4Q3HA

The crystal structure of nherf1 pdz2 cxcr2 complex revealed by the nherf1 cxcr2 chimeric protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
LRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETSTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Na(+)/H(+) exchange regulatory cofactor NHE-RF1
publication title Crystal structure of the NHERF1 PDZ2 domain in complex with the chemokine receptor CXCR2 reveals probable modes of PDZ2 dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4q3hA00
3RL7A 1KY9A 3QJNA 4FGMA 4RI0A 4NNLA 4NMSA 2V90A 4GVDA 1IU2A 1MC7A 2JREA 2H3MA 5HFCA 2QKTA 2HGAA 4WYUA 3CBYA 2H3LA 2IWNA 1WI2A 2Z9IA 5HFEA 5GNDA 2YUYA 3QO6A 1UEQA 1WHAA 3DJAA 1WG6A 2DLUA 1VB7A 4K78A 5GLJA 2KQFA 4K72A 1WF7A 1FC7A 3SHUA 5A2PA 2VPHA 2KPKA 3CYYA 4JOHA 2EDVA 1P1EA 1UJVA 1UFXA 2CS5A 2P3WA 2REYA 3EGGC 1N7EA 1WIFA 2YTWA 2DJTA 2Q3GA 1VCWA 2I0LA 2H2CA 2DLSA 3PDZA 2M0VA 3FY5A 2M3MA 1L6OA 3E17A 3MH7A 3AXAA 3QE1A 2UZCA 3CS0A 1TQ3A 1B8QA 1G9OA 1D5GA 4XHVA 5HF4A 2WL7A 4OEOA 1R6JA 2BYGA 2QT5A 3CH8A 2IWPA 1FC6A 2IWOA 2EGKA 1IHJA 2JOAA 2QG1A 1UHPA 2M0UA 1Z86A 1V6BA 3PV4A 2KRGA 2EGOA 1NF3C 4JOKA 2VSVA 2M0TA 2QBWA 2GZVA 3DJ1A 1NTEA 1Y8TA 2KL1A 3KHFA 2YT7A 4NMPA 2KAWA 5I7ZA 1GQ5A 3GCOA 3HPKA 2JIKA 1Y7NA 4JOGA 3OTPA 2W4FA 2QKUA 3VQGA 1RY4A 1Z87A 2OSGA 3HVQC 2EHRA 2KOMA 4F8KA 3TSWA 1X5NA 2I1NA 2W7RA 2I4SA 2VSPA 5H3JA 3ID2A 4G69A 3GCNA 3QDOA 2M0ZA 1X6DA 1V1TA 2OZFA 3LNXA 1YBOA 2OCSA 2K1ZA 2ZPLA 1X5RA 2LC7A 1LCYA 2KJDA 2G5MB 2EJYA 1RGWA 3O46A 2AWWA 5HEDA 1MFGA 1QAVA 5D13A 1WH1A 1OBYA 5FB8C 2V1WA 1SOZA 1T2MA 2EDPA 4OAJA 4NMVA 5HFDA 1WJLA 1P1DA 3NGHA 2HE2A 2G2LA 5DTHA 1GM1A 4EDJA 1GQ4A 4Q2QA 1N6EA 1OBZA 1N7TA 4L8NA 1UITA 3I4WA 4NMQA 1N99A 3KZDA 4NNMA 1WHDA 2PNTA 1N7FA 2JILA 2JXOA 2OS6A 1PDRA 2EEGA 4HOPA 2HE4A 2MX6A 4AMHA 2MHOA 2RCZA 4P0CA 5B6LA 3BPUA 1ZUBA 3GJ9A 5HJ1A 4Q2OA 3OU0A 3KZEA 3TMHA 5EZ0A 2EGNA 2EAQA 4O06A 1UF1A 4YYXA 4NXQA 1W9OA 4H11A 2DC2A 3RLEA 5E6PB 2ZPMA 2PDZA 2Z17A 3SFJA 1FC9A 5HEYA 2PA1A 2EDZA 4JOJA 1TE0A 2FN5A 2I04A 3O5NA 1K32A 3TSZA 2EXGA 2I6VA 2YUBA 4YDPA 2JWEA 2RRMA 3DIWA 3SHWA 2KOJA 1BFEA 2CSJA 2KJKA 5JXBA 3GGEA 1UJUA 2F0AA 5EYZA 2OQSA 3GDVA 4Q6SA 2DB5A 2DAZA 2EV8A 3B76A 1OZIA 2DKRA 2PZDA 1UEPA 3HPMA 1Q7XA 4K6YA 2LUIA 3STJA 1VA8A 1N6DA 4GHNA 4P2AB 3K82A 1KWAA 1IU0A 4JORA 5FHTA 1WI4A 2CSSA 2EEIA 3GDSA 2VWRA 3RL8A 1WF8A 4Q2NA 5E1YA 2EEJA 1WFGA 5F67A 2DM8A 2R3YA 2M10A 3PDVA 2EEHA 4HOPB 3NFKA 2X7ZA 4NXPA 1VJ6A 3I18A 3R69A 3LNYA 3ZRTA 2KOHA 1FCFA 2LC6A 4N6XA 2F5YA 4KFVA 3DORA 3GSLA 1TP5A 2D8IA 1V5QA 2H2BA 2PKTA 2OPGA 4JOPA 4NXRA 5HF1A 2L4SA 2KYLA 4NMOA 2KG2A 1U37A 1V62A 4K75A 1UEWA 1UM7A 2QKVA 2L4TA 4IC6A 1QLCA 4JL7A 3SOEA 1U3BA 3K1RA 2DMZA 5HFBA 4OEPA 4Q2PA 2L97A 1UEZA 3MH6A 1W9EA 1VAEA 1Q3PA 1OBXA 2KBSA 4JOEA 3WKMA 1M5ZA 1SOTA 2I0IA 1KEFA 3VQFA 2VRFA 1RZXA 3SUZA 5HDYA 2K20A 2KPLA 4GVCA 5G1DA 4K76A 4WYTA 1X5QA 2D90A 3GDUA 1RGRA 1U39A 5G1EA 1W9QA 3ID4A 1QAUA 3QJMA 4PQWA 4NMRA 3CC0A 5E21A 2FCFA 4E34A 4LMMA 1Q3OA 5E11A 2OGPA 4Q3HA 3ID3A 2AINA 1I92A 3PS4A 3DJ3A 3EGHC 1UM1A 3L4FD 2PKUA 2R4HA 4JOFA 3I1EA 4E3BA 3CBXA 3R0HA 3NFLA 2KV8A 2Q9VA 2IWQA 1I16A 2O2TA 1BE9A 4Z33A 2LOBA 3PV5A 4UU6A 2AWXA 2FNEA 2LA8A 5E22A 4Z8JA 4MPAA 1MFLA 3JXTA 2ENOA 5F3XA 2FE5A 1ZOKA 1WFVA 4R2ZA 1XZ9A 3R68A 2VZ5A 3PV2A 1QAVB 3TSVA 3QIKA 4KFWA 4Q6HA 3MH4A 1X8SA 1TP3A 2YT8A 3CBZA 3QGLA 1N6FA 4REYA 4UU5A 2JINA 2E7KA 4NMTA 1UJDA 2AWUA 1U38A 2KA9A 3WKLA 3ID1A 2D92A 2KJPA 1V5LA 2OMJA 5HETA 1X45A 5HFFA 5HEBA 3K50A 4E35A
chains in the Genus database with same CATH superfamily
3RL7A 1KY9A 3QJNA 4FGMA 4RI0A 4NNLA 4NMSA 2V90A 4GVDA 1IU2A 1MC7A 2JREA 2H3MA 5HFCA 2QKTA 2HGAA 4WYUA 3CBYA 2H3LA 2IWNA 1WI2A 2Z9IA 5HFEA 5GNDA 2YUYA 3QO6A 1UEQA 1WHAA 3DJAA 1WG6A 2DLUA 1VB7A 4K78A 5GLJA 2KQFA 4K72A 1WF7A 1FC7A 3SHUA 5A2PA 2VPHA 2KPKA 3CYYA 4JOHA 2EDVA 1P1EA 1UJVA 1UFXA 2CS5A 2P3WA 2REYA 3EGGC 1N7EA 1WIFA 2YTWA 2DJTA 2Q3GA 1VCWA 2I0LA 2H2CA 2DLSA 3NCVA 3PDZA 2M0VA 3FY5A 2M3MA 1L6OA 3E17A 3MH7A 3AXAA 3QE1A 2UZCA 3CS0A 1TQ3A 1B8QA 1G9OA 1D5GA 4XHVA 5HF4A 2WL7A 4OEOA 1R6JA 2BYGA 2QT5A 3CH8A 2IWPA 1FC6A 2IWOA 2EGKA 1IHJA 2JOAA 2QG1A 1UHPA 2M0UA 1Z86A 1V6BA 3PV4A 2KRGA 2EGOA 1NF3C 4JOKA 2VSVA 2M0TA 2QBWA 2GZVA 3DJ1A 1NTEA 1Y8TA 2KL1A 3KHFA 2YT7A 4NMPA 2KAWA 5I7ZA 1GQ5A 3GCOA 1X9ZA 3HPKA 2JIKA 1Y7NA 4JOGA 3OTPA 2W4FA 2QKUA 3VQGA 1RY4A 1Z87A 2OSGA 3HVQC 2EHRA 2KOMA 4F8KA 3TSWA 1X5NA 2I1NA 2W7RA 2I4SA 2VSPA 5H3JA 3ID2A 4G69A 3GCNA 3QDOA 2M0ZA 1X6DA 1V1TA 2OZFA 3LNXA 1YBOA 2OCSA 2K1ZA 2ZPLA 1X5RA 2LC7A 1LCYA 2KJDA 2G5MB 2EJYA 1RGWA 3O46A 2AWWA 5HEDA 1MFGA 1QAVA 5D13A 1WH1A 1OBYA 5FB8C 2V1WA 1SOZA 1T2MA 2EDPA 4OAJA 4NMVA 5HFDA 1WJLA 1P1DA 3NGHA 2HE2A 2G2LA 5DTHA 1GM1A 4EDJA 1GQ4A 4Q2QA 1N6EA 1OBZA 1N7TA 4L8NA 1UITA 3I4WA 4NMQA 1N99A 3KZDA 4NNMA 1WHDA 2PNTA 1N7FA 2JILA 2JXOA 2OS6A 1PDRA 2EEGA 4HOPA 2HE4A 2MX6A 4AMHA 2MHOA 2RCZA 4P0CA 5B6LA 3BPUA 1ZUBA 3GJ9A 5HJ1A 4Q2OA 3OU0A 3KZEA 2GEFA 3TMHA 5EZ0A 2EGNA 2EAQA 4O06A 1UF1A 4YYXA 4NXQA 1W9OA 4H11A 2DC2A 3RLEA 5E6PB 2ZPMA 2PDZA 2Z17A 3SFJA 1FC9A 5HEYA 2PA1A 2EDZA 4JOJA 1TE0A 2FN5A 2I04A 3O5NA 1K32A 3TSZA 2EXGA 2I6VA 2YUBA 4YDPA 2JWEA 2RRMA 3DIWA 3SHWA 2KOJA 1BFEA 2CSJA 2KJKA 5JXBA 3GGEA 1UJUA 2F0AA 5EYZA 2OQSA 3GDVA 4Q6SA 2DB5A 2DAZA 2EV8A 3B76A 1OZIA 2DKRA 3GABA 2PZDA 1UEPA 3HPMA 1Q7XA 4K6YA 2LUIA 3STJA 1VA8A 1N6DA 4GHNA 4P2AB 3K82A 1KWAA 1IU0A 4JORA 5FHTA 1WI4A 2CSSA 2EEIA 3GDSA 2VWRA 3RL8A 1WF8A 4Q2NA 4JJ3A 5E1YA 2EEJA 1WFGA 5F67A 2DM8A 5IL9A 2R3YA 2M10A 3PDVA 2EEHA 4HOPB 3NFKA 2X7ZA 4NXPA 1VJ6A 3I18A 3R69A 3LNYA 3ZRTA 2KOHA 1FCFA 2LC6A 4N6XA 2F5YA 4KFVA 3DORA 3GSLA 1TP5A 2D8IA 1V5QA 2H2BA 2PKTA 2OPGA 4JOPA 4NXRA 5HF1A 2L4SA 2KYLA 4NMOA 2KG2A 5B42A 1U37A 1V62A 4K75A 1UEWA 1UM7A 2QKVA 4JJ0A 2L4TA 4IC6A 1QLCA 4JL7A 3SOEA 1U3BA 2DMZA 3K1RA 5ILBA 5HFBA 4OEPA 4Q2PA 2L97A 1UEZA 3MH6A 1W9EA 1VAEA 1Q3PA 1OBXA 2KBSA 4JOEA 3WKMA 1M5ZA 1SOTA 2I0IA 3KDGA 1KEFA 3VQFA 2VRFA 1RZXA 3SUZA 5HDYA 2K20A 2KPLA 4GVCA 5G1DA 4K76A 4WYTA 1X5QA 2D90A 3GDUA 1RGRA 1U39A 5G1EA 1W9QA 3ID4A 1QAUA 3QJMA 4PQWA 4NMRA 4FLNA 3CC0A 5E21A 2FCFA 4E34A 4LMMA 1Q3OA 5E11A 2OGPA 4Q3HA 3ID3A 2AINA 1I92A 3PS4A 3DJ3A 3EGHC 1UM1A 3L4FD 2PKUA 2R4HA 4JOFA 3I1EA 4E3BA 3CBXA 3R0HA 3NFLA 2KV8A 2Q9VA 2IWQA 1I16A 2O2TA 1BE9A 4Z33A 2LOBA 3PV5A 4UU6A 2AWXA 2FNEA 2LA8A 5E22A 4Z8JA 4MPAA 1MFLA 3JXTA 2ENOA 5F3XA 2FE5A 1ZOKA 1WFVA 4R2ZA 1XZ9A 3R68A 2VZ5A 3PV2A 1QAVB 3TSVA 3QIKA 4KFWA 4Q6HA 3MH4A 1X8SA 1TP3A 2YT8A 3CBZA 3QGLA 1N6FA 2JSNA 4REYA 4UU5A 2JINA 2E7KA 4NMTA 1UJDA 2AWUA 1U38A 2KA9A 3WKLA 3ID1A 2D92A 3KDKA 2KJPA 1V5LA 2OMJA 5HETA 1X45A 5HFFA 5HEBA 3K50A 4E35A
chains in the Genus database with same CATH topology
3RL7A 1KY9A 3QJNA 4FGMA 4RI0A 4NNLA 4NMSA 2V90A 4GVDA 1IU2A 1MC7A 2JREA 2H3MA 5HFCA 2QKTA 2HGAA 4WYUA 3CBYA 2H3LA 2IWNA 1WI2A 2Z9IA 5HFEA 5GNDA 2YUYA 3QO6A 1UEQA 1WHAA 3DJAA 1WG6A 2DLUA 1VB7A 4K78A 5GLJA 2KQFA 4K72A 1WF7A 1FC7A 3SHUA 5A2PA 2VPHA 2KPKA 3CYYA 4JOHA 2EDVA 1P1EA 1UJVA 1UFXA 2CS5A 2P3WA 2REYA 3EGGC 1N7EA 1WIFA 2YTWA 2DJTA 2Q3GA 1VCWA 2I0LA 2H2CA 2DLSA 3NCVA 3PDZA 2M0VA 3FY5A 2M3MA 1L6OA 3E17A 3MH7A 3AXAA 3QE1A 2UZCA 3CS0A 1TQ3A 1B8QA 1G9OA 1D5GA 4XHVA 5HF4A 2WL7A 4OEOA 1R6JA 2BYGA 2QT5A 3CH8A 2IWPA 1FC6A 2IWOA 2EGKA 1IHJA 2JOAA 2QG1A 1UHPA 2M0UA 1Z86A 1V6BA 3PV4A 2KRGA 2EGOA 1NF3C 4JOKA 2VSVA 2M0TA 2QBWA 2GZVA 3DJ1A 1NTEA 1Y8TA 2KL1A 3KHFA 2YT7A 4NMPA 2KAWA 5I7ZA 1GQ5A 3GCOA 1X9ZA 3HPKA 2JIKA 1Y7NA 4JOGA 3OTPA 2W4FA 2QKUA 3VQGA 1RY4A 1Z87A 2OSGA 3HVQC 2EHRA 2KOMA 4F8KA 3TSWA 1X5NA 2I1NA 2W7RA 2I4SA 2VSPA 5H3JA 3ID2A 4G69A 3GCNA 3QDOA 2M0ZA 1X6DA 1V1TA 2OZFA 3LNXA 1YBOA 2OCSA 2K1ZA 2ZPLA 1X5RA 2LC7A 1LCYA 2KJDA 2G5MB 2EJYA 1RGWA 3O46A 2AWWA 5HEDA 1MFGA 1QAVA 5D13A 1WH1A 1OBYA 5FB8C 2V1WA 1SOZA 1T2MA 2EDPA 4OAJA 4NMVA 5HFDA 1WJLA 1P1DA 3NGHA 2HE2A 2G2LA 5DTHA 1GM1A 4EDJA 1GQ4A 4Q2QA 1N6EA 1OBZA 1N7TA 4L8NA 1UITA 3I4WA 4NMQA 1N99A 3KZDA 4NNMA 1WHDA 2PNTA 1N7FA 2JILA 2JXOA 2OS6A 1PDRA 2EEGA 4HOPA 2HE4A 2MX6A 4AMHA 2MHOA 2RCZA 4P0CA 5B6LA 3BPUA 1ZUBA 3GJ9A 5HJ1A 4Q2OA 3OU0A 3KZEA 2GEFA 3TMHA 5EZ0A 2EGNA 2EAQA 4O06A 1UF1A 4YYXA 4NXQA 1W9OA 4H11A 2DC2A 3RLEA 5E6PB 2ZPMA 2PDZA 2Z17A 3SFJA 1FC9A 5HEYA 2PA1A 2EDZA 4JOJA 1TE0A 2FN5A 2I04A 3O5NA 1K32A 3TSZA 2EXGA 2I6VA 2YUBA 4YDPA 2JWEA 2RRMA 3DIWA 3SHWA 2KOJA 1BFEA 2CSJA 2KJKA 5JXBA 3GGEA 1UJUA 2F0AA 5EYZA 2OQSA 3GDVA 4Q6SA 2DB5A 2DAZA 2EV8A 3B76A 1OZIA 2DKRA 3GABA 2PZDA 1UEPA 3HPMA 1Q7XA 4K6YA 2LUIA 3STJA 1VA8A 1N6DA 4GHNA 4P2AB 3K82A 1KWAA 1IU0A 4JORA 5FHTA 1WI4A 2CSSA 2EEIA 3GDSA 2VWRA 3RL8A 1WF8A 4Q2NA 4JJ3A 5E1YA 2EEJA 1WFGA 5F67A 2DM8A 5IL9A 2R3YA 2M10A 3PDVA 2EEHA 4HOPB 3NFKA 2X7ZA 4NXPA 1VJ6A 3I18A 3R69A 3LNYA 3ZRTA 2KOHA 1FCFA 2LC6A 4N6XA 2F5YA 4KFVA 3DORA 3GSLA 1TP5A 2D8IA 1V5QA 2H2BA 2PKTA 2OPGA 4JOPA 4NXRA 5HF1A 2L4SA 2KYLA 4NMOA 2KG2A 5B42A 1U37A 1V62A 4K75A 1UEWA 1UM7A 2QKVA 4JJ0A 2L4TA 4IC6A 1QLCA 4JL7A 3SOEA 1U3BA 2DMZA 3K1RA 5ILBA 5HFBA 4OEPA 4Q2PA 2L97A 1UEZA 3MH6A 1W9EA 1VAEA 1Q3PA 1OBXA 2KBSA 4JOEA 3WKMA 1M5ZA 1SOTA 2I0IA 3KDGA 1KEFA 3VQFA 2VRFA 1RZXA 3SUZA 5HDYA 2K20A 2KPLA 4GVCA 5G1DA 4K76A 4WYTA 1X5QA 2D90A 3GDUA 1RGRA 1U39A 5G1EA 1W9QA 3ID4A 1QAUA 3QJMA 4PQWA 4NMRA 4FLNA 3CC0A 5E21A 2FCFA 4E34A 4LMMA 1Q3OA 5E11A 2OGPA 4Q3HA 3ID3A 2AINA 1I92A 3PS4A 3DJ3A 3EGHC 1UM1A 3L4FD 2PKUA 2R4HA 4JOFA 3I1EA 4E3BA 3CBXA 3R0HA 3NFLA 2KV8A 2Q9VA 2IWQA 1I16A 2O2TA 1BE9A 4Z33A 2LOBA 3PV5A 4UU6A 2AWXA 2FNEA 2LA8A 5E22A 4Z8JA 4MPAA 1MFLA 3JXTA 2ENOA 5F3XA 2FE5A 1ZOKA 1WFVA 4R2ZA 1XZ9A 3R68A 2VZ5A 3PV2A 1QAVB 3TSVA 3QIKA 4KFWA 4Q6HA 3MH4A 1X8SA 1TP3A 2YT8A 3CBZA 3QGLA 1N6FA 2JSNA 4REYA 4UU5A 2JINA 2E7KA 4NMTA 1UJDA 2AWUA 1U38A 2KA9A 3WKLA 3ID1A 2D92A 3KDKA 2KJPA 1V5LA 2OMJA 5HETA 1X45A 5HFFA 5HEBA 3K50A 4E35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL7 A;  1KY9 A;  3QJN A;  4FGM A;  4RI0 A;  4NNL A;  4NMS A;  2V90 A;  4GVD A;  1IU2 A;  1MC7 A;  2JRE A;  2H3M A;  5HFC A;  2QKT A;  2HGA A;  4WYU A;  3CBY A;  2H3L A;  2IWN A;  1WI2 A;  2Z9I A;  5HFE A;  5GND A;  2YUY A;  3QO6 A;  1UEQ A;  1WHA A;  3DJA A;  1WG6 A;  2DLU A;  1VB7 A;  4K78 A;  5GLJ A;  2KQF A;  4K72 A;  1WF7 A;  1FC7 A;  3SHU A;  5A2P A;  2VPH A;  2KPK A;  3CYY A;  4JOH A;  2EDV A;  1P1E A;  1UJV A;  1UFX A;  2CS5 A;  2P3W A;  2REY A;  3EGG C;  1N7E A;  1WIF A;  2YTW A;  2DJT A;  2Q3G A;  1VCW A;  2I0L A;  2H2C A;  2DLS A;  3PDZ A;  2M0V A;  3FY5 A;  2M3M A;  1L6O A;  3E17 A;  3MH7 A;  3AXA A;  3QE1 A;  2UZC A;  3CS0 A;  1TQ3 A;  1B8Q A;  1G9O A;  1D5G A;  4XHV A;  5HF4 A;  2WL7 A;  4OEO A;  1R6J A;  2BYG A;  2QT5 A;  3CH8 A;  2IWP A;  1FC6 A;  2IWO A;  2EGK A;  1IHJ A;  2JOA A;  2QG1 A;  1UHP A;  2M0U A;  1Z86 A;  1V6B A;  3PV4 A;  2KRG A;  2EGO A;  1NF3 C;  4JOK A;  2VSV A;  2M0T A;  2QBW A;  2GZV A;  3DJ1 A;  1NTE A;  1Y8T A;  2KL1 A;  3KHF A;  2YT7 A;  4NMP A;  2KAW A;  5I7Z A;  1GQ5 A;  3GCO A;  3HPK A;  2JIK A;  1Y7N A;  4JOG A;  3OTP A;  2W4F A;  2QKU A;  3VQG A;  1RY4 A;  1Z87 A;  2OSG A;  3HVQ C;  2EHR A;  2KOM A;  4F8K A;  3TSW A;  1X5N A;  2I1N A;  2W7R A;  2I4S A;  2VSP A;  5H3J A;  3ID2 A;  4G69 A;  3GCN A;  3QDO A;  2M0Z A;  1X6D A;  1V1T A;  2OZF A;  3LNX A;  1YBO A;  2OCS A;  2K1Z A;  2ZPL A;  1X5R A;  2LC7 A;  1LCY A;  2KJD A;  2G5M B;  2EJY A;  1RGW A;  3O46 A;  2AWW A;  5HED A;  1MFG A;  1QAV A;  5D13 A;  1WH1 A;  1OBY A;  5FB8 C;  2V1W A;  1SOZ A;  1T2M A;  2EDP A;  4OAJ A;  4NMV A;  5HFD A;  1WJL A;  1P1D A;  3NGH A;  2HE2 A;  2G2L A;  5DTH A;  1GM1 A;  4EDJ A;  1GQ4 A;  4Q2Q A;  1N6E A;  1OBZ A;  1N7T A;  4L8N A;  1UIT A;  3I4W A;  4NMQ A;  1N99 A;  3KZD A;  4NNM A;  1WHD A;  2PNT A;  1N7F A;  2JIL A;  2JXO A;  2OS6 A;  1PDR A;  2EEG A;  4HOP A;  2HE4 A;  2MX6 A;  4AMH A;  2MHO A;  2RCZ A;  4P0C A;  5B6L A;  3BPU A;  1ZUB A;  3GJ9 A;  5HJ1 A;  4Q2O A;  3OU0 A;  3KZE A;  3TMH A;  5EZ0 A;  2EGN A;  2EAQ A;  4O06 A;  1UF1 A;  4YYX A;  4NXQ A;  1W9O A;  4H11 A;  2DC2 A;  3RLE A;  5E6P B;  2ZPM A;  2PDZ A;  2Z17 A;  3SFJ A;  1FC9 A;  5HEY A;  2PA1 A;  2EDZ A;  4JOJ A;  1TE0 A;  2FN5 A;  2I04 A;  3O5N A;  1K32 A;  3TSZ A;  2EXG A;  2I6V A;  2YUB A;  4YDP A;  2JWE A;  2RRM A;  3DIW A;  3SHW A;  2KOJ A;  1BFE A;  2CSJ A;  2KJK A;  5JXB A;  3GGE A;  1UJU A;  2F0A A;  5EYZ A;  2OQS A;  3GDV A;  4Q6S A;  2DB5 A;  2DAZ A;  2EV8 A;  3B76 A;  1OZI A;  2DKR A;  2PZD A;  1UEP A;  3HPM A;  1Q7X A;  4K6Y A;  2LUI A;  3STJ A;  1VA8 A;  1N6D A;  4GHN A;  4P2A B;  3K82 A;  1KWA A;  1IU0 A;  4JOR A;  5FHT A;  1WI4 A;  2CSS A;  2EEI A;  3GDS A;  2VWR A;  3RL8 A;  1WF8 A;  4Q2N A;  5E1Y A;  2EEJ A;  1WFG A;  5F67 A;  2DM8 A;  2R3Y A;  2M10 A;  3PDV A;  2EEH A;  4HOP B;  3NFK A;  2X7Z A;  4NXP A;  1VJ6 A;  3I18 A;  3R69 A;  3LNY A;  3ZRT A;  2KOH A;  1FCF A;  2LC6 A;  4N6X A;  2F5Y A;  4KFV A;  3DOR A;  3GSL A;  1TP5 A;  2D8I A;  1V5Q A;  2H2B A;  2PKT A;  2OPG A;  4JOP A;  4NXR A;  5HF1 A;  2L4S A;  2KYL A;  4NMO A;  2KG2 A;  1U37 A;  1V62 A;  4K75 A;  1UEW A;  1UM7 A;  2QKV A;  2L4T A;  4IC6 A;  1QLC A;  4JL7 A;  3SOE A;  1U3B A;  3K1R A;  2DMZ A;  5HFB A;  4OEP A;  4Q2P A;  2L97 A;  1UEZ A;  3MH6 A;  1W9E A;  1VAE A;  1Q3P A;  1OBX A;  2KBS A;  4JOE A;  3WKM A;  1M5Z A;  1SOT A;  2I0I A;  1KEF A;  3VQF A;  2VRF A;  1RZX A;  3SUZ A;  5HDY A;  2K20 A;  2KPL A;  4GVC A;  5G1D A;  4K76 A;  4WYT A;  1X5Q A;  2D90 A;  3GDU A;  1RGR A;  1U39 A;  5G1E A;  1W9Q A;  3ID4 A;  1QAU A;  3QJM A;  4PQW A;  4NMR A;  3CC0 A;  5E21 A;  2FCF A;  4E34 A;  4LMM A;  1Q3O A;  5E11 A;  2OGP A;  4Q3H A;  3ID3 A;  2AIN A;  1I92 A;  3PS4 A;  3DJ3 A;  3EGH C;  1UM1 A;  3L4F D;  2PKU A;  2R4H A;  4JOF A;  3I1E A;  4E3B A;  3CBX A;  3R0H A;  3NFL A;  2KV8 A;  2Q9V A;  2IWQ A;  1I16 A;  2O2T A;  1BE9 A;  4Z33 A;  2LOB A;  3PV5 A;  4UU6 A;  2AWX A;  2FNE A;  2LA8 A;  5E22 A;  4Z8J A;  4MPA A;  1MFL A;  3JXT A;  2ENO A;  5F3X A;  2FE5 A;  1ZOK A;  1WFV A;  4R2Z A;  1XZ9 A;  3R68 A;  2VZ5 A;  3PV2 A;  1QAV B;  3TSV A;  3QIK A;  4KFW A;  4Q6H A;  3MH4 A;  1X8S A;  1TP3 A;  2YT8 A;  3CBZ A;  3QGL A;  1N6F A;  4REY A;  4UU5 A;  2JIN A;  2E7K A;  4NMT A;  1UJD A;  2AWU A;  1U38 A;  2KA9 A;  3WKL A;  3ID1 A;  2D92 A;  2KJP A;  1V5L A;  2OMJ A;  5HET A;  1X45 A;  5HFF A;  5HEB A;  3K50 A;  4E35 A; 
#chains in the Genus database with same CATH topology
 3RL7 A;  1KY9 A;  3QJN A;  4FGM A;  4RI0 A;  4NNL A;  4NMS A;  2V90 A;  4GVD A;  1IU2 A;  1MC7 A;  2JRE A;  2H3M A;  5HFC A;  2QKT A;  2HGA A;  4WYU A;  3CBY A;  2H3L A;  2IWN A;  1WI2 A;  2Z9I A;  5HFE A;  5GND A;  2YUY A;  3QO6 A;  1UEQ A;  1WHA A;  3DJA A;  1WG6 A;  2DLU A;  1VB7 A;  4K78 A;  5GLJ A;  2KQF A;  4K72 A;  1WF7 A;  1FC7 A;  3SHU A;  5A2P A;  2VPH A;  2KPK A;  3CYY A;  4JOH A;  2EDV A;  1P1E A;  1UJV A;  1UFX A;  2CS5 A;  2P3W A;  2REY A;  3EGG C;  1N7E A;  1WIF A;  2YTW A;  2DJT A;  2Q3G A;  1VCW A;  2I0L A;  2H2C A;  2DLS A;  3NCV A;  3PDZ A;  2M0V A;  3FY5 A;  2M3M A;  1L6O A;  3E17 A;  3MH7 A;  3AXA A;  3QE1 A;  2UZC A;  3CS0 A;  1TQ3 A;  1B8Q A;  1G9O A;  1D5G A;  4XHV A;  5HF4 A;  2WL7 A;  4OEO A;  1R6J A;  2BYG A;  2QT5 A;  3CH8 A;  2IWP A;  1FC6 A;  2IWO A;  2EGK A;  1IHJ A;  2JOA A;  2QG1 A;  1UHP A;  2M0U A;  1Z86 A;  1V6B A;  3PV4 A;  2KRG A;  2EGO A;  1NF3 C;  4JOK A;  2VSV A;  2M0T A;  2QBW A;  2GZV A;  3DJ1 A;  1NTE A;  1Y8T A;  2KL1 A;  3KHF A;  2YT7 A;  4NMP A;  2KAW A;  5I7Z A;  1GQ5 A;  3GCO A;  1X9Z A;  3HPK A;  2JIK A;  1Y7N A;  4JOG A;  3OTP A;  2W4F A;  2QKU A;  3VQG A;  1RY4 A;  1Z87 A;  2OSG A;  3HVQ C;  2EHR A;  2KOM A;  4F8K A;  3TSW A;  1X5N A;  2I1N A;  2W7R A;  2I4S A;  2VSP A;  5H3J A;  3ID2 A;  4G69 A;  3GCN A;  3QDO A;  2M0Z A;  1X6D A;  1V1T A;  2OZF A;  3LNX A;  1YBO A;  2OCS A;  2K1Z A;  2ZPL A;  1X5R A;  2LC7 A;  1LCY A;  2KJD A;  2G5M B;  2EJY A;  1RGW A;  3O46 A;  2AWW A;  5HED A;  1MFG A;  1QAV A;  5D13 A;  1WH1 A;  1OBY A;  5FB8 C;  2V1W A;  1SOZ A;  1T2M A;  2EDP A;  4OAJ A;  4NMV A;  5HFD A;  1WJL A;  1P1D A;  3NGH A;  2HE2 A;  2G2L A;  5DTH A;  1GM1 A;  4EDJ A;  1GQ4 A;  4Q2Q A;  1N6E A;  1OBZ A;  1N7T A;  4L8N A;  1UIT A;  3I4W A;  4NMQ A;  1N99 A;  3KZD A;  4NNM A;  1WHD A;  2PNT A;  1N7F A;  2JIL A;  2JXO A;  2OS6 A;  1PDR A;  2EEG A;  4HOP A;  2HE4 A;  2MX6 A;  4AMH A;  2MHO A;  2RCZ A;  4P0C A;  5B6L A;  3BPU A;  1ZUB A;  3GJ9 A;  5HJ1 A;  4Q2O A;  3OU0 A;  3KZE A;  2GEF A;  3TMH A;  5EZ0 A;  2EGN A;  2EAQ A;  4O06 A;  1UF1 A;  4YYX A;  4NXQ A;  1W9O A;  4H11 A;  2DC2 A;  3RLE A;  5E6P B;  2ZPM A;  2PDZ A;  2Z17 A;  3SFJ A;  1FC9 A;  5HEY A;  2PA1 A;  2EDZ A;  4JOJ A;  1TE0 A;  2FN5 A;  2I04 A;  3O5N A;  1K32 A;  3TSZ A;  2EXG A;  2I6V A;  2YUB A;  4YDP A;  2JWE A;  2RRM A;  3DIW A;  3SHW A;  2KOJ A;  1BFE A;  2CSJ A;  2KJK A;  5JXB A;  3GGE A;  1UJU A;  2F0A A;  5EYZ A;  2OQS A;  3GDV A;  4Q6S A;  2DB5 A;  2DAZ A;  2EV8 A;  3B76 A;  1OZI A;  2DKR A;  3GAB A;  2PZD A;  1UEP A;  3HPM A;  1Q7X A;  4K6Y A;  2LUI A;  3STJ A;  1VA8 A;  1N6D A;  4GHN A;  4P2A B;  3K82 A;  1KWA A;  1IU0 A;  4JOR A;  5FHT A;  1WI4 A;  2CSS A;  2EEI A;  3GDS A;  2VWR A;  3RL8 A;  1WF8 A;  4Q2N A;  4JJ3 A;  5E1Y A;  2EEJ A;  1WFG A;  5F67 A;  2DM8 A;  5IL9 A;  2R3Y A;  2M10 A;  3PDV A;  2EEH A;  4HOP B;  3NFK A;  2X7Z A;  4NXP A;  1VJ6 A;  3I18 A;  3R69 A;  3LNY A;  3ZRT A;  2KOH A;  1FCF A;  2LC6 A;  4N6X A;  2F5Y A;  4KFV A;  3DOR A;  3GSL A;  1TP5 A;  2D8I A;  1V5Q A;  2H2B A;  2PKT A;  2OPG A;  4JOP A;  4NXR A;  5HF1 A;  2L4S A;  2KYL A;  4NMO A;  2KG2 A;  5B42 A;  1U37 A;  1V62 A;  4K75 A;  1UEW A;  1UM7 A;  2QKV A;  4JJ0 A;  2L4T A;  4IC6 A;  1QLC A;  4JL7 A;  3SOE A;  1U3B A;  2DMZ A;  3K1R A;  5ILB A;  5HFB A;  4OEP A;  4Q2P A;  2L97 A;  1UEZ A;  3MH6 A;  1W9E A;  1VAE A;  1Q3P A;  1OBX A;  2KBS A;  4JOE A;  3WKM A;  1M5Z A;  1SOT A;  2I0I A;  3KDG A;  1KEF A;  3VQF A;  2VRF A;  1RZX A;  3SUZ A;  5HDY A;  2K20 A;  2KPL A;  4GVC A;  5G1D A;  4K76 A;  4WYT A;  1X5Q A;  2D90 A;  3GDU A;  1RGR A;  1U39 A;  5G1E A;  1W9Q A;  3ID4 A;  1QAU A;  3QJM A;  4PQW A;  4NMR A;  4FLN A;  3CC0 A;  5E21 A;  2FCF A;  4E34 A;  4LMM A;  1Q3O A;  5E11 A;  2OGP A;  4Q3H A;  3ID3 A;  2AIN A;  1I92 A;  3PS4 A;  3DJ3 A;  3EGH C;  1UM1 A;  3L4F D;  2PKU A;  2R4H A;  4JOF A;  3I1E A;  4E3B A;  3CBX A;  3R0H A;  3NFL A;  2KV8 A;  2Q9V A;  2IWQ A;  1I16 A;  2O2T A;  1BE9 A;  4Z33 A;  2LOB A;  3PV5 A;  4UU6 A;  2AWX A;  2FNE A;  2LA8 A;  5E22 A;  4Z8J A;  4MPA A;  1MFL A;  3JXT A;  2ENO A;  5F3X A;  2FE5 A;  1ZOK A;  1WFV A;  4R2Z A;  1XZ9 A;  3R68 A;  2VZ5 A;  3PV2 A;  1QAV B;  3TSV A;  3QIK A;  4KFW A;  4Q6H A;  3MH4 A;  1X8S A;  1TP3 A;  2YT8 A;  3CBZ A;  3QGL A;  1N6F A;  2JSN A;  4REY A;  4UU5 A;  2JIN A;  2E7K A;  4NMT A;  1UJD A;  2AWU A;  1U38 A;  2KA9 A;  3WKL A;  3ID1 A;  2D92 A;  3KDK A;  2KJP A;  1V5L A;  2OMJ A;  5HET A;  1X45 A;  5HFF A;  5HEB A;  3K50 A;  4E35 A; 
#chains in the Genus database with same CATH homology
 3RL7 A;  1KY9 A;  3QJN A;  4FGM A;  4RI0 A;  4NNL A;  4NMS A;  2V90 A;  4GVD A;  1IU2 A;  1MC7 A;  2JRE A;  2H3M A;  5HFC A;  2QKT A;  2HGA A;  4WYU A;  3CBY A;  2H3L A;  2IWN A;  1WI2 A;  2Z9I A;  5HFE A;  5GND A;  2YUY A;  3QO6 A;  1UEQ A;  1WHA A;  3DJA A;  1WG6 A;  2DLU A;  1VB7 A;  4K78 A;  5GLJ A;  2KQF A;  4K72 A;  1WF7 A;  1FC7 A;  3SHU A;  5A2P A;  2VPH A;  2KPK A;  3CYY A;  4JOH A;  2EDV A;  1P1E A;  1UJV A;  1UFX A;  2CS5 A;  2P3W A;  2REY A;  3EGG C;  1N7E A;  1WIF A;  2YTW A;  2DJT A;  2Q3G A;  1VCW A;  2I0L A;  2H2C A;  2DLS A;  3NCV A;  3PDZ A;  2M0V A;  3FY5 A;  2M3M A;  1L6O A;  3E17 A;  3MH7 A;  3AXA A;  3QE1 A;  2UZC A;  3CS0 A;  1TQ3 A;  1B8Q A;  1G9O A;  1D5G A;  4XHV A;  5HF4 A;  2WL7 A;  4OEO A;  1R6J A;  2BYG A;  2QT5 A;  3CH8 A;  2IWP A;  1FC6 A;  2IWO A;  2EGK A;  1IHJ A;  2JOA A;  2QG1 A;  1UHP A;  2M0U A;  1Z86 A;  1V6B A;  3PV4 A;  2KRG A;  2EGO A;  1NF3 C;  4JOK A;  2VSV A;  2M0T A;  2QBW A;  2GZV A;  3DJ1 A;  1NTE A;  1Y8T A;  2KL1 A;  3KHF A;  2YT7 A;  4NMP A;  2KAW A;  5I7Z A;  1GQ5 A;  3GCO A;  1X9Z A;  3HPK A;  2JIK A;  1Y7N A;  4JOG A;  3OTP A;  2W4F A;  2QKU A;  3VQG A;  1RY4 A;  1Z87 A;  2OSG A;  3HVQ C;  2EHR A;  2KOM A;  4F8K A;  3TSW A;  1X5N A;  2I1N A;  2W7R A;  2I4S A;  2VSP A;  5H3J A;  3ID2 A;  4G69 A;  3GCN A;  3QDO A;  2M0Z A;  1X6D A;  1V1T A;  2OZF A;  3LNX A;  1YBO A;  2OCS A;  2K1Z A;  2ZPL A;  1X5R A;  2LC7 A;  1LCY A;  2KJD A;  2G5M B;  2EJY A;  1RGW A;  3O46 A;  2AWW A;  5HED A;  1MFG A;  1QAV A;  5D13 A;  1WH1 A;  1OBY A;  5FB8 C;  2V1W A;  1SOZ A;  1T2M A;  2EDP A;  4OAJ A;  4NMV A;  5HFD A;  1WJL A;  1P1D A;  3NGH A;  2HE2 A;  2G2L A;  5DTH A;  1GM1 A;  4EDJ A;  1GQ4 A;  4Q2Q A;  1N6E A;  1OBZ A;  1N7T A;  4L8N A;  1UIT A;  3I4W A;  4NMQ A;  1N99 A;  3KZD A;  4NNM A;  1WHD A;  2PNT A;  1N7F A;  2JIL A;  2JXO A;  2OS6 A;  1PDR A;  2EEG A;  4HOP A;  2HE4 A;  2MX6 A;  4AMH A;  2MHO A;  2RCZ A;  4P0C A;  5B6L A;  3BPU A;  1ZUB A;  3GJ9 A;  5HJ1 A;  4Q2O A;  3OU0 A;  3KZE A;  2GEF A;  3TMH A;  5EZ0 A;  2EGN A;  2EAQ A;  4O06 A;  1UF1 A;  4YYX A;  4NXQ A;  1W9O A;  4H11 A;  2DC2 A;  3RLE A;  5E6P B;  2ZPM A;  2PDZ A;  2Z17 A;  3SFJ A;  1FC9 A;  5HEY A;  2PA1 A;  2EDZ A;  4JOJ A;  1TE0 A;  2FN5 A;  2I04 A;  3O5N A;  1K32 A;  3TSZ A;  2EXG A;  2I6V A;  2YUB A;  4YDP A;  2JWE A;  2RRM A;  3DIW A;  3SHW A;  2KOJ A;  1BFE A;  2CSJ A;  2KJK A;  5JXB A;  3GGE A;  1UJU A;  2F0A A;  5EYZ A;  2OQS A;  3GDV A;  4Q6S A;  2DB5 A;  2DAZ A;  2EV8 A;  3B76 A;  1OZI A;  2DKR A;  3GAB A;  2PZD A;  1UEP A;  3HPM A;  1Q7X A;  4K6Y A;  2LUI A;  3STJ A;  1VA8 A;  1N6D A;  4GHN A;  4P2A B;  3K82 A;  1KWA A;  1IU0 A;  4JOR A;  5FHT A;  1WI4 A;  2CSS A;  2EEI A;  3GDS A;  2VWR A;  3RL8 A;  1WF8 A;  4Q2N A;  4JJ3 A;  5E1Y A;  2EEJ A;  1WFG A;  5F67 A;  2DM8 A;  5IL9 A;  2R3Y A;  2M10 A;  3PDV A;  2EEH A;  4HOP B;  3NFK A;  2X7Z A;  4NXP A;  1VJ6 A;  3I18 A;  3R69 A;  3LNY A;  3ZRT A;  2KOH A;  1FCF A;  2LC6 A;  4N6X A;  2F5Y A;  4KFV A;  3DOR A;  3GSL A;  1TP5 A;  2D8I A;  1V5Q A;  2H2B A;  2PKT A;  2OPG A;  4JOP A;  4NXR A;  5HF1 A;  2L4S A;  2KYL A;  4NMO A;  2KG2 A;  5B42 A;  1U37 A;  1V62 A;  4K75 A;  1UEW A;  1UM7 A;  2QKV A;  4JJ0 A;  2L4T A;  4IC6 A;  1QLC A;  4JL7 A;  3SOE A;  1U3B A;  2DMZ A;  3K1R A;  5ILB A;  5HFB A;  4OEP A;  4Q2P A;  2L97 A;  1UEZ A;  3MH6 A;  1W9E A;  1VAE A;  1Q3P A;  1OBX A;  2KBS A;  4JOE A;  3WKM A;  1M5Z A;  1SOT A;  2I0I A;  3KDG A;  1KEF A;  3VQF A;  2VRF A;  1RZX A;  3SUZ A;  5HDY A;  2K20 A;  2KPL A;  4GVC A;  5G1D A;  4K76 A;  4WYT A;  1X5Q A;  2D90 A;  3GDU A;  1RGR A;  1U39 A;  5G1E A;  1W9Q A;  3ID4 A;  1QAU A;  3QJM A;  4PQW A;  4NMR A;  4FLN A;  3CC0 A;  5E21 A;  2FCF A;  4E34 A;  4LMM A;  1Q3O A;  5E11 A;  2OGP A;  4Q3H A;  3ID3 A;  2AIN A;  1I92 A;  3PS4 A;  3DJ3 A;  3EGH C;  1UM1 A;  3L4F D;  2PKU A;  2R4H A;  4JOF A;  3I1E A;  4E3B A;  3CBX A;  3R0H A;  3NFL A;  2KV8 A;  2Q9V A;  2IWQ A;  1I16 A;  2O2T A;  1BE9 A;  4Z33 A;  2LOB A;  3PV5 A;  4UU6 A;  2AWX A;  2FNE A;  2LA8 A;  5E22 A;  4Z8J A;  4MPA A;  1MFL A;  3JXT A;  2ENO A;  5F3X A;  2FE5 A;  1ZOK A;  1WFV A;  4R2Z A;  1XZ9 A;  3R68 A;  2VZ5 A;  3PV2 A;  1QAV B;  3TSV A;  3QIK A;  4KFW A;  4Q6H A;  3MH4 A;  1X8S A;  1TP3 A;  2YT8 A;  3CBZ A;  3QGL A;  1N6F A;  2JSN A;  4REY A;  4UU5 A;  2JIN A;  2E7K A;  4NMT A;  1UJD A;  2AWU A;  1U38 A;  2KA9 A;  3WKL A;  3ID1 A;  2D92 A;  3KDK A;  2KJP A;  1V5L A;  2OMJ A;  5HET A;  1X45 A;  5HFF A;  5HEB A;  3K50 A;  4E35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...