA 4NMTA 4GVCA 2OGPA 2JWEA 1B8QA 5FB8C 2OMJA 1UF1A 1ZOKA 2JILA 1X6DA 5G1EA 1P1EA 2K20A 2EJYA 4NMRA 4P0CA 5HFFA 3VQGA 3NFKA 4Q3HA 1FCFA 4K78A 3KHFA 1MFGA 4Q2PA 3K82A 4NXRA 3DJAA 2DB5A 3SUZA 2I6VA 1X5RA 2KRGA 2EEJA 4NXPA 1VA8A 2QBWA 1GQ5A 1I16A 3PV2A 1Q3OA 3DORA 1VAEA 4NMQA 2KJKA 2G2LA 1KWAA 2R4HA 1UEWA 2K1ZA 1V5LA 2W4FA 4KFWA 1V1TA 2I0IA 2CSJA 1QLCA 2YUBA 2HE2A 2VSVA 4HOPB 1N7TA 2I1NA 2FN5A 3DJ3A 2KV8A 3ID3A 4EDJA 1VCWA 2M10A 1D5GA 1PDRA 2MX6A 4K76A 3PV5A 2FNEA 2OS6A 4GVDA 3QE1A 3PDVA 5E21A 2DM8A 1WI4A 4HOPA 2DJTA 2PKTA 2I04A 3QDOA 2KG2A 2HE4A 3QO6A 2I0LA 3CYYA 1OBZA 4OEOA 5G1DA 5HEBA 2IWOA 3SOEA 4RI0A 2D8IA 5GNDA 5E11A 2EHRA 3TMHA 4AMHA 2RRMA 4NXQA 3ZRTA 1QAVA 2FCFA 2YT8A 3TSZA 5I7ZA 2KPLA 1RGWA 1WHDA 1U3BA 1N6FA 2QKTA 3HPMA 3GCOA 3RLEA 2DMZA 3WKMA 3MH6A 4H11A 1WI2A 2RCZA 2EAQA 3R69A 4JOPA 1UEPA 3DIWA 1U39A 3KZDA 2ZPMA 2BYGA 3PV4A 3HPKA 1OBXA 2V1WA 5HEYA 2X7ZA 3CBYA 1RZXA 3QJNA 4OAJA 3NFLA 3RL8A 2KBSA 1VJ6A 3DJ1A 3BPUA 2M0ZA 1WHAA 3L4FD 2L4SA 4Q2NA 2KA9A 3GDVA 3I18A 2EV8A 2H3LA 2FE5A 4GHNA 2D90A 2JXOA 2KL1A 1YBOA 1BE9A 2KYLA 2EGNA 2IWNA 1RGRA 1I92A 1NF3C 3STJA 3OTPA 4UU6A 3GDUA 1IU2A 2REYA 2KQFA 3SFJA 1WF8A 2PNTA 2L4TA 4JOEA 3B76A 2EDPA 2YUYA 2O2TA 2Z17A 5HDYA 4JOGA 1SOTA 3I1EA 1TE0A 1MC7A 4N6XA 4NNMA 3GDSA 2CSSA 5D13A 5E1YA
chains in the Genus database with same CATH superfamily
2F0AA 3PDZA 1X8SA 2D92A 4WYTA 4WYUA 5E6PB 3TSVA 1Q3PA 1OBYA 1UHPA 4G69A 1N7FA 3KZEA 4NNLA 4OEPA 3O46A 2HGAA 3K1RA 1Y7NA 2EDVA 4F8KA 2GEFA 2DC2A 1Y8TA 1IHJA 2P3WA 3OU0A 1W9OA 2UZCA 3K50A 1UEZA 3QIKA 3LNYA 3CS0A 2KJPA 4FLNA 1SOZA 4Q6SA 3ID1A 5HETA 5FHTA 5HFBA 1WF7A 1TQ3A 1N6DA 1X45A 2M0TA 5EZ0A 2VRFA 3ID4A 3EGHC 2R3YA 3O5NA 2QKVA 2WL7A 4JL7A 2JREA 2LC6A 4K72A 2LA8A 2AINA 2PKUA 1FC7A 3CC0A 1VB7A 4Q2OA 3JXTA 1MFLA 2EEHA 2DKRA 2M0UA 5F67A 4JORA 2AWUA 4NMOA 1T2MA 1WFVA 2JIKA 5A2PA 5EYZA 4YDPA 4E34A 3MH4A 3CH8A 5HF4A 2JOAA 2KJDA 1RY4A 2IWPA 2PDZA 4NMSA 3RL7A 1WJLA 4JOKA 2F5YA 4Z33A 1GQ4A 2Q3GA 2OCSA 1M5ZA 2ENOA 5HJ1A 3CBXA 4JOHA 1X9ZA 3SHWA 5ILBA 1UFXA 3EGGC 3R0HA 3PS4A 3TSWA 5DTHA 2PA1A 2I4SA 5JXBA 1QAUA 2OQSA 2KOJA 4REYA 4E3BA 2CS5A 1K32A 3VQFA 2AWXA 2W7RA 2AWWA 1X5QA 4NMPA 4FGMA 4Q2QA 3FY5A 2VWRA 1UM1A 2L97A 5HFCA 3R68A 3SHUA 2OSGA 1UEQA 4L8NA 3E17A 4XHVA 2JINA 1V62A 2G5MB 1U38A 2EEGA 5B6LA 1N7EA 4MPAA 5HEDA 2EDZA 2QT5A 4P2AB 2PZDA 2M0VA 1OZIA 4YYXA 2EEIA 2EGOA 2EGKA 3WKLA 1V6BA 5F3XA 1XZ9A 2DAZA 1NTEA 2E7KA 2OPGA 1W9EA 2H2CA 5GLJA 2QG1A 2DLUA 2ZPLA 4NMVA 1UJVA 1ZUBA 4R2ZA 2KPKA 2KAWA 4K6YA 4Q6HA 1KY9A 1Z87A 1WIFA 3GCNA 1KEFA 1WG6A 4O06A 1P1DA 1UITA 2M3MA 2GZVA 4LMMA 3AXAA 3GJ9A 2H2BA 1UJDA 2H3MA 1FC6A 4JOFA 5E22A 2IWQA 1GM1A 2MHOA 1U37A 3GGEA 3CBZA 1Z86A 1V5QA 1IU0A 2EXGA 1QAVB 2KOMA 2Z9IA 1UM7A 3GSLA 3ID2A 2LOBA 2VZ5A 2V90A 2Q9VA 5H3JA 1N6EA 1WFGA 3QJMA 1UJUA 3LNXA 3MH7A 4K75A 3QGLA 4PQWA 3NGHA 1L6OA 4UU5A 1N99A 1TP5A 1FC9A 1WH1A 2YT7A 5HF1A 4E35A 2VPHA 5HFDA 1Q7XA 3I4WA 3HVQC 2LC7A 2OZFA 2YTWA 1TP3A 4IC6A 1R6JA 4JOJA 1G9OA 2LUIA 2QKUA 5HFEA 1LCYA 1X5NA 2JSNA 4Z8JA 1BFEA 1W9QA 4JJ3A 2KOHA 4KFVA 2DLSA 2VSPA 4NMTA 4GVCA 2OGPA 2JWEA 1B8QA 5FB8C 2OMJA 1UF1A 1ZOKA 2JILA 1X6DA 5G1EA 1P1EA 2K20A 2EJYA 4NMRA 4P0CA 5HFFA 3VQGA 3NFKA 4Q3HA 1FCFA 4K78A 3KHFA 1MFGA 4Q2PA 3K82A 4NXRA 3DJAA 2DB5A 3SUZA 2I6VA 1X5RA 2KRGA 2EEJA 4NXPA 1VA8A 2QBWA 1GQ5A 1I16A 3PV2A 1Q3OA 3DORA 1VAEA 4NMQA 3NCVA 2KJKA 2G2LA 1KWAA 2R4HA 3KDGA 1UEWA 2K1ZA 1V5LA 2W4FA 4KFWA 1V1TA 2I0IA 2CSJA 1QLCA 2YUBA 2HE2A 2VSVA 4HOPB 5B42A 1N7TA 2I1NA 2FN5A 3DJ3A 2KV8A 3ID3A 4EDJA 1VCWA 2M10A 1D5GA 1PDRA 2MX6A 4K76A 3PV5A 2FNEA 2OS6A 4GVDA 3QE1A 3PDVA 5E21A 2DM8A 1WI4A 4HOPA 2DJTA 2PKTA 2I04A 3QDOA 2KG2A 2HE4A 3QO6A 2I0LA 3CYYA 1OBZA 4OEOA 5G1DA 5HEBA 2IWOA 3SOEA 4RI0A 2D8IA 5GNDA 5E11A 2EHRA 3TMHA 4AMHA 2RRMA 4NXQA 3ZRTA 1QAVA 2FCFA 2YT8A 3TSZA 5I7ZA 2KPLA 1RGWA 1WHDA 1U3BA 1N6FA 2QKTA 3HPMA 3GCOA 3RLEA 3GABA 2DMZA 3WKMA 3MH6A 4H11A 1WI2A 2RCZA 2EAQA 3R69A 4JOPA 1UEPA 3DIWA 1U39A 3KZDA 2ZPMA 2BYGA 3PV4A 3HPKA 1OBXA 2V1WA 5HEYA 2X7ZA 5IL9A 3CBYA 1RZXA 3QJNA 4OAJA 3NFLA 3RL8A 2KBSA 1VJ6A 3DJ1A 3KDKA 3BPUA 2M0ZA 1WHAA 3L4FD 2L4SA 4Q2NA 2KA9A 3GDVA 3I18A 2EV8A 2H3LA 2FE5A 4GHNA 2D90A 2JXOA 2KL1A 1YBOA 1BE9A 2KYLA 2EGNA 2IWNA 1RGRA 1I92A 1NF3C 3STJA 3OTPA 4UU6A 3GDUA 1IU2A 2REYA 2KQFA 3SFJA 1WF8A 2PNTA 2L4TA 4JOEA 3B76A 2EDPA 2YUYA 2O2TA 2Z17A 5HDYA 4JOGA 1SOTA 3I1EA 1TE0A 1MC7A 4JJ0A 4N6XA 4NNMA 3GDSA 2CSSA 5D13A 5E1YA
chains in the Genus database with same CATH topology
2F0AA 3PDZA 1X8SA 2D92A 4WYTA 4WYUA 5E6PB 3TSVA 1Q3PA 1OBYA 1UHPA 4G69A 1N7FA 3KZEA 4NNLA 4OEPA 3O46A 2HGAA 3K1RA 1Y7NA 2EDVA 4F8KA 2GEFA 2DC2A 1Y8TA 1IHJA 2P3WA 3OU0A 1W9OA 2UZCA 3K50A 1UEZA 3QIKA 3LNYA 3CS0A 2KJPA 4FLNA 1SOZA 4Q6SA 3ID1A 5HETA 5FHTA 5HFBA 1WF7A 1TQ3A 1N6DA 1X45A 2M0TA 5EZ0A 2VRFA 3ID4A 3EGHC 2R3YA 3O5NA 2QKVA 2WL7A 4JL7A 2JREA 2LC6A 4K72A 2LA8A 2AINA 2PKUA 1FC7A 3CC0A 1VB7A 4Q2OA 3JXTA 1MFLA 2EEHA 2DKRA 2M0UA 5F67A 4JORA 2AWUA 4NMOA 1T2MA 1WFVA 2JIKA 5A2PA 5EYZA 4YDPA 4E34A 3MH4A 3CH8A 5HF4A 2JOAA 2KJDA 1RY4A 2IWPA 2PDZA 4NMSA 3RL7A 1WJLA 4JOKA 2F5YA 4Z33A 1GQ4A 2Q3GA 2OCSA 1M5ZA 2ENOA 5HJ1A 3CBXA 4JOHA 1X9ZA 3SHWA 5ILBA 1UFXA 3EGGC 3R0HA 3PS4A 3TSWA 5DTHA 2PA1A 2I4SA 5JXBA 1QAUA 2OQSA 2KOJA 4REYA 4E3BA 2CS5A 1K32A 3VQFA 2AWXA 2W7RA 2AWWA 1X5QA 4NMPA 4FGMA 4Q2QA 3FY5A 2VWRA 1UM1A 2L97A 5HFCA 3R68A 3SHUA 2OSGA 1UEQA 4L8NA 3E17A 4XHVA 2JINA 1V62A 2G5MB 1U38A 2EEGA 5B6LA 1N7EA 4MPAA 5HEDA 2EDZA 2QT5A 4P2AB 2PZDA 2M0VA 1OZIA 4YYXA 2EEIA 2EGOA 2EGKA 3WKLA 1V6BA 5F3XA 1XZ9A 2DAZA 1NTEA 2E7KA 2OPGA 1W9EA 2H2CA 5GLJA 2QG1A 2DLUA 2ZPLA 4NMVA 1UJVA 1ZUBA 4R2ZA 2KPKA 2KAWA 4K6YA 4Q6HA 1KY9A 1Z87A 1WIFA 3GCNA 1KEFA 1WG6A 4O06A 1P1DA 1UITA 2M3MA 2GZVA 4LMMA 3AXAA 3GJ9A 2H2BA 1UJDA 2H3MA 1FC6A 4JOFA 5E22A 2IWQA 1GM1A 2MHOA 1U37A 3GGEA 3CBZA 1Z86A 1V5QA 1IU0A 2EXGA 1QAVB 2KOMA 2Z9IA 1UM7A 3GSLA 3ID2A 2LOBA 2VZ5A 2V90A 2Q9VA 5H3JA 1N6EA 1WFGA 3QJMA 1UJUA 3LNXA 3MH7A 4K75A 3QGLA 4PQWA 3NGHA 1L6OA 4UU5A 1N99A 1TP5A 1FC9A 1WH1A 2YT7A 5HF1A 4E35A 2VPHA 5HFDA 1Q7XA 3I4WA 3HVQC 2LC7A 2OZFA 2YTWA 1TP3A 4IC6A 1R6JA 4JOJA 1G9OA 2LUIA 2QKUA 5HFEA 1LCYA 1X5NA 2JSNA 4Z8JA 1BFEA 1W9QA 4JJ3A 2KOHA 4KFVA 2DLSA 2VSPA 4NMTA 4GVCA 2OGPA 2JWEA 1B8QA 5FB8C 2OMJA 1UF1A 1ZOKA 2JILA 1X6DA 5G1EA 1P1EA 2K20A 2EJYA 4NMRA 4P0CA 5HFFA 3VQGA 3NFKA 4Q3HA 1FCFA 4K78A 3KHFA 1MFGA 4Q2PA 3K82A 4NXRA 3DJAA 2DB5A 3SUZA 2I6VA 1X5RA 2KRGA 2EEJA 4NXPA 1VA8A 2QBWA 1GQ5A 1I16A 3PV2A 1Q3OA 3DORA 1VAEA 4NMQA 3NCVA 2KJKA 2G2LA 1KWAA 2R4HA 3KDGA 1UEWA 2K1ZA 1V5LA 2W4FA 4KFWA 1V1TA 2I0IA 2CSJA 1QLCA 2YUBA 2HE2A 2VSVA 4HOPB 5B42A 1N7TA 2I1NA 2FN5A 3DJ3A 2KV8A 3ID3A 4EDJA 1VCWA 2M10A 1D5GA 1PDRA 2MX6A 4K76A 3PV5A 2FNEA 2OS6A 4GVDA 3QE1A 3PDVA 5E21A 2DM8A 1WI4A 4HOPA 2DJTA 2PKTA 2I04A 3QDOA 2KG2A 2HE4A 3QO6A 2I0LA 3CYYA 1OBZA 4OEOA 5G1DA 5HEBA 2IWOA 3SOEA 4RI0A 2D8IA 5GNDA 5E11A 2EHRA 3TMHA 4AMHA 2RRMA 4NXQA 3ZRTA 1QAVA 2FCFA 2YT8A 3TSZA 5I7ZA 2KPLA 1RGWA 1WHDA 1U3BA 1N6FA 2QKTA 3HPMA 3GCOA 3RLEA 3GABA 2DMZA 3WKMA 3MH6A 4H11A 1WI2A 2RCZA 2EAQA 3R69A 4JOPA 1UEPA 3DIWA 1U39A 3KZDA 2ZPMA 2BYGA 3PV4A 3HPKA 1OBXA 2V1WA 5HEYA 2X7ZA 5IL9A 3CBYA 1RZXA 3QJNA 4OAJA 3NFLA 3RL8A 2KBSA 1VJ6A 3DJ1A 3KDKA 3BPUA 2M0ZA 1WHAA 3L4FD 2L4SA 4Q2NA 2KA9A 3GDVA 3I18A 2EV8A 2H3LA 2FE5A 4GHNA 2D90A 2JXOA 2KL1A 1YBOA 1BE9A 2KYLA 2EGNA 2IWNA 1RGRA 1I92A 1NF3C 3STJA 3OTPA 4UU6A 3GDUA 1IU2A 2REYA 2KQFA 3SFJA 1WF8A 2PNTA 2L4TA 4JOEA 3B76A 2EDPA 2YUYA 2O2TA 2Z17A 5HDYA 4JOGA 1SOTA 3I1EA 1TE0A 1MC7A 4JJ0A 4N6XA 4NNMA 3GDSA 2CSSA 5D13A 5E1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0A A;  3PDZ A;  1X8S A;  2D92 A;  4WYT A;  4WYU A;  5E6P B;  3TSV A;  1Q3P A;  1OBY A;  1UHP A;  4G69 A;  1N7F A;  3KZE A;  4NNL A;  4OEP A;  3O46 A;  2HGA A;  3K1R A;  1Y7N A;  2EDV A;  4F8K A;  2DC2 A;  1Y8T A;  1IHJ A;  2P3W A;  3OU0 A;  1W9O A;  2UZC A;  3K50 A;  1UEZ A;  3QIK A;  3LNY A;  3CS0 A;  2KJP A;  1SOZ A;  4Q6S A;  3ID1 A;  5HET A;  5FHT A;  5HFB A;  1WF7 A;  1TQ3 A;  1N6D A;  1X45 A;  2M0T A;  5EZ0 A;  2VRF A;  3ID4 A;  3EGH C;  2R3Y A;  3O5N A;  2QKV A;  2WL7 A;  4JL7 A;  2JRE A;  2LC6 A;  4K72 A;  2LA8 A;  2AIN A;  2PKU A;  1FC7 A;  3CC0 A;  1VB7 A;  4Q2O A;  3JXT A;  1MFL A;  2EEH A;  2DKR A;  2M0U A;  5F67 A;  4JOR A;  2AWU A;  4NMO A;  1T2M A;  1WFV A;  2JIK A;  5A2P A;  5EYZ A;  4YDP A;  4E34 A;  3MH4 A;  3CH8 A;  5HF4 A;  2JOA A;  2KJD A;  1RY4 A;  2IWP A;  2PDZ A;  4NMS A;  3RL7 A;  1WJL A;  4JOK A;  2F5Y A;  4Z33 A;  1GQ4 A;  2Q3G A;  2OCS A;  1M5Z A;  2ENO A;  5HJ1 A;  3CBX A;  4JOH A;  3SHW A;  1UFX A;  3EGG C;  3R0H A;  3PS4 A;  3TSW A;  5DTH A;  2PA1 A;  2I4S A;  5JXB A;  1QAU A;  2OQS A;  2KOJ A;  4REY A;  4E3B A;  2CS5 A;  1K32 A;  3VQF A;  2AWX A;  2W7R A;  2AWW A;  1X5Q A;  4NMP A;  4FGM A;  4Q2Q A;  3FY5 A;  2VWR A;  1UM1 A;  2L97 A;  5HFC A;  3R68 A;  3SHU A;  2OSG A;  1UEQ A;  4L8N A;  3E17 A;  4XHV A;  2JIN A;  1V62 A;  2G5M B;  1U38 A;  2EEG A;  5B6L A;  1N7E A;  4MPA A;  5HED A;  2EDZ A;  2QT5 A;  4P2A B;  2PZD A;  2M0V A;  1OZI A;  4YYX A;  2EEI A;  2EGO A;  2EGK A;  3WKL A;  1V6B A;  5F3X A;  1XZ9 A;  2DAZ A;  1NTE A;  2E7K A;  2OPG A;  1W9E A;  2H2C A;  5GLJ A;  2QG1 A;  2DLU A;  2ZPL A;  4NMV A;  1UJV A;  1ZUB A;  4R2Z A;  2KPK A;  2KAW A;  4K6Y A;  4Q6H A;  1KY9 A;  1Z87 A;  1WIF A;  3GCN A;  1KEF A;  1WG6 A;  4O06 A;  1P1D A;  1UIT A;  2M3M A;  2GZV A;  4LMM A;  3AXA A;  3GJ9 A;  2H2B A;  1UJD A;  2H3M A;  1FC6 A;  4JOF A;  5E22 A;  2IWQ A;  1GM1 A;  2MHO A;  1U37 A;  3GGE A;  3CBZ A;  1Z86 A;  1V5Q A;  1IU0 A;  2EXG A;  1QAV B;  2KOM A;  2Z9I A;  1UM7 A;  3GSL A;  3ID2 A;  2LOB A;  2VZ5 A;  2V90 A;  2Q9V A;  5H3J A;  1N6E A;  1WFG A;  3QJM A;  1UJU A;  3LNX A;  3MH7 A;  4K75 A;  3QGL A;  4PQW A;  3NGH A;  1L6O A;  4UU5 A;  1N99 A;  1TP5 A;  1FC9 A;  1WH1 A;  2YT7 A;  5HF1 A;  4E35 A;  2VPH A;  5HFD A;  1Q7X A;  3I4W A;  3HVQ C;  2LC7 A;  2OZF A;  2YTW A;  1TP3 A;  4IC6 A;  1R6J A;  4JOJ A;  1G9O A;  2LUI A;  2QKU A;  5HFE A;  1LCY A;  1X5N A;  4Z8J A;  1BFE A;  1W9Q A;  2KOH A;  4KFV A;  2DLS A;  2VSP A;  4NMT A;  4GVC A;  2OGP A;  2JWE A;  1B8Q A;  5FB8 C;  2OMJ A;  1UF1 A;  1ZOK A;  2JIL A;  1X6D A;  5G1E A;  1P1E A;  2K20 A;  2EJY A;  4NMR A;  4P0C A;  5HFF A;  3VQG A;  3NFK A;  4Q3H A;  1FCF A;  4K78 A;  3KHF A;  1MFG A;  4Q2P A;  3K82 A;  4NXR A;  3DJA A;  2DB5 A;  3SUZ A;  2I6V A;  1X5R A;  2KRG A;  2EEJ A;  4NXP A;  1VA8 A;  2QBW A;  1GQ5 A;  1I16 A;  3PV2 A;  1Q3O A;  3DOR A;  1VAE A;  4NMQ A;  2KJK A;  2G2L A;  1KWA A;  2R4H A;  1UEW A;  2K1Z A;  1V5L A;  2W4F A;  4KFW A;  1V1T A;  2I0I A;  2CSJ A;  1QLC A;  2YUB A;  2HE2 A;  2VSV A;  4HOP B;  1N7T A;  2I1N A;  2FN5 A;  3DJ3 A;  2KV8 A;  3ID3 A;  4EDJ A;  1VCW A;  2M10 A;  1D5G A;  1PDR A;  2MX6 A;  4K76 A;  3PV5 A;  2FNE A;  2OS6 A;  4GVD A;  3QE1 A;  3PDV A;  5E21 A;  2DM8 A;  1WI4 A;  4HOP A;  2DJT A;  2PKT A;  2I04 A;  3QDO A;  2KG2 A;  2HE4 A;  3QO6 A;  2I0L A;  3CYY A;  1OBZ A;  4OEO A;  5G1D A;  5HEB A;  2IWO A;  3SOE A;  4RI0 A;  2D8I A;  5GND A;  5E11 A;  2EHR A;  3TMH A;  4AMH A;  2RRM A;  4NXQ A;  3ZRT A;  1QAV A;  2FCF A;  2YT8 A;  3TSZ A;  5I7Z A;  2KPL A;  1RGW A;  1WHD A;  1U3B A;  1N6F A;  2QKT A;  3HPM A;  3GCO A;  3RLE A;  2DMZ A;  3WKM A;  3MH6 A;  4H11 A;  1WI2 A;  2RCZ A;  2EAQ A;  3R69 A;  4JOP A;  1UEP A;  3DIW A;  1U39 A;  3KZD A;  2ZPM A;  2BYG A;  3PV4 A;  3HPK A;  1OBX A;  2V1W A;  5HEY A;  2X7Z A;  3CBY A;  1RZX A;  3QJN A;  4OAJ A;  3NFL A;  3RL8 A;  2KBS A;  1VJ6 A;  3DJ1 A;  3BPU A;  2M0Z A;  1WHA A;  3L4F D;  2L4S A;  4Q2N A;  2KA9 A;  3GDV A;  3I18 A;  2EV8 A;  2H3L A;  2FE5 A;  4GHN A;  2D90 A;  2JXO A;  2KL1 A;  1YBO A;  1BE9 A;  2KYL A;  2EGN A;  2IWN A;  1RGR A;  1I92 A;  1NF3 C;  3STJ A;  3OTP A;  4UU6 A;  3GDU A;  1IU2 A;  2REY A;  2KQF A;  3SFJ A;  1WF8 A;  2PNT A;  2L4T A;  4JOE A;  3B76 A;  2EDP A;  2YUY A;  2O2T A;  2Z17 A;  5HDY A;  4JOG A;  1SOT A;  3I1E A;  1TE0 A;  1MC7 A;  4N6X A;  4NNM A;  3GDS A;  2CSS A;  5D13 A;  5E1Y A; 
#chains in the Genus database with same CATH topology
 2F0A A;  3PDZ A;  1X8S A;  2D92 A;  4WYT A;  4WYU A;  5E6P B;  3TSV A;  1Q3P A;  1OBY A;  1UHP A;  4G69 A;  1N7F A;  3KZE A;  4NNL A;  4OEP A;  3O46 A;  2HGA A;  3K1R A;  1Y7N A;  2EDV A;  4F8K A;  2GEF A;  2DC2 A;  1Y8T A;  1IHJ A;  2P3W A;  3OU0 A;  1W9O A;  2UZC A;  3K50 A;  1UEZ A;  3QIK A;  3LNY A;  3CS0 A;  2KJP A;  4FLN A;  1SOZ A;  4Q6S A;  3ID1 A;  5HET A;  5FHT A;  5HFB A;  1WF7 A;  1TQ3 A;  1N6D A;  1X45 A;  2M0T A;  5EZ0 A;  2VRF A;  3ID4 A;  3EGH C;  2R3Y A;  3O5N A;  2QKV A;  2WL7 A;  4JL7 A;  2JRE A;  2LC6 A;  4K72 A;  2LA8 A;  2AIN A;  2PKU A;  1FC7 A;  3CC0 A;  1VB7 A;  4Q2O A;  3JXT A;  1MFL A;  2EEH A;  2DKR A;  2M0U A;  5F67 A;  4JOR A;  2AWU A;  4NMO A;  1T2M A;  1WFV A;  2JIK A;  5A2P A;  5EYZ A;  4YDP A;  4E34 A;  3MH4 A;  3CH8 A;  5HF4 A;  2JOA A;  2KJD A;  1RY4 A;  2IWP A;  2PDZ A;  4NMS A;  3RL7 A;  1WJL A;  4JOK A;  2F5Y A;  4Z33 A;  1GQ4 A;  2Q3G A;  2OCS A;  1M5Z A;  2ENO A;  5HJ1 A;  3CBX A;  4JOH A;  1X9Z A;  3SHW A;  5ILB A;  1UFX A;  3EGG C;  3R0H A;  3PS4 A;  3TSW A;  5DTH A;  2PA1 A;  2I4S A;  5JXB A;  1QAU A;  2OQS A;  2KOJ A;  4REY A;  4E3B A;  2CS5 A;  1K32 A;  3VQF A;  2AWX A;  2W7R A;  2AWW A;  1X5Q A;  4NMP A;  4FGM A;  4Q2Q A;  3FY5 A;  2VWR A;  1UM1 A;  2L97 A;  5HFC A;  3R68 A;  3SHU A;  2OSG A;  1UEQ A;  4L8N A;  3E17 A;  4XHV A;  2JIN A;  1V62 A;  2G5M B;  1U38 A;  2EEG A;  5B6L A;  1N7E A;  4MPA A;  5HED A;  2EDZ A;  2QT5 A;  4P2A B;  2PZD A;  2M0V A;  1OZI A;  4YYX A;  2EEI A;  2EGO A;  2EGK A;  3WKL A;  1V6B A;  5F3X A;  1XZ9 A;  2DAZ A;  1NTE A;  2E7K A;  2OPG A;  1W9E A;  2H2C A;  5GLJ A;  2QG1 A;  2DLU A;  2ZPL A;  4NMV A;  1UJV A;  1ZUB A;  4R2Z A;  2KPK A;  2KAW A;  4K6Y A;  4Q6H A;  1KY9 A;  1Z87 A;  1WIF A;  3GCN A;  1KEF A;  1WG6 A;  4O06 A;  1P1D A;  1UIT A;  2M3M A;  2GZV A;  4LMM A;  3AXA A;  3GJ9 A;  2H2B A;  1UJD A;  2H3M A;  1FC6 A;  4JOF A;  5E22 A;  2IWQ A;  1GM1 A;  2MHO A;  1U37 A;  3GGE A;  3CBZ A;  1Z86 A;  1V5Q A;  1IU0 A;  2EXG A;  1QAV B;  2KOM A;  2Z9I A;  1UM7 A;  3GSL A;  3ID2 A;  2LOB A;  2VZ5 A;  2V90 A;  2Q9V A;  5H3J A;  1N6E A;  1WFG A;  3QJM A;  1UJU A;  3LNX A;  3MH7 A;  4K75 A;  3QGL A;  4PQW A;  3NGH A;  1L6O A;  4UU5 A;  1N99 A;  1TP5 A;  1FC9 A;  1WH1 A;  2YT7 A;  5HF1 A;  4E35 A;  2VPH A;  5HFD A;  1Q7X A;  3I4W A;  3HVQ C;  2LC7 A;  2OZF A;  2YTW A;  1TP3 A;  4IC6 A;  1R6J A;  4JOJ A;  1G9O A;  2LUI A;  2QKU A;  5HFE A;  1LCY A;  1X5N A;  2JSN A;  4Z8J A;  1BFE A;  1W9Q A;  4JJ3 A;  2KOH A;  4KFV A;  2DLS A;  2VSP A;  4NMT A;  4GVC A;  2OGP A;  2JWE A;  1B8Q A;  5FB8 C;  2OMJ A;  1UF1 A;  1ZOK A;  2JIL A;  1X6D A;  5G1E A;  1P1E A;  2K20 A;  2EJY A;  4NMR A;  4P0C A;  5HFF A;  3VQG A;  3NFK A;  4Q3H A;  1FCF A;  4K78 A;  3KHF A;  1MFG A;  4Q2P A;  3K82 A;  4NXR A;  3DJA A;  2DB5 A;  3SUZ A;  2I6V A;  1X5R A;  2KRG A;  2EEJ A;  4NXP A;  1VA8 A;  2QBW A;  1GQ5 A;  1I16 A;  3PV2 A;  1Q3O A;  3DOR A;  1VAE A;  4NMQ A;  3NCV A;  2KJK A;  2G2L A;  1KWA A;  2R4H A;  3KDG A;  1UEW A;  2K1Z A;  1V5L A;  2W4F A;  4KFW A;  1V1T A;  2I0I A;  2CSJ A;  1QLC A;  2YUB A;  2HE2 A;  2VSV A;  4HOP B;  5B42 A;  1N7T A;  2I1N A;  2FN5 A;  3DJ3 A;  2KV8 A;  3ID3 A;  4EDJ A;  1VCW A;  2M10 A;  1D5G A;  1PDR A;  2MX6 A;  4K76 A;  3PV5 A;  2FNE A;  2OS6 A;  4GVD A;  3QE1 A;  3PDV A;  5E21 A;  2DM8 A;  1WI4 A;  4HOP A;  2DJT A;  2PKT A;  2I04 A;  3QDO A;  2KG2 A;  2HE4 A;  3QO6 A;  2I0L A;  3CYY A;  1OBZ A;  4OEO A;  5G1D A;  5HEB A;  2IWO A;  3SOE A;  4RI0 A;  2D8I A;  5GND A;  5E11 A;  2EHR A;  3TMH A;  4AMH A;  2RRM A;  4NXQ A;  3ZRT A;  1QAV A;  2FCF A;  2YT8 A;  3TSZ A;  5I7Z A;  2KPL A;  1RGW A;  1WHD A;  1U3B A;  1N6F A;  2QKT A;  3HPM A;  3GCO A;  3RLE A;  3GAB A;  2DMZ A;  3WKM A;  3MH6 A;  4H11 A;  1WI2 A;  2RCZ A;  2EAQ A;  3R69 A;  4JOP A;  1UEP A;  3DIW A;  1U39 A;  3KZD A;  2ZPM A;  2BYG A;  3PV4 A;  3HPK A;  1OBX A;  2V1W A;  5HEY A;  2X7Z A;  5IL9 A;  3CBY A;  1RZX A;  3QJN A;  4OAJ A;  3NFL A;  3RL8 A;  2KBS A;  1VJ6 A;  3DJ1 A;  3KDK A;  3BPU A;  2M0Z A;  1WHA A;  3L4F D;  2L4S A;  4Q2N A;  2KA9 A;  3GDV A;  3I18 A;  2EV8 A;  2H3L A;  2FE5 A;  4GHN A;  2D90 A;  2JXO A;  2KL1 A;  1YBO A;  1BE9 A;  2KYL A;  2EGN A;  2IWN A;  1RGR A;  1I92 A;  1NF3 C;  3STJ A;  3OTP A;  4UU6 A;  3GDU A;  1IU2 A;  2REY A;  2KQF A;  3SFJ A;  1WF8 A;  2PNT A;  2L4T A;  4JOE A;  3B76 A;  2EDP A;  2YUY A;  2O2T A;  2Z17 A;  5HDY A;  4JOG A;  1SOT A;  3I1E A;  1TE0 A;  1MC7 A;  4JJ0 A;  4N6X A;  4NNM A;  3GDS A;  2CSS A;  5D13 A;  5E1Y A; 
#chains in the Genus database with same CATH homology
 2F0A A;  3PDZ A;  1X8S A;  2D92 A;  4WYT A;  4WYU A;  5E6P B;  3TSV A;  1Q3P A;  1OBY A;  1UHP A;  4G69 A;  1N7F A;  3KZE A;  4NNL A;  4OEP A;  3O46 A;  2HGA A;  3K1R A;  1Y7N A;  2EDV A;  4F8K A;  2GEF A;  2DC2 A;  1Y8T A;  1IHJ A;  2P3W A;  3OU0 A;  1W9O A;  2UZC A;  3K50 A;  1UEZ A;  3QIK A;  3LNY A;  3CS0 A;  2KJP A;  4FLN A;  1SOZ A;  4Q6S A;  3ID1 A;  5HET A;  5FHT A;  5HFB A;  1WF7 A;  1TQ3 A;  1N6D A;  1X45 A;  2M0T A;  5EZ0 A;  2VRF A;  3ID4 A;  3EGH C;  2R3Y A;  3O5N A;  2QKV A;  2WL7 A;  4JL7 A;  2JRE A;  2LC6 A;  4K72 A;  2LA8 A;  2AIN A;  2PKU A;  1FC7 A;  3CC0 A;  1VB7 A;  4Q2O A;  3JXT A;  1MFL A;  2EEH A;  2DKR A;  2M0U A;  5F67 A;  4JOR A;  2AWU A;  4NMO A;  1T2M A;  1WFV A;  2JIK A;  5A2P A;  5EYZ A;  4YDP A;  4E34 A;  3MH4 A;  3CH8 A;  5HF4 A;  2JOA A;  2KJD A;  1RY4 A;  2IWP A;  2PDZ A;  4NMS A;  3RL7 A;  1WJL A;  4JOK A;  2F5Y A;  4Z33 A;  1GQ4 A;  2Q3G A;  2OCS A;  1M5Z A;  2ENO A;  5HJ1 A;  3CBX A;  4JOH A;  1X9Z A;  3SHW A;  5ILB A;  1UFX A;  3EGG C;  3R0H A;  3PS4 A;  3TSW A;  5DTH A;  2PA1 A;  2I4S A;  5JXB A;  1QAU A;  2OQS A;  2KOJ A;  4REY A;  4E3B A;  2CS5 A;  1K32 A;  3VQF A;  2AWX A;  2W7R A;  2AWW A;  1X5Q A;  4NMP A;  4FGM A;  4Q2Q A;  3FY5 A;  2VWR A;  1UM1 A;  2L97 A;  5HFC A;  3R68 A;  3SHU A;  2OSG A;  1UEQ A;  4L8N A;  3E17 A;  4XHV A;  2JIN A;  1V62 A;  2G5M B;  1U38 A;  2EEG A;  5B6L A;  1N7E A;  4MPA A;  5HED A;  2EDZ A;  2QT5 A;  4P2A B;  2PZD A;  2M0V A;  1OZI A;  4YYX A;  2EEI A;  2EGO A;  2EGK A;  3WKL A;  1V6B A;  5F3X A;  1XZ9 A;  2DAZ A;  1NTE A;  2E7K A;  2OPG A;  1W9E A;  2H2C A;  5GLJ A;  2QG1 A;  2DLU A;  2ZPL A;  4NMV A;  1UJV A;  1ZUB A;  4R2Z A;  2KPK A;  2KAW A;  4K6Y A;  4Q6H A;  1KY9 A;  1Z87 A;  1WIF A;  3GCN A;  1KEF A;  1WG6 A;  4O06 A;  1P1D A;  1UIT A;  2M3M A;  2GZV A;  4LMM A;  3AXA A;  3GJ9 A;  2H2B A;  1UJD A;  2H3M A;  1FC6 A;  4JOF A;  5E22 A;  2IWQ A;  1GM1 A;  2MHO A;  1U37 A;  3GGE A;  3CBZ A;  1Z86 A;  1V5Q A;  1IU0 A;  2EXG A;  1QAV B;  2KOM A;  2Z9I A;  1UM7 A;  3GSL A;  3ID2 A;  2LOB A;  2VZ5 A;  2V90 A;  2Q9V A;  5H3J A;  1N6E A;  1WFG A;  3QJM A;  1UJU A;  3LNX A;  3MH7 A;  4K75 A;  3QGL A;  4PQW A;  3NGH A;  1L6O A;  4UU5 A;  1N99 A;  1TP5 A;  1FC9 A;  1WH1 A;  2YT7 A;  5HF1 A;  4E35 A;  2VPH A;  5HFD A;  1Q7X A;  3I4W A;  3HVQ C;  2LC7 A;  2OZF A;  2YTW A;  1TP3 A;  4IC6 A;  1R6J A;  4JOJ A;  1G9O A;  2LUI A;  2QKU A;  5HFE A;  1LCY A;  1X5N A;  2JSN A;  4Z8J A;  1BFE A;  1W9Q A;  4JJ3 A;  2KOH A;  4KFV A;  2DLS A;  2VSP A;  4NMT A;  4GVC A;  2OGP A;  2JWE A;  1B8Q A;  5FB8 C;  2OMJ A;  1UF1 A;  1ZOK A;  2JIL A;  1X6D A;  5G1E A;  1P1E A;  2K20 A;  2EJY A;  4NMR A;  4P0C A;  5HFF A;  3VQG A;  3NFK A;  4Q3H A;  1FCF A;  4K78 A;  3KHF A;  1MFG A;  4Q2P A;  3K82 A;  4NXR A;  3DJA A;  2DB5 A;  3SUZ A;  2I6V A;  1X5R A;  2KRG A;  2EEJ A;  4NXP A;  1VA8 A;  2QBW A;  1GQ5 A;  1I16 A;  3PV2 A;  1Q3O A;  3DOR A;  1VAE A;  4NMQ A;  3NCV A;  2KJK A;  2G2L A;  1KWA A;  2R4H A;  3KDG A;  1UEW A;  2K1Z A;  1V5L A;  2W4F A;  4KFW A;  1V1T A;  2I0I A;  2CSJ A;  1QLC A;  2YUB A;  2HE2 A;  2VSV A;  4HOP B;  5B42 A;  1N7T A;  2I1N A;  2FN5 A;  3DJ3 A;  2KV8 A;  3ID3 A;  4EDJ A;  1VCW A;  2M10 A;  1D5G A;  1PDR A;  2MX6 A;  4K76 A;  3PV5 A;  2FNE A;  2OS6 A;  4GVD A;  3QE1 A;  3PDV A;  5E21 A;  2DM8 A;  1WI4 A;  4HOP A;  2DJT A;  2PKT A;  2I04 A;  3QDO A;  2KG2 A;  2HE4 A;  3QO6 A;  2I0L A;  3CYY A;  1OBZ A;  4OEO A;  5G1D A;  5HEB A;  2IWO A;  3SOE A;  4RI0 A;  2D8I A;  5GND A;  5E11 A;  2EHR A;  3TMH A;  4AMH A;  2RRM A;  4NXQ A;  3ZRT A;  1QAV A;  2FCF A;  2YT8 A;  3TSZ A;  5I7Z A;  2KPL A;  1RGW A;  1WHD A;  1U3B A;  1N6F A;  2QKT A;  3HPM A;  3GCO A;  3RLE A;  3GAB A;  2DMZ A;  3WKM A;  3MH6 A;  4H11 A;  1WI2 A;  2RCZ A;  2EAQ A;  3R69 A;  4JOP A;  1UEP A;  3DIW A;  1U39 A;  3KZD A;  2ZPM A;  2BYG A;  3PV4 A;  3HPK A;  1OBX A;  2V1W A;  5HEY A;  2X7Z A;  5IL9 A;  3CBY A;  1RZX A;  3QJN A;  4OAJ A;  3NFL A;  3RL8 A;  2KBS A;  1VJ6 A;  3DJ1 A;  3KDK A;  3BPU A;  2M0Z A;  1WHA A;  3L4F D;  2L4S A;  4Q2N A;  2KA9 A;  3GDV A;  3I18 A;  2EV8 A;  2H3L A;  2FE5 A;  4GHN A;  2D90 A;  2JXO A;  2KL1 A;  1YBO A;  1BE9 A;  2KYL A;  2EGN A;  2IWN A;  1RGR A;  1I92 A;  1NF3 C;  3STJ A;  3OTP A;  4UU6 A;  3GDU A;  1IU2 A;  2REY A;  2KQF A;  3SFJ A;  1WF8 A;  2PNT A;  2L4T A;  4JOE A;  3B76 A;  2EDP A;  2YUY A;  2O2T A;  2Z17 A;  5HDY A;  4JOG A;  1SOT A;  3I1E A;  1TE0 A;  1MC7 A;  4JJ0 A;  4N6X A;  4NNM A;  3GDS A;  2CSS A;  5D13 A;  5E1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...