1PDRA

Crystal structure of the third pdz domain from the human homolog of discs large protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
b'ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRQHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HUMAN DISCS LARGE PROTEIN
publication title Crystal structure of a PDZ domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1996-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1pdrA00
3AXAA 4Z33A 5HETA 2AWWA 3RL7A 1QAUA 4JOFA 1UM1A 3PDZA 2CS5A 1V6BA 5F67A 1VB7A 3LNXA 4RI0A 3DJ1A 4NXRA 2UZCA 5A2PA 4Q2PA 2KV8A 1GM1A 4GVDA 1P1EA 1N6EA 1WHDA 2VZ5A 2LOBA 4K6YA 5HEDA 3SOEA 2EEJA 2DKRA 1Q3PA 4JOKA 2BYGA 1Q3OA 2QKVA 1KY9A 2I1NA 3R68A 2DLSA 2QBWA 3B76A 1K32A 1VAEA 4OAJA 3ID4A 3OTPA 3SHUA 3KZEA 2K1ZA 5HF4A 5HFEA 3DJ3A 5HFFA 4YYXA 4KFVA 3GDSA 2H3LA 1FC6A 2EGNA 1UEQA 2M10A 5HFCA 5GLJA 2JREA 1TE0A 4L8NA 5JXBA 1OZIA 1RY4A 2QKUA 4K72A 1WH1A 4H11A 2EEHA 1V62A 3HVQC 4P2AB 3EGGC 4XHVA 2EHRA 2KOHA 4G69A 1QLCA 2G5MB 2OSGA 4UU6A 5FHTA 2EEGA 2EDPA 2ZPLA 1YBOA 3SHWA 2KYLA 4R2ZA 4JOJA 4NNLA 1TQ3A 2DM8A 3KHFA 2VRFA 5E1YA 3I1EA 1MC7A 1U38A 4JL7A 2E7KA 1P1DA 2DJTA 4JORA 4O06A 5FB8C 4F8KA 2EEIA 3MH7A 2H2CA 2HE4A 4JOPA 4HOPB 4IC6A 3STJA 1I92A 3GSLA 1VCWA 2EV8A 1WFVA 2JIKA 1N6FA 3QO6A 2LUIA 2EXGA 2FN5A 1LCYA 2H2BA 4NXPA 2QG1A 1XZ9A 1X8SA 4OEOA 1FCFA 2Z9IA 3WKLA 2FNEA 4Q2NA 2IWQA 3CBXA 2OQSA 2PNTA 2W4FA 1RGWA 4K75A 4EDJA 4K76A 3NGHA 2YUBA 3CYYA 4FGMA 2WL7A 5HJ1A 1TP3A 1ZUBA 3ZRTA 1G9OA 2OCSA 1W9EA 2KJPA 4NXQA 4P0CA 5B6LA 4LMMA 1B8QA 2O2TA 4OEPA 2CSSA 2FE5A 2I0LA 2HGAA 1FC9A 2EGOA 2JINA 1X5RA 1VJ6A 5DTHA 2KBSA 1MFLA 4REYA 4NMOA 2EJYA 2D92A 1UEWA 3CH8A 1X5NA 3RLEA 3R0HA 5I7ZA 2DB5A 1FC7A 2PA1A 2MX6A 1NTEA 2JWEA 2VSPA 3OU0A 4K78A 3K50A 3QGLA 4Q3HA 3FY5A 5GNDA 5E21A 2I4SA 3CC0A 2W7RA 3VQFA 1VA8A 1UEPA 2M0UA 5HFBA 1WG6A 2VPHA 1QAVB 4NMPA 2FCFA 2DC2A 4Q2QA 2KOJA 5HFDA 1R6JA 2QT5A 2DLUA 1UM7A 1KEFA 4NMRA 1WHAA 1N99A 2D8IA 1RZXA 2RRMA 1U37A 2ZPMA 2Q3GA 2M0TA 2OGPA 2RCZA 5G1EA 4KFWA 2KJDA 3TSVA 5H3JA 3E17A 3VQGA 2OZFA 3KZDA 1UITA 2KQFA 2KAWA 2L4TA 2Q9VA 1UJVA 3MH4A 4JOEA 2K20A 1X5QA 1GQ5A 2JILA 4HOPA 4JOGA 3PV2A 1Z86A 3QIKA 1ZOKA 3SUZA 1OBXA 1BFEA 1L6OA 2OMJA 1NF3C 2I04A 2KPKA 3O46A 4AMHA 1Y7NA 2H3MA 3CS0A 2VSVA 3GDUA 3JXTA 3ID2A 5F3XA 1U3BA 2ENOA 2R4HA 1Z87A 4N6XA 2I6VA 2KRGA 4Q2OA 3SFJA 2KG2A 2KJKA 2M0VA 3PDVA 2GZVA 5D13A 4MPAA 2MHOA 1T2MA 2KA9A 3QDOA 1UFXA 4GHNA 2KPLA 1UJUA 2F5YA 1N7FA 3PV4A 4Q6HA 2VWRA 1UHPA 1SOTA 2OPGA 4JOHA 5HEYA 1IHJA 5EYZA 4NMQA 3TMHA 2OS6A 1M5ZA 2M3MA 3QE1A 1KWAA 2EGKA 3L4FD 1X45A 2I0IA 1TP5A 4NMVA 1OBZA 4YDPA 1N7TA 1D5GA 2PKUA 3BPUA 1UF1A 1BE9A 4WYTA 1RGRA 4Z8JA 2PKTA 2HE2A 4Q6SA 2KOMA 2JOAA 3TSWA 1PDRA 2AWUA 4NMSA 2AWXA 1MFGA 1X6DA 5E11A 4UU5A 3NFKA 1Y8TA 3I4WA 3DIWA 3CBZA 1QAVA 3QJNA 3CBYA 3ID3A 5HEBA 4E35A 1GQ4A 1N6DA 2LC7A 1V5LA 2EDZA 2L4SA 3GCOA 4WYUA 5G1DA 2YUYA 1WI4A 1W9OA 5EZ0A 3PS4A 2EAQA 3PV5A 1SOZA 2D90A 1WF8A 1OBYA 2CSJA 1WIFA 2PDZA 5E6PB 1WI2A 4NMTA 1UEZA 3ID1A 1V5QA 2V90A 4E34A 3EGHC 3WKMA 2QKTA 3HPMA 2X7ZA 1I16A 3R69A 3O5NA 1U39A 4NNMA 2KL1A 2P3WA 3I18A 3LNYA 2YT7A 2PZDA 3GGEA 1V1TA 2Z17A 2JXOA 2IWNA 3K1RA 5HF1A 4PQWA 2DAZA 3RL8A 5E22A 2L97A 2G2LA 3QJMA 2YT8A 1WF7A 4GVCA 2IWPA 3GJ9A 1N7EA 3DORA 2LC6A 2EDVA 4E3BA 3GCNA 2M0ZA 3NFLA 3MH6A 2LA8A 3HPKA 1UJDA 2V1WA 2R3YA 2F0AA 1IU2A 3GDVA 2AINA 2YTWA 2DMZA 2IWOA 1W9QA 3TSZA 5HDYA 3DJAA 3K82A 1WFGA 2REYA 1Q7XA 1WJLA 1IU0A
chains in the Genus database with same CATH superfamily
3AXAA 4Z33A 5HETA 2AWWA 3RL7A 1QAUA 4JOFA 1UM1A 3PDZA 2CS5A 1V6BA 5F67A 1VB7A 3KDKA 3LNXA 4RI0A 3DJ1A 4NXRA 2UZCA 5A2PA 4Q2PA 2KV8A 1GM1A 4GVDA 1P1EA 1N6EA 1WHDA 2JSNA 2VZ5A 2LOBA 4FLNA 4K6YA 5HEDA 3SOEA 2EEJA 2DKRA 1Q3PA 4JOKA 2BYGA 1Q3OA 2QKVA 1KY9A 2I1NA 3R68A 2DLSA 2QBWA 3B76A 1K32A 1VAEA 4OAJA 3ID4A 3OTPA 3SHUA 3KZEA 2K1ZA 5HF4A 5HFEA 3DJ3A 5HFFA 4YYXA 4KFVA 3GDSA 2H3LA 1FC6A 2EGNA 1UEQA 2M10A 5HFCA 5GLJA 2JREA 1TE0A 4L8NA 5JXBA 1OZIA 1RY4A 2QKUA 4K72A 1WH1A 4H11A 2EEHA 1V62A 3HVQC 4P2AB 3EGGC 4XHVA 2EHRA 2KOHA 4G69A 1QLCA 2G5MB 2OSGA 4UU6A 5FHTA 2EEGA 2EDPA 2ZPLA 1YBOA 3SHWA 2KYLA 4R2ZA 4JOJA 4NNLA 1TQ3A 2DM8A 3KHFA 2VRFA 5E1YA 3I1EA 1MC7A 1U38A 4JL7A 2E7KA 1P1DA 2DJTA 4JORA 4O06A 5FB8C 4F8KA 2EEIA 3MH7A 2H2CA 2HE4A 4JOPA 4HOPB 4IC6A 3STJA 1I92A 3GSLA 1VCWA 2EV8A 1WFVA 2JIKA 1N6FA 3QO6A 2LUIA 2EXGA 2FN5A 1LCYA 2H2BA 4NXPA 2QG1A 1XZ9A 1X8SA 4OEOA 1FCFA 2Z9IA 1X9ZA 3WKLA 2FNEA 4Q2NA 2IWQA 3CBXA 2OQSA 2PNTA 2W4FA 1RGWA 4K75A 4EDJA 4K76A 3NGHA 2YUBA 3CYYA 4FGMA 2WL7A 5HJ1A 1TP3A 1ZUBA 3ZRTA 1G9OA 2OCSA 1W9EA 2KJPA 4NXQA 4P0CA 5B6LA 4LMMA 1B8QA 2O2TA 4OEPA 2CSSA 2FE5A 2I0LA 2HGAA 1FC9A 2EGOA 5ILBA 2JINA 1X5RA 1VJ6A 5DTHA 2KBSA 1MFLA 4REYA 4NMOA 2EJYA 3NCVA 2D92A 1UEWA 3CH8A 1X5NA 3RLEA 3R0HA 5I7ZA 2DB5A 1FC7A 2PA1A 2MX6A 1NTEA 2JWEA 2VSPA 3OU0A 4K78A 3K50A 3QGLA 4Q3HA 3FY5A 5GNDA 5E21A 2I4SA 3CC0A 2W7RA 3VQFA 1VA8A 1UEPA 2M0UA 5HFBA 1WG6A 2VPHA 1QAVB 4NMPA 2FCFA 2DC2A 4Q2QA 2KOJA 5HFDA 1R6JA 2QT5A 2DLUA 1UM7A 1KEFA 4NMRA 1WHAA 1N99A 2D8IA 1RZXA 2RRMA 1U37A 2ZPMA 2Q3GA 2M0TA 2OGPA 2RCZA 5G1EA 4KFWA 2KJDA 3TSVA 5H3JA 3E17A 3VQGA 2OZFA 3KZDA 1UITA 2KQFA 2KAWA 2L4TA 2Q9VA 1UJVA 3MH4A 4JOEA 2K20A 1X5QA 1GQ5A 2JILA 4HOPA 4JOGA 3PV2A 1Z86A 3QIKA 1ZOKA 4JJ0A 3SUZA 1OBXA 5B42A 1BFEA 1L6OA 2OMJA 1NF3C 2I04A 2KPKA 3O46A 4AMHA 1Y7NA 2H3MA 3CS0A 2VSVA 3GDUA 3JXTA 3ID2A 4JJ3A 5F3XA 1U3BA 2ENOA 2R4HA 1Z87A 4N6XA 2I6VA 2KRGA 4Q2OA 3SFJA 2KG2A 2KJKA 2M0VA 3PDVA 2GZVA 5D13A 4MPAA 2MHOA 1T2MA 2KA9A 3QDOA 1UFXA 4GHNA 2KPLA 1UJUA 2F5YA 1N7FA 3PV4A 4Q6HA 2VWRA 1UHPA 1SOTA 2OPGA 4JOHA 5HEYA 1IHJA 5EYZA 4NMQA 3TMHA 2OS6A 1M5ZA 2M3MA 3QE1A 1KWAA 2EGKA 3L4FD 1X45A 2I0IA 1TP5A 4NMVA 1OBZA 4YDPA 1N7TA 1D5GA 2PKUA 3BPUA 1UF1A 1BE9A 4WYTA 1RGRA 4Z8JA 3GABA 2PKTA 2HE2A 4Q6SA 2KOMA 2JOAA 3TSWA 1PDRA 2AWUA 4NMSA 2GEFA 2AWXA 1MFGA 1X6DA 5E11A 4UU5A 3NFKA 1Y8TA 3I4WA 3DIWA 3CBZA 1QAVA 3QJNA 3CBYA 3ID3A 5HEBA 4E35A 1GQ4A 1N6DA 2LC7A 1V5LA 2EDZA 2L4SA 3GCOA 4WYUA 5G1DA 2YUYA 1WI4A 1W9OA 5EZ0A 3PS4A 2EAQA 3PV5A 1SOZA 2D90A 1WF8A 1OBYA 2CSJA 1WIFA 2PDZA 5E6PB 1WI2A 4NMTA 1UEZA 3ID1A 1V5QA 2V90A 4E34A 3EGHC 3WKMA 2QKTA 3HPMA 2X7ZA 1I16A 3R69A 3O5NA 1U39A 4NNMA 2KL1A 2P3WA 3I18A 3LNYA 2YT7A 2PZDA 3GGEA 1V1TA 2Z17A 2JXOA 2IWNA 3K1RA 5HF1A 4PQWA 2DAZA 3RL8A 5E22A 2L97A 2G2LA 3QJMA 2YT8A 1WF7A 4GVCA 3KDGA 2IWPA 3GJ9A 1N7EA 3DORA 2LC6A 2EDVA 4E3BA 3GCNA 2M0ZA 3NFLA 3MH6A 2LA8A 3HPKA 1UJDA 2V1WA 2R3YA 2F0AA 1IU2A 3GDVA 2AINA 2YTWA 2DMZA 2IWOA 1W9QA 3TSZA 5HDYA 3DJAA 3K82A 1WFGA 2REYA 1Q7XA 1WJLA 5IL9A 1IU0A
chains in the Genus database with same CATH topology
3AXAA 4Z33A 5HETA 2AWWA 3RL7A 1QAUA 4JOFA 1UM1A 3PDZA 2CS5A 1V6BA 5F67A 1VB7A 3KDKA 3LNXA 4RI0A 3DJ1A 4NXRA 2UZCA 5A2PA 4Q2PA 2KV8A 1GM1A 4GVDA 1P1EA 1N6EA 1WHDA 2JSNA 2VZ5A 2LOBA 4FLNA 4K6YA 5HEDA 3SOEA 2EEJA 2DKRA 1Q3PA 4JOKA 2BYGA 1Q3OA 2QKVA 1KY9A 2I1NA 3R68A 2DLSA 2QBWA 3B76A 1K32A 1VAEA 4OAJA 3ID4A 3OTPA 3SHUA 3KZEA 2K1ZA 5HF4A 5HFEA 3DJ3A 5HFFA 4YYXA 4KFVA 3GDSA 2H3LA 1FC6A 2EGNA 1UEQA 2M10A 5HFCA 5GLJA 2JREA 1TE0A 4L8NA 5JXBA 1OZIA 1RY4A 2QKUA 4K72A 1WH1A 4H11A 2EEHA 1V62A 3HVQC 4P2AB 3EGGC 4XHVA 2EHRA 2KOHA 4G69A 1QLCA 2G5MB 2OSGA 4UU6A 5FHTA 2EEGA 2EDPA 2ZPLA 1YBOA 3SHWA 2KYLA 4R2ZA 4JOJA 4NNLA 1TQ3A 2DM8A 3KHFA 2VRFA 5E1YA 3I1EA 1MC7A 1U38A 4JL7A 2E7KA 1P1DA 2DJTA 4JORA 4O06A 5FB8C 4F8KA 2EEIA 3MH7A 2H2CA 2HE4A 4JOPA 4HOPB 4IC6A 3STJA 1I92A 3GSLA 1VCWA 2EV8A 1WFVA 2JIKA 1N6FA 3QO6A 2LUIA 2EXGA 2FN5A 1LCYA 2H2BA 4NXPA 2QG1A 1XZ9A 1X8SA 4OEOA 1FCFA 2Z9IA 1X9ZA 3WKLA 2FNEA 4Q2NA 2IWQA 3CBXA 2OQSA 2PNTA 2W4FA 1RGWA 4K75A 4EDJA 4K76A 3NGHA 2YUBA 3CYYA 4FGMA 2WL7A 5HJ1A 1TP3A 1ZUBA 3ZRTA 1G9OA 2OCSA 1W9EA 2KJPA 4NXQA 4P0CA 5B6LA 4LMMA 1B8QA 2O2TA 4OEPA 2CSSA 2FE5A 2I0LA 2HGAA 1FC9A 2EGOA 5ILBA 2JINA 1X5RA 1VJ6A 5DTHA 2KBSA 1MFLA 4REYA 4NMOA 2EJYA 3NCVA 2D92A 1UEWA 3CH8A 1X5NA 3RLEA 3R0HA 5I7ZA 2DB5A 1FC7A 2PA1A 2MX6A 1NTEA 2JWEA 2VSPA 3OU0A 4K78A 3K50A 3QGLA 4Q3HA 3FY5A 5GNDA 5E21A 2I4SA 3CC0A 2W7RA 3VQFA 1VA8A 1UEPA 2M0UA 5HFBA 1WG6A 2VPHA 1QAVB 4NMPA 2FCFA 2DC2A 4Q2QA 2KOJA 5HFDA 1R6JA 2QT5A 2DLUA 1UM7A 1KEFA 4NMRA 1WHAA 1N99A 2D8IA 1RZXA 2RRMA 1U37A 2ZPMA 2Q3GA 2M0TA 2OGPA 2RCZA 5G1EA 4KFWA 2KJDA 3TSVA 5H3JA 3E17A 3VQGA 2OZFA 3KZDA 1UITA 2KQFA 2KAWA 2L4TA 2Q9VA 1UJVA 3MH4A 4JOEA 2K20A 1X5QA 1GQ5A 2JILA 4HOPA 4JOGA 3PV2A 1Z86A 3QIKA 1ZOKA 4JJ0A 3SUZA 1OBXA 5B42A 1BFEA 1L6OA 2OMJA 1NF3C 2I04A 2KPKA 3O46A 4AMHA 1Y7NA 2H3MA 3CS0A 2VSVA 3GDUA 3JXTA 3ID2A 4JJ3A 5F3XA 1U3BA 2ENOA 2R4HA 1Z87A 4N6XA 2I6VA 2KRGA 4Q2OA 3SFJA 2KG2A 2KJKA 2M0VA 3PDVA 2GZVA 5D13A 4MPAA 2MHOA 1T2MA 2KA9A 3QDOA 1UFXA 4GHNA 2KPLA 1UJUA 2F5YA 1N7FA 3PV4A 4Q6HA 2VWRA 1UHPA 1SOTA 2OPGA 4JOHA 5HEYA 1IHJA 5EYZA 4NMQA 3TMHA 2OS6A 1M5ZA 2M3MA 3QE1A 1KWAA 2EGKA 3L4FD 1X45A 2I0IA 1TP5A 4NMVA 1OBZA 4YDPA 1N7TA 1D5GA 2PKUA 3BPUA 1UF1A 1BE9A 4WYTA 1RGRA 4Z8JA 3GABA 2PKTA 2HE2A 4Q6SA 2KOMA 2JOAA 3TSWA 1PDRA 2AWUA 4NMSA 2GEFA 2AWXA 1MFGA 1X6DA 5E11A 4UU5A 3NFKA 1Y8TA 3I4WA 3DIWA 3CBZA 1QAVA 3QJNA 3CBYA 3ID3A 5HEBA 4E35A 1GQ4A 1N6DA 2LC7A 1V5LA 2EDZA 2L4SA 3GCOA 4WYUA 5G1DA 2YUYA 1WI4A 1W9OA 5EZ0A 3PS4A 2EAQA 3PV5A 1SOZA 2D90A 1WF8A 1OBYA 2CSJA 1WIFA 2PDZA 5E6PB 1WI2A 4NMTA 1UEZA 3ID1A 1V5QA 2V90A 4E34A 3EGHC 3WKMA 2QKTA 3HPMA 2X7ZA 1I16A 3R69A 3O5NA 1U39A 4NNMA 2KL1A 2P3WA 3I18A 3LNYA 2YT7A 2PZDA 3GGEA 1V1TA 2Z17A 2JXOA 2IWNA 3K1RA 5HF1A 4PQWA 2DAZA 3RL8A 5E22A 2L97A 2G2LA 3QJMA 2YT8A 1WF7A 4GVCA 3KDGA 2IWPA 3GJ9A 1N7EA 3DORA 2LC6A 2EDVA 4E3BA 3GCNA 2M0ZA 3NFLA 3MH6A 2LA8A 3HPKA 1UJDA 2V1WA 2R3YA 2F0AA 1IU2A 3GDVA 2AINA 2YTWA 2DMZA 2IWOA 1W9QA 3TSZA 5HDYA 3DJAA 3K82A 1WFGA 2REYA 1Q7XA 1WJLA 5IL9A 1IU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AXA A;  4Z33 A;  5HET A;  2AWW A;  3RL7 A;  1QAU A;  4JOF A;  1UM1 A;  3PDZ A;  2CS5 A;  1V6B A;  5F67 A;  1VB7 A;  3LNX A;  4RI0 A;  3DJ1 A;  4NXR A;  2UZC A;  5A2P A;  4Q2P A;  2KV8 A;  1GM1 A;  4GVD A;  1P1E A;  1N6E A;  1WHD A;  2VZ5 A;  2LOB A;  4K6Y A;  5HED A;  3SOE A;  2EEJ A;  2DKR A;  1Q3P A;  4JOK A;  2BYG A;  1Q3O A;  2QKV A;  1KY9 A;  2I1N A;  3R68 A;  2DLS A;  2QBW A;  3B76 A;  1K32 A;  1VAE A;  4OAJ A;  3ID4 A;  3OTP A;  3SHU A;  3KZE A;  2K1Z A;  5HF4 A;  5HFE A;  3DJ3 A;  5HFF A;  4YYX A;  4KFV A;  3GDS A;  2H3L A;  1FC6 A;  2EGN A;  1UEQ A;  2M10 A;  5HFC A;  5GLJ A;  2JRE A;  1TE0 A;  4L8N A;  5JXB A;  1OZI A;  1RY4 A;  2QKU A;  4K72 A;  1WH1 A;  4H11 A;  2EEH A;  1V62 A;  3HVQ C;  4P2A B;  3EGG C;  4XHV A;  2EHR A;  2KOH A;  4G69 A;  1QLC A;  2G5M B;  2OSG A;  4UU6 A;  5FHT A;  2EEG A;  2EDP A;  2ZPL A;  1YBO A;  3SHW A;  2KYL A;  4R2Z A;  4JOJ A;  4NNL A;  1TQ3 A;  2DM8 A;  3KHF A;  2VRF A;  5E1Y A;  3I1E A;  1MC7 A;  1U38 A;  4JL7 A;  2E7K A;  1P1D A;  2DJT A;  4JOR A;  4O06 A;  5FB8 C;  4F8K A;  2EEI A;  3MH7 A;  2H2C A;  2HE4 A;  4JOP A;  4HOP B;  4IC6 A;  3STJ A;  1I92 A;  3GSL A;  1VCW A;  2EV8 A;  1WFV A;  2JIK A;  1N6F A;  3QO6 A;  2LUI A;  2EXG A;  2FN5 A;  1LCY A;  2H2B A;  4NXP A;  2QG1 A;  1XZ9 A;  1X8S A;  4OEO A;  1FCF A;  2Z9I A;  3WKL A;  2FNE A;  4Q2N A;  2IWQ A;  3CBX A;  2OQS A;  2PNT A;  2W4F A;  1RGW A;  4K75 A;  4EDJ A;  4K76 A;  3NGH A;  2YUB A;  3CYY A;  4FGM A;  2WL7 A;  5HJ1 A;  1TP3 A;  1ZUB A;  3ZRT A;  1G9O A;  2OCS A;  1W9E A;  2KJP A;  4NXQ A;  4P0C A;  5B6L A;  4LMM A;  1B8Q A;  2O2T A;  4OEP A;  2CSS A;  2FE5 A;  2I0L A;  2HGA A;  1FC9 A;  2EGO A;  2JIN A;  1X5R A;  1VJ6 A;  5DTH A;  2KBS A;  1MFL A;  4REY A;  4NMO A;  2EJY A;  2D92 A;  1UEW A;  3CH8 A;  1X5N A;  3RLE A;  3R0H A;  5I7Z A;  2DB5 A;  1FC7 A;  2PA1 A;  2MX6 A;  1NTE A;  2JWE A;  2VSP A;  3OU0 A;  4K78 A;  3K50 A;  3QGL A;  4Q3H A;  3FY5 A;  5GND A;  5E21 A;  2I4S A;  3CC0 A;  2W7R A;  3VQF A;  1VA8 A;  1UEP A;  2M0U A;  5HFB A;  1WG6 A;  2VPH A;  1QAV B;  4NMP A;  2FCF A;  2DC2 A;  4Q2Q A;  2KOJ A;  5HFD A;  1R6J A;  2QT5 A;  2DLU A;  1UM7 A;  1KEF A;  4NMR A;  1WHA A;  1N99 A;  2D8I A;  1RZX A;  2RRM A;  1U37 A;  2ZPM A;  2Q3G A;  2M0T A;  2OGP A;  2RCZ A;  5G1E A;  4KFW A;  2KJD A;  3TSV A;  5H3J A;  3E17 A;  3VQG A;  2OZF A;  3KZD A;  1UIT A;  2KQF A;  2KAW A;  2L4T A;  2Q9V A;  1UJV A;  3MH4 A;  4JOE A;  2K20 A;  1X5Q A;  1GQ5 A;  2JIL A;  4HOP A;  4JOG A;  3PV2 A;  1Z86 A;  3QIK A;  1ZOK A;  3SUZ A;  1OBX A;  1BFE A;  1L6O A;  2OMJ A;  1NF3 C;  2I04 A;  2KPK A;  3O46 A;  4AMH A;  1Y7N A;  2H3M A;  3CS0 A;  2VSV A;  3GDU A;  3JXT A;  3ID2 A;  5F3X A;  1U3B A;  2ENO A;  2R4H A;  1Z87 A;  4N6X A;  2I6V A;  2KRG A;  4Q2O A;  3SFJ A;  2KG2 A;  2KJK A;  2M0V A;  3PDV A;  2GZV A;  5D13 A;  4MPA A;  2MHO A;  1T2M A;  2KA9 A;  3QDO A;  1UFX A;  4GHN A;  2KPL A;  1UJU A;  2F5Y A;  1N7F A;  3PV4 A;  4Q6H A;  2VWR A;  1UHP A;  1SOT A;  2OPG A;  4JOH A;  5HEY A;  1IHJ A;  5EYZ A;  4NMQ A;  3TMH A;  2OS6 A;  1M5Z A;  2M3M A;  3QE1 A;  1KWA A;  2EGK A;  3L4F D;  1X45 A;  2I0I A;  1TP5 A;  4NMV A;  1OBZ A;  4YDP A;  1N7T A;  1D5G A;  2PKU A;  3BPU A;  1UF1 A;  1BE9 A;  4WYT A;  1RGR A;  4Z8J A;  2PKT A;  2HE2 A;  4Q6S A;  2KOM A;  2JOA A;  3TSW A;  1PDR A;  2AWU A;  4NMS A;  2AWX A;  1MFG A;  1X6D A;  5E11 A;  4UU5 A;  3NFK A;  1Y8T A;  3I4W A;  3DIW A;  3CBZ A;  1QAV A;  3QJN A;  3CBY A;  3ID3 A;  5HEB A;  4E35 A;  1GQ4 A;  1N6D A;  2LC7 A;  1V5L A;  2EDZ A;  2L4S A;  3GCO A;  4WYU A;  5G1D A;  2YUY A;  1WI4 A;  1W9O A;  5EZ0 A;  3PS4 A;  2EAQ A;  3PV5 A;  1SOZ A;  2D90 A;  1WF8 A;  1OBY A;  2CSJ A;  1WIF A;  2PDZ A;  5E6P B;  1WI2 A;  4NMT A;  1UEZ A;  3ID1 A;  1V5Q A;  2V90 A;  4E34 A;  3EGH C;  3WKM A;  2QKT A;  3HPM A;  2X7Z A;  1I16 A;  3R69 A;  3O5N A;  1U39 A;  4NNM A;  2KL1 A;  2P3W A;  3I18 A;  3LNY A;  2YT7 A;  2PZD A;  3GGE A;  1V1T A;  2Z17 A;  2JXO A;  2IWN A;  3K1R A;  5HF1 A;  4PQW A;  2DAZ A;  3RL8 A;  5E22 A;  2L97 A;  2G2L A;  3QJM A;  2YT8 A;  1WF7 A;  4GVC A;  2IWP A;  3GJ9 A;  1N7E A;  3DOR A;  2LC6 A;  2EDV A;  4E3B A;  3GCN A;  2M0Z A;  3NFL A;  3MH6 A;  2LA8 A;  3HPK A;  1UJD A;  2V1W A;  2R3Y A;  2F0A A;  1IU2 A;  3GDV A;  2AIN A;  2YTW A;  2DMZ A;  2IWO A;  1W9Q A;  3TSZ A;  5HDY A;  3DJA A;  3K82 A;  1WFG A;  2REY A;  1Q7X A;  1WJL A;  1IU0 A; 
#chains in the Genus database with same CATH topology
 3AXA A;  4Z33 A;  5HET A;  2AWW A;  3RL7 A;  1QAU A;  4JOF A;  1UM1 A;  3PDZ A;  2CS5 A;  1V6B A;  5F67 A;  1VB7 A;  3KDK A;  3LNX A;  4RI0 A;  3DJ1 A;  4NXR A;  2UZC A;  5A2P A;  4Q2P A;  2KV8 A;  1GM1 A;  4GVD A;  1P1E A;  1N6E A;  1WHD A;  2JSN A;  2VZ5 A;  2LOB A;  4FLN A;  4K6Y A;  5HED A;  3SOE A;  2EEJ A;  2DKR A;  1Q3P A;  4JOK A;  2BYG A;  1Q3O A;  2QKV A;  1KY9 A;  2I1N A;  3R68 A;  2DLS A;  2QBW A;  3B76 A;  1K32 A;  1VAE A;  4OAJ A;  3ID4 A;  3OTP A;  3SHU A;  3KZE A;  2K1Z A;  5HF4 A;  5HFE A;  3DJ3 A;  5HFF A;  4YYX A;  4KFV A;  3GDS A;  2H3L A;  1FC6 A;  2EGN A;  1UEQ A;  2M10 A;  5HFC A;  5GLJ A;  2JRE A;  1TE0 A;  4L8N A;  5JXB A;  1OZI A;  1RY4 A;  2QKU A;  4K72 A;  1WH1 A;  4H11 A;  2EEH A;  1V62 A;  3HVQ C;  4P2A B;  3EGG C;  4XHV A;  2EHR A;  2KOH A;  4G69 A;  1QLC A;  2G5M B;  2OSG A;  4UU6 A;  5FHT A;  2EEG A;  2EDP A;  2ZPL A;  1YBO A;  3SHW A;  2KYL A;  4R2Z A;  4JOJ A;  4NNL A;  1TQ3 A;  2DM8 A;  3KHF A;  2VRF A;  5E1Y A;  3I1E A;  1MC7 A;  1U38 A;  4JL7 A;  2E7K A;  1P1D A;  2DJT A;  4JOR A;  4O06 A;  5FB8 C;  4F8K A;  2EEI A;  3MH7 A;  2H2C A;  2HE4 A;  4JOP A;  4HOP B;  4IC6 A;  3STJ A;  1I92 A;  3GSL A;  1VCW A;  2EV8 A;  1WFV A;  2JIK A;  1N6F A;  3QO6 A;  2LUI A;  2EXG A;  2FN5 A;  1LCY A;  2H2B A;  4NXP A;  2QG1 A;  1XZ9 A;  1X8S A;  4OEO A;  1FCF A;  2Z9I A;  1X9Z A;  3WKL A;  2FNE A;  4Q2N A;  2IWQ A;  3CBX A;  2OQS A;  2PNT A;  2W4F A;  1RGW A;  4K75 A;  4EDJ A;  4K76 A;  3NGH A;  2YUB A;  3CYY A;  4FGM A;  2WL7 A;  5HJ1 A;  1TP3 A;  1ZUB A;  3ZRT A;  1G9O A;  2OCS A;  1W9E A;  2KJP A;  4NXQ A;  4P0C A;  5B6L A;  4LMM A;  1B8Q A;  2O2T A;  4OEP A;  2CSS A;  2FE5 A;  2I0L A;  2HGA A;  1FC9 A;  2EGO A;  5ILB A;  2JIN A;  1X5R A;  1VJ6 A;  5DTH A;  2KBS A;  1MFL A;  4REY A;  4NMO A;  2EJY A;  3NCV A;  2D92 A;  1UEW A;  3CH8 A;  1X5N A;  3RLE A;  3R0H A;  5I7Z A;  2DB5 A;  1FC7 A;  2PA1 A;  2MX6 A;  1NTE A;  2JWE A;  2VSP A;  3OU0 A;  4K78 A;  3K50 A;  3QGL A;  4Q3H A;  3FY5 A;  5GND A;  5E21 A;  2I4S A;  3CC0 A;  2W7R A;  3VQF A;  1VA8 A;  1UEP A;  2M0U A;  5HFB A;  1WG6 A;  2VPH A;  1QAV B;  4NMP A;  2FCF A;  2DC2 A;  4Q2Q A;  2KOJ A;  5HFD A;  1R6J A;  2QT5 A;  2DLU A;  1UM7 A;  1KEF A;  4NMR A;  1WHA A;  1N99 A;  2D8I A;  1RZX A;  2RRM A;  1U37 A;  2ZPM A;  2Q3G A;  2M0T A;  2OGP A;  2RCZ A;  5G1E A;  4KFW A;  2KJD A;  3TSV A;  5H3J A;  3E17 A;  3VQG A;  2OZF A;  3KZD A;  1UIT A;  2KQF A;  2KAW A;  2L4T A;  2Q9V A;  1UJV A;  3MH4 A;  4JOE A;  2K20 A;  1X5Q A;  1GQ5 A;  2JIL A;  4HOP A;  4JOG A;  3PV2 A;  1Z86 A;  3QIK A;  1ZOK A;  4JJ0 A;  3SUZ A;  1OBX A;  5B42 A;  1BFE A;  1L6O A;  2OMJ A;  1NF3 C;  2I04 A;  2KPK A;  3O46 A;  4AMH A;  1Y7N A;  2H3M A;  3CS0 A;  2VSV A;  3GDU A;  3JXT A;  3ID2 A;  4JJ3 A;  5F3X A;  1U3B A;  2ENO A;  2R4H A;  1Z87 A;  4N6X A;  2I6V A;  2KRG A;  4Q2O A;  3SFJ A;  2KG2 A;  2KJK A;  2M0V A;  3PDV A;  2GZV A;  5D13 A;  4MPA A;  2MHO A;  1T2M A;  2KA9 A;  3QDO A;  1UFX A;  4GHN A;  2KPL A;  1UJU A;  2F5Y A;  1N7F A;  3PV4 A;  4Q6H A;  2VWR A;  1UHP A;  1SOT A;  2OPG A;  4JOH A;  5HEY A;  1IHJ A;  5EYZ A;  4NMQ A;  3TMH A;  2OS6 A;  1M5Z A;  2M3M A;  3QE1 A;  1KWA A;  2EGK A;  3L4F D;  1X45 A;  2I0I A;  1TP5 A;  4NMV A;  1OBZ A;  4YDP A;  1N7T A;  1D5G A;  2PKU A;  3BPU A;  1UF1 A;  1BE9 A;  4WYT A;  1RGR A;  4Z8J A;  3GAB A;  2PKT A;  2HE2 A;  4Q6S A;  2KOM A;  2JOA A;  3TSW A;  1PDR A;  2AWU A;  4NMS A;  2GEF A;  2AWX A;  1MFG A;  1X6D A;  5E11 A;  4UU5 A;  3NFK A;  1Y8T A;  3I4W A;  3DIW A;  3CBZ A;  1QAV A;  3QJN A;  3CBY A;  3ID3 A;  5HEB A;  4E35 A;  1GQ4 A;  1N6D A;  2LC7 A;  1V5L A;  2EDZ A;  2L4S A;  3GCO A;  4WYU A;  5G1D A;  2YUY A;  1WI4 A;  1W9O A;  5EZ0 A;  3PS4 A;  2EAQ A;  3PV5 A;  1SOZ A;  2D90 A;  1WF8 A;  1OBY A;  2CSJ A;  1WIF A;  2PDZ A;  5E6P B;  1WI2 A;  4NMT A;  1UEZ A;  3ID1 A;  1V5Q A;  2V90 A;  4E34 A;  3EGH C;  3WKM A;  2QKT A;  3HPM A;  2X7Z A;  1I16 A;  3R69 A;  3O5N A;  1U39 A;  4NNM A;  2KL1 A;  2P3W A;  3I18 A;  3LNY A;  2YT7 A;  2PZD A;  3GGE A;  1V1T A;  2Z17 A;  2JXO A;  2IWN A;  3K1R A;  5HF1 A;  4PQW A;  2DAZ A;  3RL8 A;  5E22 A;  2L97 A;  2G2L A;  3QJM A;  2YT8 A;  1WF7 A;  4GVC A;  3KDG A;  2IWP A;  3GJ9 A;  1N7E A;  3DOR A;  2LC6 A;  2EDV A;  4E3B A;  3GCN A;  2M0Z A;  3NFL A;  3MH6 A;  2LA8 A;  3HPK A;  1UJD A;  2V1W A;  2R3Y A;  2F0A A;  1IU2 A;  3GDV A;  2AIN A;  2YTW A;  2DMZ A;  2IWO A;  1W9Q A;  3TSZ A;  5HDY A;  3DJA A;  3K82 A;  1WFG A;  2REY A;  1Q7X A;  1WJL A;  5IL9 A;  1IU0 A; 
#chains in the Genus database with same CATH homology
 3AXA A;  4Z33 A;  5HET A;  2AWW A;  3RL7 A;  1QAU A;  4JOF A;  1UM1 A;  3PDZ A;  2CS5 A;  1V6B A;  5F67 A;  1VB7 A;  3KDK A;  3LNX A;  4RI0 A;  3DJ1 A;  4NXR A;  2UZC A;  5A2P A;  4Q2P A;  2KV8 A;  1GM1 A;  4GVD A;  1P1E A;  1N6E A;  1WHD A;  2JSN A;  2VZ5 A;  2LOB A;  4FLN A;  4K6Y A;  5HED A;  3SOE A;  2EEJ A;  2DKR A;  1Q3P A;  4JOK A;  2BYG A;  1Q3O A;  2QKV A;  1KY9 A;  2I1N A;  3R68 A;  2DLS A;  2QBW A;  3B76 A;  1K32 A;  1VAE A;  4OAJ A;  3ID4 A;  3OTP A;  3SHU A;  3KZE A;  2K1Z A;  5HF4 A;  5HFE A;  3DJ3 A;  5HFF A;  4YYX A;  4KFV A;  3GDS A;  2H3L A;  1FC6 A;  2EGN A;  1UEQ A;  2M10 A;  5HFC A;  5GLJ A;  2JRE A;  1TE0 A;  4L8N A;  5JXB A;  1OZI A;  1RY4 A;  2QKU A;  4K72 A;  1WH1 A;  4H11 A;  2EEH A;  1V62 A;  3HVQ C;  4P2A B;  3EGG C;  4XHV A;  2EHR A;  2KOH A;  4G69 A;  1QLC A;  2G5M B;  2OSG A;  4UU6 A;  5FHT A;  2EEG A;  2EDP A;  2ZPL A;  1YBO A;  3SHW A;  2KYL A;  4R2Z A;  4JOJ A;  4NNL A;  1TQ3 A;  2DM8 A;  3KHF A;  2VRF A;  5E1Y A;  3I1E A;  1MC7 A;  1U38 A;  4JL7 A;  2E7K A;  1P1D A;  2DJT A;  4JOR A;  4O06 A;  5FB8 C;  4F8K A;  2EEI A;  3MH7 A;  2H2C A;  2HE4 A;  4JOP A;  4HOP B;  4IC6 A;  3STJ A;  1I92 A;  3GSL A;  1VCW A;  2EV8 A;  1WFV A;  2JIK A;  1N6F A;  3QO6 A;  2LUI A;  2EXG A;  2FN5 A;  1LCY A;  2H2B A;  4NXP A;  2QG1 A;  1XZ9 A;  1X8S A;  4OEO A;  1FCF A;  2Z9I A;  1X9Z A;  3WKL A;  2FNE A;  4Q2N A;  2IWQ A;  3CBX A;  2OQS A;  2PNT A;  2W4F A;  1RGW A;  4K75 A;  4EDJ A;  4K76 A;  3NGH A;  2YUB A;  3CYY A;  4FGM A;  2WL7 A;  5HJ1 A;  1TP3 A;  1ZUB A;  3ZRT A;  1G9O A;  2OCS A;  1W9E A;  2KJP A;  4NXQ A;  4P0C A;  5B6L A;  4LMM A;  1B8Q A;  2O2T A;  4OEP A;  2CSS A;  2FE5 A;  2I0L A;  2HGA A;  1FC9 A;  2EGO A;  5ILB A;  2JIN A;  1X5R A;  1VJ6 A;  5DTH A;  2KBS A;  1MFL A;  4REY A;  4NMO A;  2EJY A;  3NCV A;  2D92 A;  1UEW A;  3CH8 A;  1X5N A;  3RLE A;  3R0H A;  5I7Z A;  2DB5 A;  1FC7 A;  2PA1 A;  2MX6 A;  1NTE A;  2JWE A;  2VSP A;  3OU0 A;  4K78 A;  3K50 A;  3QGL A;  4Q3H A;  3FY5 A;  5GND A;  5E21 A;  2I4S A;  3CC0 A;  2W7R A;  3VQF A;  1VA8 A;  1UEP A;  2M0U A;  5HFB A;  1WG6 A;  2VPH A;  1QAV B;  4NMP A;  2FCF A;  2DC2 A;  4Q2Q A;  2KOJ A;  5HFD A;  1R6J A;  2QT5 A;  2DLU A;  1UM7 A;  1KEF A;  4NMR A;  1WHA A;  1N99 A;  2D8I A;  1RZX A;  2RRM A;  1U37 A;  2ZPM A;  2Q3G A;  2M0T A;  2OGP A;  2RCZ A;  5G1E A;  4KFW A;  2KJD A;  3TSV A;  5H3J A;  3E17 A;  3VQG A;  2OZF A;  3KZD A;  1UIT A;  2KQF A;  2KAW A;  2L4T A;  2Q9V A;  1UJV A;  3MH4 A;  4JOE A;  2K20 A;  1X5Q A;  1GQ5 A;  2JIL A;  4HOP A;  4JOG A;  3PV2 A;  1Z86 A;  3QIK A;  1ZOK A;  4JJ0 A;  3SUZ A;  1OBX A;  5B42 A;  1BFE A;  1L6O A;  2OMJ A;  1NF3 C;  2I04 A;  2KPK A;  3O46 A;  4AMH A;  1Y7N A;  2H3M A;  3CS0 A;  2VSV A;  3GDU A;  3JXT A;  3ID2 A;  4JJ3 A;  5F3X A;  1U3B A;  2ENO A;  2R4H A;  1Z87 A;  4N6X A;  2I6V A;  2KRG A;  4Q2O A;  3SFJ A;  2KG2 A;  2KJK A;  2M0V A;  3PDV A;  2GZV A;  5D13 A;  4MPA A;  2MHO A;  1T2M A;  2KA9 A;  3QDO A;  1UFX A;  4GHN A;  2KPL A;  1UJU A;  2F5Y A;  1N7F A;  3PV4 A;  4Q6H A;  2VWR A;  1UHP A;  1SOT A;  2OPG A;  4JOH A;  5HEY A;  1IHJ A;  5EYZ A;  4NMQ A;  3TMH A;  2OS6 A;  1M5Z A;  2M3M A;  3QE1 A;  1KWA A;  2EGK A;  3L4F D;  1X45 A;  2I0I A;  1TP5 A;  4NMV A;  1OBZ A;  4YDP A;  1N7T A;  1D5G A;  2PKU A;  3BPU A;  1UF1 A;  1BE9 A;  4WYT A;  1RGR A;  4Z8J A;  3GAB A;  2PKT A;  2HE2 A;  4Q6S A;  2KOM A;  2JOA A;  3TSW A;  1PDR A;  2AWU A;  4NMS A;  2GEF A;  2AWX A;  1MFG A;  1X6D A;  5E11 A;  4UU5 A;  3NFK A;  1Y8T A;  3I4W A;  3DIW A;  3CBZ A;  1QAV A;  3QJN A;  3CBY A;  3ID3 A;  5HEB A;  4E35 A;  1GQ4 A;  1N6D A;  2LC7 A;  1V5L A;  2EDZ A;  2L4S A;  3GCO A;  4WYU A;  5G1D A;  2YUY A;  1WI4 A;  1W9O A;  5EZ0 A;  3PS4 A;  2EAQ A;  3PV5 A;  1SOZ A;  2D90 A;  1WF8 A;  1OBY A;  2CSJ A;  1WIF A;  2PDZ A;  5E6P B;  1WI2 A;  4NMT A;  1UEZ A;  3ID1 A;  1V5Q A;  2V90 A;  4E34 A;  3EGH C;  3WKM A;  2QKT A;  3HPM A;  2X7Z A;  1I16 A;  3R69 A;  3O5N A;  1U39 A;  4NNM A;  2KL1 A;  2P3W A;  3I18 A;  3LNY A;  2YT7 A;  2PZD A;  3GGE A;  1V1T A;  2Z17 A;  2JXO A;  2IWN A;  3K1R A;  5HF1 A;  4PQW A;  2DAZ A;  3RL8 A;  5E22 A;  2L97 A;  2G2L A;  3QJM A;  2YT8 A;  1WF7 A;  4GVC A;  3KDG A;  2IWP A;  3GJ9 A;  1N7E A;  3DOR A;  2LC6 A;  2EDV A;  4E3B A;  3GCN A;  2M0Z A;  3NFL A;  3MH6 A;  2LA8 A;  3HPK A;  1UJD A;  2V1W A;  2R3Y A;  2F0A A;  1IU2 A;  3GDV A;  2AIN A;  2YTW A;  2DMZ A;  2IWO A;  1W9Q A;  3TSZ A;  5HDY A;  3DJA A;  3K82 A;  1WFG A;  2REY A;  1Q7X A;  1WJL A;  5IL9 A;  1IU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...