5HFBA

The third pdz domain from the synaptic protein psd-95 (h372a mutant) in complex with a c-terminal peptide derived from cript
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
117
Chain Sequence
PEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASAEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Origins of Allostery and Evolvability in Proteins: A Case Study.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 26
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5hfbA00
2DJTA 3OTPA 5HJ1A 5HFFA 1OBZA 1B8QA 1WG6A 3KZEA 1UF1A 4K75A 2KBSA 3CBXA 2EEHA 1RZXA 4GVCA 2EDVA 2YT8A 1X45A 3PDVA 2KV8A 3R69A 2E7KA 2M0TA 4OEPA 5F3XA 2KOHA 2I04A 1MC7A 1N7FA 2ZPMA 2YUBA 2QKTA 3L4FD 2YTWA 1I16A 2AWXA 2D8IA 4F8KA 2D92A 2HE4A 5E11A 5HFEA 4JOFA 2EGOA 5HEYA 2V90A 1Q7XA 3AXAA 2R3YA 5E21A 1Z86A 2K20A 3GCNA 1QAUA 1U37A 3ID4A 2FNEA 1Z87A 3PV2A 2M10A 2IWOA 5EZ0A 3EGHC 5FHTA 1ZOKA 1N6FA 2KJPA 4G69A 4JL7A 2KA9A 4NNLA 2YT7A 3CBYA 1GM1A 3K1RA 4EDJA 2RCZA 1Y7NA 2KRGA 3E17A 4MPAA 3QGLA 4FGMA 2IWQA 2JIKA 4R2ZA 2PA1A 2EGKA 2CSJA 4HOPB 3TSWA 1UITA 3ZRTA 2HE2A 1W9EA 2FCFA 3MH7A 2IWPA 2P3WA 1N7TA 2CS5A 4NMOA 2VWRA 2VZ5A 4P2AB 3TMHA 2JILA 3DJ3A 2L97A 1TP5A 3TSVA 1LCYA 3CS0A 3GCOA 2KPKA 2BYGA 1QAVA 2D90A 2M3MA 5HFBA 2OPGA 4AMHA 3CH8A 4Q2PA 1IHJA 2AWUA 2LC6A 1UJVA 4YDPA 2OS6A 3GSLA 1WIFA 4KFVA 1SOZA 3BPUA 2JWEA 2LC7A 2LUIA 4N6XA 3LNXA 1L6OA 2DLUA 1X5QA 1KEFA 1RY4A 3CC0A 2W4FA 4GVDA 2DMZA 4JOPA 2EV8A 3K50A 2EXGA 3CBZA 2EEIA 4NMSA 5I7ZA 3WKMA 4Z8JA 1X5NA 1N99A 2OSGA 1WHDA 4JORA 3NFLA 3TSZA 1M5ZA 2L4SA 5H3JA 2EDPA 4WYUA 3ID2A 5HF1A 4NMRA 1QLCA 5JXBA 1FC6A 1TP3A 2QKVA 2MX6A 1FC9A 3GDVA 1UEWA 2KG2A 2KQFA 2KAWA 3PV5A 2HGAA 2L4TA 1OBYA 2KJDA 1Q3PA 3DORA 5GNDA 1X8SA 2R4HA 3RLEA 2PNTA 1R6JA 2DC2A 4NXQA 3QJMA 2DLSA 1WF7A 1WFVA 1P1EA 2JOAA 1UEPA 2PDZA 1K32A 2PZDA 2VSVA 1N6DA 2KYLA 2FN5A 1VAEA 2F5YA 1UM1A 3QJNA 4HOPA 3PS4A 4RI0A 5E6PB 2QG1A 1ZUBA 1RGRA 2PKUA 3PDZA 2DB5A 5DTHA 2KOMA 3FY5A 1WI4A 3QE1A 4JOHA 1X6DA 3SOEA 2EAQA 2DAZA 4NMQA 1BE9A 2LA8A 3SHUA 2H2CA 1D5GA 1U38A 2Z17A 3HPKA 1NF3C 1SOTA 2DKRA 4WYTA 4PQWA 2KPLA 1I92A 2EEGA 4H11A 2VRFA 2VSPA 1UJDA 4L8NA 1V5LA 1G9OA 4Z33A 4E35A 2G5MB 3R0HA 4Q6SA 5E22A 1WFGA 2G2LA 4NMPA 4JOEA 1WH1A 1Y8TA 1U3BA 1WHAA 1KWAA 1UHPA 5G1EA 1FC7A 2F0AA 1TQ3A 1GQ5A 4K78A 3SFJA 1RGWA 2RRMA 1Q3OA 1IU0A 4E3BA 4NMTA 2PKTA 2M0ZA 5F67A 2ZPLA 4IC6A 5HDYA 4YYXA 3VQFA 2JXOA 1T2MA 4JOKA 4XHVA 2DM8A 2OMJA 2KL1A 1FCFA 5GLJA 2H3LA 1U39A 2AINA 4UU5A 5E1YA 3MH6A 5HF4A 1P1DA 5HETA 1V6BA 2OCSA 4NMVA 3O5NA 2QT5A 3QIKA 3GJ9A 3CYYA 2REYA 3NGHA 2JREA 3SHWA 3I4WA 4JOGA 1W9QA 1IU2A 2IWNA 3I18A 1KY9A 3ID3A 2CSSA 4O06A 2H3MA 1N7EA 2K1ZA 1MFGA 1TE0A 2KOJA 1VJ6A 1W9OA 5EYZA 3JXTA 4OEOA 2UZCA 4KFWA 3QO6A 3STJA 5G1DA 2I0IA 3GGEA 3MH4A 3WKLA 2Z9IA 3RL8A 2OZFA 2Q3GA 1UEZA 4P0CA 2W7RA 1MFLA 1OZIA 5HEBA 2V1WA 2M0UA 2KJKA 1N6EA 1VA8A 3ID1A 3GDSA 2I4SA 2H2BA 1V62A 1V5QA 1UEQA 3KZDA 2WL7A 3RL7A 2FE5A 3GDUA 3LNYA 3NFKA 4Q2QA 1UJUA 5HEDA 4Q2OA 4K76A 3EGGC 2X7ZA 2I1NA 2ENOA 3SUZA 2OQSA 1BFEA 3OU0A 1V1TA 3HPMA 5A2PA 1NTEA 1UM7A 1WF8A 4Q3HA 2LOBA 3K82A 2Q9VA 1GQ4A 2OGPA 5HFCA 2QBWA 1VB7A 2QKUA 4JOJA 3DJ1A 3VQGA 1UFXA 2EGNA 4REYA 3QDOA 4OAJA 4Q2NA 1X5RA 2M0VA 5B6LA 2JINA 3DJAA 4NXRA 2EJYA 3PV4A 5D13A 3R68A 2I0LA 4K6YA 3HVQC 1WJLA 2AWWA 2EDZA 2VPHA 1PDRA 1YBOA 2EEJA 4LMMA 4UU6A 3KHFA 3O46A 3DIWA 2YUYA 5FB8C 2GZVA 4E34A 4K72A 5HFDA 2EHRA 1XZ9A 4Q6HA 3I1EA 4GHNA 1OBXA 1VCWA 4NNMA 2O2TA 3B76A 1WI2A 1QAVB 2I6VA 2MHOA 4NXPA
chains in the Genus database with same CATH superfamily
2DJTA 3OTPA 5HJ1A 5HFFA 1OBZA 1B8QA 1WG6A 3KZEA 1UF1A 4K75A 2KBSA 3CBXA 2EEHA 1RZXA 4GVCA 2EDVA 2YT8A 1X45A 3PDVA 2KV8A 3R69A 2E7KA 2M0TA 4OEPA 5F3XA 2KOHA 2I04A 1MC7A 1N7FA 2ZPMA 2YUBA 2QKTA 3L4FD 2YTWA 1I16A 2AWXA 2D8IA 4F8KA 2D92A 2HE4A 5E11A 5HFEA 4JOFA 2EGOA 5HEYA 2V90A 1Q7XA 3AXAA 2R3YA 5E21A 4FLNA 1Z86A 2K20A 3GCNA 1QAUA 1U37A 3ID4A 2FNEA 1Z87A 3PV2A 2M10A 2IWOA 5EZ0A 3EGHC 5FHTA 1ZOKA 1N6FA 2KJPA 4G69A 4JL7A 2KA9A 4NNLA 2YT7A 3CBYA 1GM1A 3K1RA 4EDJA 2RCZA 5ILBA 1Y7NA 2KRGA 3E17A 4MPAA 3QGLA 4FGMA 2IWQA 2JIKA 4R2ZA 2PA1A 2EGKA 2CSJA 4HOPB 3TSWA 1UITA 3ZRTA 2HE2A 1W9EA 2FCFA 3MH7A 2IWPA 2P3WA 1N7TA 2CS5A 4NMOA 2VWRA 2VZ5A 4P2AB 3TMHA 2JILA 3DJ3A 2L97A 1TP5A 3TSVA 1LCYA 3CS0A 3GCOA 2KPKA 2BYGA 1QAVA 2D90A 2M3MA 5HFBA 2OPGA 4AMHA 3CH8A 4Q2PA 1IHJA 2AWUA 2LC6A 1UJVA 4YDPA 2OS6A 3GSLA 1WIFA 4KFVA 1SOZA 3BPUA 2JWEA 2LC7A 2LUIA 4N6XA 3LNXA 1L6OA 2DLUA 1X5QA 1KEFA 5B42A 1RY4A 3CC0A 2W4FA 4JJ3A 4GVDA 2DMZA 4JOPA 2EV8A 3K50A 2EXGA 3CBZA 2EEIA 4NMSA 5I7ZA 3WKMA 4Z8JA 1X5NA 1N99A 2OSGA 1WHDA 4JORA 3NFLA 3TSZA 2JSNA 1M5ZA 2L4SA 5H3JA 2EDPA 4WYUA 3ID2A 5HF1A 4NMRA 1QLCA 5JXBA 1FC6A 1TP3A 2QKVA 2MX6A 1FC9A 3GDVA 1UEWA 2KG2A 2KQFA 2KAWA 3PV5A 2HGAA 2L4TA 1OBYA 2KJDA 1Q3PA 3DORA 5GNDA 1X8SA 2R4HA 3RLEA 2PNTA 1R6JA 2DC2A 4NXQA 3QJMA 2DLSA 1WF7A 1WFVA 1P1EA 2JOAA 1UEPA 2PDZA 1K32A 3KDGA 2PZDA 2VSVA 1N6DA 2KYLA 2FN5A 1VAEA 2F5YA 1UM1A 3QJNA 4HOPA 3PS4A 4RI0A 5E6PB 2QG1A 1ZUBA 3NCVA 1RGRA 2PKUA 3PDZA 2DB5A 5DTHA 2KOMA 3FY5A 1WI4A 3QE1A 4JOHA 1X6DA 3SOEA 2EAQA 2DAZA 4NMQA 1BE9A 2LA8A 3SHUA 2H2CA 1D5GA 1U38A 2Z17A 3HPKA 1NF3C 1SOTA 2DKRA 4WYTA 4PQWA 2KPLA 1I92A 2EEGA 4H11A 2VRFA 2VSPA 1UJDA 4L8NA 1V5LA 1G9OA 4Z33A 4E35A 2G5MB 3R0HA 4Q6SA 5E22A 1WFGA 2G2LA 4NMPA 4JOEA 1WH1A 1Y8TA 1U3BA 1WHAA 1KWAA 1UHPA 5G1EA 1FC7A 2F0AA 1TQ3A 1GQ5A 4K78A 3SFJA 1RGWA 2RRMA 1Q3OA 1IU0A 4E3BA 4NMTA 2PKTA 2M0ZA 5F67A 2ZPLA 4IC6A 5HDYA 4YYXA 3VQFA 2JXOA 1T2MA 4JOKA 4XHVA 2DM8A 2OMJA 2KL1A 1FCFA 5GLJA 2H3LA 1U39A 2AINA 4UU5A 5E1YA 3MH6A 5HF4A 1P1DA 5HETA 1V6BA 2OCSA 4NMVA 3O5NA 2QT5A 3QIKA 3GJ9A 3CYYA 2REYA 3NGHA 2JREA 3SHWA 3I4WA 3KDKA 4JOGA 1W9QA 1IU2A 2IWNA 3I18A 1KY9A 3ID3A 2CSSA 4O06A 2H3MA 1N7EA 2K1ZA 1MFGA 1TE0A 2KOJA 1VJ6A 1W9OA 5EYZA 3JXTA 4OEOA 2UZCA 4KFWA 3QO6A 3STJA 5G1DA 2I0IA 3GGEA 3MH4A 3WKLA 2Z9IA 3RL8A 2OZFA 2Q3GA 1UEZA 4P0CA 2W7RA 1MFLA 1OZIA 5HEBA 2V1WA 2M0UA 2KJKA 1N6EA 1VA8A 3ID1A 3GDSA 5IL9A 2I4SA 2H2BA 1V62A 1V5QA 1UEQA 3KZDA 2WL7A 3RL7A 2FE5A 3GDUA 3LNYA 3NFKA 4Q2QA 1UJUA 5HEDA 4Q2OA 4K76A 3EGGC 2X7ZA 2I1NA 2ENOA 3SUZA 2OQSA 1BFEA 3OU0A 1V1TA 3HPMA 5A2PA 1NTEA 1UM7A 1WF8A 4Q3HA 2LOBA 3K82A 2Q9VA 1GQ4A 2OGPA 5HFCA 2QBWA 1VB7A 2QKUA 4JOJA 3DJ1A 3VQGA 1UFXA 4JJ0A 2EGNA 4REYA 3QDOA 4OAJA 4Q2NA 1X5RA 2M0VA 5B6LA 2JINA 3DJAA 4NXRA 2EJYA 3PV4A 5D13A 3R68A 2I0LA 4K6YA 3HVQC 1WJLA 2AWWA 2EDZA 2VPHA 2GEFA 1PDRA 1YBOA 2EEJA 4LMMA 4UU6A 3KHFA 3O46A 3DIWA 2YUYA 5FB8C 2GZVA 4E34A 3GABA 4K72A 2EHRA 5HFDA 1XZ9A 4Q6HA 3I1EA 4GHNA 1OBXA 1X9ZA 1VCWA 4NNMA 2O2TA 3B76A 1WI2A 1QAVB 2I6VA 2MHOA 4NXPA
chains in the Genus database with same CATH topology
2DJTA 3OTPA 5HJ1A 5HFFA 1OBZA 1B8QA 1WG6A 3KZEA 1UF1A 4K75A 2KBSA 3CBXA 2EEHA 1RZXA 4GVCA 2EDVA 2YT8A 1X45A 3PDVA 2KV8A 3R69A 2E7KA 2M0TA 4OEPA 5F3XA 2KOHA 2I04A 1MC7A 1N7FA 2ZPMA 2YUBA 2QKTA 3L4FD 2YTWA 1I16A 2AWXA 2D8IA 4F8KA 2D92A 2HE4A 5E11A 5HFEA 4JOFA 2EGOA 5HEYA 2V90A 1Q7XA 3AXAA 2R3YA 5E21A 4FLNA 1Z86A 2K20A 3GCNA 1QAUA 1U37A 3ID4A 2FNEA 1Z87A 3PV2A 2M10A 2IWOA 5EZ0A 3EGHC 5FHTA 1ZOKA 1N6FA 2KJPA 4G69A 4JL7A 2KA9A 4NNLA 2YT7A 3CBYA 1GM1A 3K1RA 4EDJA 2RCZA 5ILBA 1Y7NA 2KRGA 3E17A 4MPAA 3QGLA 4FGMA 2IWQA 2JIKA 4R2ZA 2PA1A 2EGKA 2CSJA 4HOPB 3TSWA 1UITA 3ZRTA 2HE2A 1W9EA 2FCFA 3MH7A 2IWPA 2P3WA 1N7TA 2CS5A 4NMOA 2VWRA 2VZ5A 4P2AB 3TMHA 2JILA 3DJ3A 2L97A 1TP5A 3TSVA 1LCYA 3CS0A 3GCOA 2KPKA 2BYGA 1QAVA 2D90A 2M3MA 5HFBA 2OPGA 4AMHA 3CH8A 4Q2PA 1IHJA 2AWUA 2LC6A 1UJVA 4YDPA 2OS6A 3GSLA 1WIFA 4KFVA 1SOZA 3BPUA 2JWEA 2LC7A 2LUIA 4N6XA 3LNXA 1L6OA 2DLUA 1X5QA 1KEFA 5B42A 1RY4A 3CC0A 2W4FA 4JJ3A 4GVDA 2DMZA 4JOPA 2EV8A 3K50A 2EXGA 3CBZA 2EEIA 4NMSA 5I7ZA 3WKMA 4Z8JA 1X5NA 1N99A 2OSGA 1WHDA 4JORA 3NFLA 3TSZA 2JSNA 1M5ZA 2L4SA 5H3JA 2EDPA 4WYUA 3ID2A 5HF1A 4NMRA 1QLCA 5JXBA 1FC6A 1TP3A 2QKVA 2MX6A 1FC9A 3GDVA 1UEWA 2KG2A 2KQFA 2KAWA 3PV5A 2HGAA 2L4TA 1OBYA 2KJDA 1Q3PA 3DORA 5GNDA 1X8SA 2R4HA 3RLEA 2PNTA 1R6JA 2DC2A 4NXQA 3QJMA 2DLSA 1WF7A 1WFVA 1P1EA 2JOAA 1UEPA 2PDZA 1K32A 3KDGA 2PZDA 2VSVA 1N6DA 2KYLA 2FN5A 1VAEA 2F5YA 1UM1A 3QJNA 4HOPA 3PS4A 4RI0A 5E6PB 2QG1A 1ZUBA 3NCVA 1RGRA 2PKUA 3PDZA 2DB5A 5DTHA 2KOMA 3FY5A 1WI4A 3QE1A 4JOHA 1X6DA 3SOEA 2EAQA 2DAZA 4NMQA 1BE9A 2LA8A 3SHUA 2H2CA 1D5GA 1U38A 2Z17A 3HPKA 1NF3C 1SOTA 2DKRA 4WYTA 4PQWA 2KPLA 1I92A 2EEGA 4H11A 2VRFA 2VSPA 1UJDA 4L8NA 1V5LA 1G9OA 4Z33A 4E35A 2G5MB 3R0HA 4Q6SA 5E22A 1WFGA 2G2LA 4NMPA 4JOEA 1WH1A 1Y8TA 1U3BA 1WHAA 1KWAA 1UHPA 5G1EA 1FC7A 2F0AA 1TQ3A 1GQ5A 4K78A 3SFJA 1RGWA 2RRMA 1Q3OA 1IU0A 4E3BA 4NMTA 2PKTA 2M0ZA 5F67A 2ZPLA 4IC6A 5HDYA 4YYXA 3VQFA 2JXOA 1T2MA 4JOKA 4XHVA 2DM8A 2OMJA 2KL1A 1FCFA 5GLJA 2H3LA 1U39A 2AINA 4UU5A 5E1YA 3MH6A 5HF4A 1P1DA 5HETA 1V6BA 2OCSA 4NMVA 3O5NA 2QT5A 3QIKA 3GJ9A 3CYYA 2REYA 3NGHA 2JREA 3SHWA 3I4WA 3KDKA 4JOGA 1W9QA 1IU2A 2IWNA 3I18A 1KY9A 3ID3A 2CSSA 4O06A 2H3MA 1N7EA 2K1ZA 1MFGA 1TE0A 2KOJA 1VJ6A 1W9OA 5EYZA 3JXTA 4OEOA 2UZCA 4KFWA 3QO6A 3STJA 5G1DA 2I0IA 3GGEA 3MH4A 3WKLA 2Z9IA 3RL8A 2OZFA 2Q3GA 1UEZA 4P0CA 2W7RA 1MFLA 1OZIA 5HEBA 2V1WA 2M0UA 2KJKA 1N6EA 1VA8A 3ID1A 3GDSA 5IL9A 2I4SA 2H2BA 1V62A 1V5QA 1UEQA 3KZDA 2WL7A 3RL7A 2FE5A 3GDUA 3LNYA 3NFKA 4Q2QA 1UJUA 5HEDA 4Q2OA 4K76A 3EGGC 2X7ZA 2I1NA 2ENOA 3SUZA 2OQSA 1BFEA 3OU0A 1V1TA 3HPMA 5A2PA 1NTEA 1UM7A 1WF8A 4Q3HA 2LOBA 3K82A 2Q9VA 1GQ4A 2OGPA 5HFCA 2QBWA 1VB7A 2QKUA 4JOJA 3DJ1A 3VQGA 1UFXA 4JJ0A 2EGNA 4REYA 3QDOA 4OAJA 4Q2NA 1X5RA 2M0VA 5B6LA 2JINA 3DJAA 4NXRA 2EJYA 3PV4A 5D13A 3R68A 2I0LA 4K6YA 3HVQC 1WJLA 2AWWA 2EDZA 2VPHA 2GEFA 1PDRA 1YBOA 2EEJA 4LMMA 4UU6A 3KHFA 3O46A 3DIWA 2YUYA 5FB8C 2GZVA 4E34A 3GABA 4K72A 2EHRA 5HFDA 1XZ9A 4Q6HA 3I1EA 4GHNA 1OBXA 1X9ZA 1VCWA 4NNMA 2O2TA 3B76A 1WI2A 1QAVB 2I6VA 2MHOA 4NXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJT A;  3OTP A;  5HJ1 A;  5HFF A;  1OBZ A;  1B8Q A;  1WG6 A;  3KZE A;  1UF1 A;  4K75 A;  2KBS A;  3CBX A;  2EEH A;  1RZX A;  4GVC A;  2EDV A;  2YT8 A;  1X45 A;  3PDV A;  2KV8 A;  3R69 A;  2E7K A;  2M0T A;  4OEP A;  5F3X A;  2KOH A;  2I04 A;  1MC7 A;  1N7F A;  2ZPM A;  2YUB A;  2QKT A;  3L4F D;  2YTW A;  1I16 A;  2AWX A;  2D8I A;  4F8K A;  2D92 A;  2HE4 A;  5E11 A;  5HFE A;  4JOF A;  2EGO A;  5HEY A;  2V90 A;  1Q7X A;  3AXA A;  2R3Y A;  5E21 A;  1Z86 A;  2K20 A;  3GCN A;  1QAU A;  1U37 A;  3ID4 A;  2FNE A;  1Z87 A;  3PV2 A;  2M10 A;  2IWO A;  5EZ0 A;  3EGH C;  5FHT A;  1ZOK A;  1N6F A;  2KJP A;  4G69 A;  4JL7 A;  2KA9 A;  4NNL A;  2YT7 A;  3CBY A;  1GM1 A;  3K1R A;  4EDJ A;  2RCZ A;  1Y7N A;  2KRG A;  3E17 A;  4MPA A;  3QGL A;  4FGM A;  2IWQ A;  2JIK A;  4R2Z A;  2PA1 A;  2EGK A;  2CSJ A;  4HOP B;  3TSW A;  1UIT A;  3ZRT A;  2HE2 A;  1W9E A;  2FCF A;  3MH7 A;  2IWP A;  2P3W A;  1N7T A;  2CS5 A;  4NMO A;  2VWR A;  2VZ5 A;  4P2A B;  3TMH A;  2JIL A;  3DJ3 A;  2L97 A;  1TP5 A;  3TSV A;  1LCY A;  3CS0 A;  3GCO A;  2KPK A;  2BYG A;  1QAV A;  2D90 A;  2M3M A;  5HFB A;  2OPG A;  4AMH A;  3CH8 A;  4Q2P A;  1IHJ A;  2AWU A;  2LC6 A;  1UJV A;  4YDP A;  2OS6 A;  3GSL A;  1WIF A;  4KFV A;  1SOZ A;  3BPU A;  2JWE A;  2LC7 A;  2LUI A;  4N6X A;  3LNX A;  1L6O A;  2DLU A;  1X5Q A;  1KEF A;  1RY4 A;  3CC0 A;  2W4F A;  4GVD A;  2DMZ A;  4JOP A;  2EV8 A;  3K50 A;  2EXG A;  3CBZ A;  2EEI A;  4NMS A;  5I7Z A;  3WKM A;  4Z8J A;  1X5N A;  1N99 A;  2OSG A;  1WHD A;  4JOR A;  3NFL A;  3TSZ A;  1M5Z A;  2L4S A;  5H3J A;  2EDP A;  4WYU A;  3ID2 A;  5HF1 A;  4NMR A;  1QLC A;  5JXB A;  1FC6 A;  1TP3 A;  2QKV A;  2MX6 A;  1FC9 A;  3GDV A;  1UEW A;  2KG2 A;  2KQF A;  2KAW A;  3PV5 A;  2HGA A;  2L4T A;  1OBY A;  2KJD A;  1Q3P A;  3DOR A;  5GND A;  1X8S A;  2R4H A;  3RLE A;  2PNT A;  1R6J A;  2DC2 A;  4NXQ A;  3QJM A;  2DLS A;  1WF7 A;  1WFV A;  1P1E A;  2JOA A;  1UEP A;  2PDZ A;  1K32 A;  2PZD A;  2VSV A;  1N6D A;  2KYL A;  2FN5 A;  1VAE A;  2F5Y A;  1UM1 A;  3QJN A;  4HOP A;  3PS4 A;  4RI0 A;  5E6P B;  2QG1 A;  1ZUB A;  1RGR A;  2PKU A;  3PDZ A;  2DB5 A;  5DTH A;  2KOM A;  3FY5 A;  1WI4 A;  3QE1 A;  4JOH A;  1X6D A;  3SOE A;  2EAQ A;  2DAZ A;  4NMQ A;  1BE9 A;  2LA8 A;  3SHU A;  2H2C A;  1D5G A;  1U38 A;  2Z17 A;  3HPK A;  1NF3 C;  1SOT A;  2DKR A;  4WYT A;  4PQW A;  2KPL A;  1I92 A;  2EEG A;  4H11 A;  2VRF A;  2VSP A;  1UJD A;  4L8N A;  1V5L A;  1G9O A;  4Z33 A;  4E35 A;  2G5M B;  3R0H A;  4Q6S A;  5E22 A;  1WFG A;  2G2L A;  4NMP A;  4JOE A;  1WH1 A;  1Y8T A;  1U3B A;  1WHA A;  1KWA A;  1UHP A;  5G1E A;  1FC7 A;  2F0A A;  1TQ3 A;  1GQ5 A;  4K78 A;  3SFJ A;  1RGW A;  2RRM A;  1Q3O A;  1IU0 A;  4E3B A;  4NMT A;  2PKT A;  2M0Z A;  5F67 A;  2ZPL A;  4IC6 A;  5HDY A;  4YYX A;  3VQF A;  2JXO A;  1T2M A;  4JOK A;  4XHV A;  2DM8 A;  2OMJ A;  2KL1 A;  1FCF A;  5GLJ A;  2H3L A;  1U39 A;  2AIN A;  4UU5 A;  5E1Y A;  3MH6 A;  5HF4 A;  1P1D A;  5HET A;  1V6B A;  2OCS A;  4NMV A;  3O5N A;  2QT5 A;  3QIK A;  3GJ9 A;  3CYY A;  2REY A;  3NGH A;  2JRE A;  3SHW A;  3I4W A;  4JOG A;  1W9Q A;  1IU2 A;  2IWN A;  3I18 A;  1KY9 A;  3ID3 A;  2CSS A;  4O06 A;  2H3M A;  1N7E A;  2K1Z A;  1MFG A;  1TE0 A;  2KOJ A;  1VJ6 A;  1W9O A;  5EYZ A;  3JXT A;  4OEO A;  2UZC A;  4KFW A;  3QO6 A;  3STJ A;  5G1D A;  2I0I A;  3GGE A;  3MH4 A;  3WKL A;  2Z9I A;  3RL8 A;  2OZF A;  2Q3G A;  1UEZ A;  4P0C A;  2W7R A;  1MFL A;  1OZI A;  5HEB A;  2V1W A;  2M0U A;  2KJK A;  1N6E A;  1VA8 A;  3ID1 A;  3GDS A;  2I4S A;  2H2B A;  1V62 A;  1V5Q A;  1UEQ A;  3KZD A;  2WL7 A;  3RL7 A;  2FE5 A;  3GDU A;  3LNY A;  3NFK A;  4Q2Q A;  1UJU A;  5HED A;  4Q2O A;  4K76 A;  3EGG C;  2X7Z A;  2I1N A;  2ENO A;  3SUZ A;  2OQS A;  1BFE A;  3OU0 A;  1V1T A;  3HPM A;  5A2P A;  1NTE A;  1UM7 A;  1WF8 A;  4Q3H A;  2LOB A;  3K82 A;  2Q9V A;  1GQ4 A;  2OGP A;  5HFC A;  2QBW A;  1VB7 A;  2QKU A;  4JOJ A;  3DJ1 A;  3VQG A;  1UFX A;  2EGN A;  4REY A;  3QDO A;  4OAJ A;  4Q2N A;  1X5R A;  2M0V A;  5B6L A;  2JIN A;  3DJA A;  4NXR A;  2EJY A;  3PV4 A;  5D13 A;  3R68 A;  2I0L A;  4K6Y A;  3HVQ C;  1WJL A;  2AWW A;  2EDZ A;  2VPH A;  1PDR A;  1YBO A;  2EEJ A;  4LMM A;  4UU6 A;  3KHF A;  3O46 A;  3DIW A;  2YUY A;  5FB8 C;  2GZV A;  4E34 A;  4K72 A;  5HFD A;  2EHR A;  1XZ9 A;  4Q6H A;  3I1E A;  4GHN A;  1OBX A;  1VCW A;  4NNM A;  2O2T A;  3B76 A;  1WI2 A;  1QAV B;  2I6V A;  2MHO A;  4NXP A; 
#chains in the Genus database with same CATH topology
 2DJT A;  3OTP A;  5HJ1 A;  5HFF A;  1OBZ A;  1B8Q A;  1WG6 A;  3KZE A;  1UF1 A;  4K75 A;  2KBS A;  3CBX A;  2EEH A;  1RZX A;  4GVC A;  2EDV A;  2YT8 A;  1X45 A;  3PDV A;  2KV8 A;  3R69 A;  2E7K A;  2M0T A;  4OEP A;  5F3X A;  2KOH A;  2I04 A;  1MC7 A;  1N7F A;  2ZPM A;  2YUB A;  2QKT A;  3L4F D;  2YTW A;  1I16 A;  2AWX A;  2D8I A;  4F8K A;  2D92 A;  2HE4 A;  5E11 A;  5HFE A;  4JOF A;  2EGO A;  5HEY A;  2V90 A;  1Q7X A;  3AXA A;  2R3Y A;  5E21 A;  4FLN A;  1Z86 A;  2K20 A;  3GCN A;  1QAU A;  1U37 A;  3ID4 A;  2FNE A;  1Z87 A;  3PV2 A;  2M10 A;  2IWO A;  5EZ0 A;  3EGH C;  5FHT A;  1ZOK A;  1N6F A;  2KJP A;  4G69 A;  4JL7 A;  2KA9 A;  4NNL A;  2YT7 A;  3CBY A;  1GM1 A;  3K1R A;  4EDJ A;  2RCZ A;  5ILB A;  1Y7N A;  2KRG A;  3E17 A;  4MPA A;  3QGL A;  4FGM A;  2IWQ A;  2JIK A;  4R2Z A;  2PA1 A;  2EGK A;  2CSJ A;  4HOP B;  3TSW A;  1UIT A;  3ZRT A;  2HE2 A;  1W9E A;  2FCF A;  3MH7 A;  2IWP A;  2P3W A;  1N7T A;  2CS5 A;  4NMO A;  2VWR A;  2VZ5 A;  4P2A B;  3TMH A;  2JIL A;  3DJ3 A;  2L97 A;  1TP5 A;  3TSV A;  1LCY A;  3CS0 A;  3GCO A;  2KPK A;  2BYG A;  1QAV A;  2D90 A;  2M3M A;  5HFB A;  2OPG A;  4AMH A;  3CH8 A;  4Q2P A;  1IHJ A;  2AWU A;  2LC6 A;  1UJV A;  4YDP A;  2OS6 A;  3GSL A;  1WIF A;  4KFV A;  1SOZ A;  3BPU A;  2JWE A;  2LC7 A;  2LUI A;  4N6X A;  3LNX A;  1L6O A;  2DLU A;  1X5Q A;  1KEF A;  5B42 A;  1RY4 A;  3CC0 A;  2W4F A;  4JJ3 A;  4GVD A;  2DMZ A;  4JOP A;  2EV8 A;  3K50 A;  2EXG A;  3CBZ A;  2EEI A;  4NMS A;  5I7Z A;  3WKM A;  4Z8J A;  1X5N A;  1N99 A;  2OSG A;  1WHD A;  4JOR A;  3NFL A;  3TSZ A;  2JSN A;  1M5Z A;  2L4S A;  5H3J A;  2EDP A;  4WYU A;  3ID2 A;  5HF1 A;  4NMR A;  1QLC A;  5JXB A;  1FC6 A;  1TP3 A;  2QKV A;  2MX6 A;  1FC9 A;  3GDV A;  1UEW A;  2KG2 A;  2KQF A;  2KAW A;  3PV5 A;  2HGA A;  2L4T A;  1OBY A;  2KJD A;  1Q3P A;  3DOR A;  5GND A;  1X8S A;  2R4H A;  3RLE A;  2PNT A;  1R6J A;  2DC2 A;  4NXQ A;  3QJM A;  2DLS A;  1WF7 A;  1WFV A;  1P1E A;  2JOA A;  1UEP A;  2PDZ A;  1K32 A;  3KDG A;  2PZD A;  2VSV A;  1N6D A;  2KYL A;  2FN5 A;  1VAE A;  2F5Y A;  1UM1 A;  3QJN A;  4HOP A;  3PS4 A;  4RI0 A;  5E6P B;  2QG1 A;  1ZUB A;  3NCV A;  1RGR A;  2PKU A;  3PDZ A;  2DB5 A;  5DTH A;  2KOM A;  3FY5 A;  1WI4 A;  3QE1 A;  4JOH A;  1X6D A;  3SOE A;  2EAQ A;  2DAZ A;  4NMQ A;  1BE9 A;  2LA8 A;  3SHU A;  2H2C A;  1D5G A;  1U38 A;  2Z17 A;  3HPK A;  1NF3 C;  1SOT A;  2DKR A;  4WYT A;  4PQW A;  2KPL A;  1I92 A;  2EEG A;  4H11 A;  2VRF A;  2VSP A;  1UJD A;  4L8N A;  1V5L A;  1G9O A;  4Z33 A;  4E35 A;  2G5M B;  3R0H A;  4Q6S A;  5E22 A;  1WFG A;  2G2L A;  4NMP A;  4JOE A;  1WH1 A;  1Y8T A;  1U3B A;  1WHA A;  1KWA A;  1UHP A;  5G1E A;  1FC7 A;  2F0A A;  1TQ3 A;  1GQ5 A;  4K78 A;  3SFJ A;  1RGW A;  2RRM A;  1Q3O A;  1IU0 A;  4E3B A;  4NMT A;  2PKT A;  2M0Z A;  5F67 A;  2ZPL A;  4IC6 A;  5HDY A;  4YYX A;  3VQF A;  2JXO A;  1T2M A;  4JOK A;  4XHV A;  2DM8 A;  2OMJ A;  2KL1 A;  1FCF A;  5GLJ A;  2H3L A;  1U39 A;  2AIN A;  4UU5 A;  5E1Y A;  3MH6 A;  5HF4 A;  1P1D A;  5HET A;  1V6B A;  2OCS A;  4NMV A;  3O5N A;  2QT5 A;  3QIK A;  3GJ9 A;  3CYY A;  2REY A;  3NGH A;  2JRE A;  3SHW A;  3I4W A;  3KDK A;  4JOG A;  1W9Q A;  1IU2 A;  2IWN A;  3I18 A;  1KY9 A;  3ID3 A;  2CSS A;  4O06 A;  2H3M A;  1N7E A;  2K1Z A;  1MFG A;  1TE0 A;  2KOJ A;  1VJ6 A;  1W9O A;  5EYZ A;  3JXT A;  4OEO A;  2UZC A;  4KFW A;  3QO6 A;  3STJ A;  5G1D A;  2I0I A;  3GGE A;  3MH4 A;  3WKL A;  2Z9I A;  3RL8 A;  2OZF A;  2Q3G A;  1UEZ A;  4P0C A;  2W7R A;  1MFL A;  1OZI A;  5HEB A;  2V1W A;  2M0U A;  2KJK A;  1N6E A;  1VA8 A;  3ID1 A;  3GDS A;  5IL9 A;  2I4S A;  2H2B A;  1V62 A;  1V5Q A;  1UEQ A;  3KZD A;  2WL7 A;  3RL7 A;  2FE5 A;  3GDU A;  3LNY A;  3NFK A;  4Q2Q A;  1UJU A;  5HED A;  4Q2O A;  4K76 A;  3EGG C;  2X7Z A;  2I1N A;  2ENO A;  3SUZ A;  2OQS A;  1BFE A;  3OU0 A;  1V1T A;  3HPM A;  5A2P A;  1NTE A;  1UM7 A;  1WF8 A;  4Q3H A;  2LOB A;  3K82 A;  2Q9V A;  1GQ4 A;  2OGP A;  5HFC A;  2QBW A;  1VB7 A;  2QKU A;  4JOJ A;  3DJ1 A;  3VQG A;  1UFX A;  4JJ0 A;  2EGN A;  4REY A;  3QDO A;  4OAJ A;  4Q2N A;  1X5R A;  2M0V A;  5B6L A;  2JIN A;  3DJA A;  4NXR A;  2EJY A;  3PV4 A;  5D13 A;  3R68 A;  2I0L A;  4K6Y A;  3HVQ C;  1WJL A;  2AWW A;  2EDZ A;  2VPH A;  2GEF A;  1PDR A;  1YBO A;  2EEJ A;  4LMM A;  4UU6 A;  3KHF A;  3O46 A;  3DIW A;  2YUY A;  5FB8 C;  2GZV A;  4E34 A;  3GAB A;  4K72 A;  2EHR A;  5HFD A;  1XZ9 A;  4Q6H A;  3I1E A;  4GHN A;  1OBX A;  1X9Z A;  1VCW A;  4NNM A;  2O2T A;  3B76 A;  1WI2 A;  1QAV B;  2I6V A;  2MHO A;  4NXP A; 
#chains in the Genus database with same CATH homology
 2DJT A;  3OTP A;  5HJ1 A;  5HFF A;  1OBZ A;  1B8Q A;  1WG6 A;  3KZE A;  1UF1 A;  4K75 A;  2KBS A;  3CBX A;  2EEH A;  1RZX A;  4GVC A;  2EDV A;  2YT8 A;  1X45 A;  3PDV A;  2KV8 A;  3R69 A;  2E7K A;  2M0T A;  4OEP A;  5F3X A;  2KOH A;  2I04 A;  1MC7 A;  1N7F A;  2ZPM A;  2YUB A;  2QKT A;  3L4F D;  2YTW A;  1I16 A;  2AWX A;  2D8I A;  4F8K A;  2D92 A;  2HE4 A;  5E11 A;  5HFE A;  4JOF A;  2EGO A;  5HEY A;  2V90 A;  1Q7X A;  3AXA A;  2R3Y A;  5E21 A;  4FLN A;  1Z86 A;  2K20 A;  3GCN A;  1QAU A;  1U37 A;  3ID4 A;  2FNE A;  1Z87 A;  3PV2 A;  2M10 A;  2IWO A;  5EZ0 A;  3EGH C;  5FHT A;  1ZOK A;  1N6F A;  2KJP A;  4G69 A;  4JL7 A;  2KA9 A;  4NNL A;  2YT7 A;  3CBY A;  1GM1 A;  3K1R A;  4EDJ A;  2RCZ A;  5ILB A;  1Y7N A;  2KRG A;  3E17 A;  4MPA A;  3QGL A;  4FGM A;  2IWQ A;  2JIK A;  4R2Z A;  2PA1 A;  2EGK A;  2CSJ A;  4HOP B;  3TSW A;  1UIT A;  3ZRT A;  2HE2 A;  1W9E A;  2FCF A;  3MH7 A;  2IWP A;  2P3W A;  1N7T A;  2CS5 A;  4NMO A;  2VWR A;  2VZ5 A;  4P2A B;  3TMH A;  2JIL A;  3DJ3 A;  2L97 A;  1TP5 A;  3TSV A;  1LCY A;  3CS0 A;  3GCO A;  2KPK A;  2BYG A;  1QAV A;  2D90 A;  2M3M A;  5HFB A;  2OPG A;  4AMH A;  3CH8 A;  4Q2P A;  1IHJ A;  2AWU A;  2LC6 A;  1UJV A;  4YDP A;  2OS6 A;  3GSL A;  1WIF A;  4KFV A;  1SOZ A;  3BPU A;  2JWE A;  2LC7 A;  2LUI A;  4N6X A;  3LNX A;  1L6O A;  2DLU A;  1X5Q A;  1KEF A;  5B42 A;  1RY4 A;  3CC0 A;  2W4F A;  4JJ3 A;  4GVD A;  2DMZ A;  4JOP A;  2EV8 A;  3K50 A;  2EXG A;  3CBZ A;  2EEI A;  4NMS A;  5I7Z A;  3WKM A;  4Z8J A;  1X5N A;  1N99 A;  2OSG A;  1WHD A;  4JOR A;  3NFL A;  3TSZ A;  2JSN A;  1M5Z A;  2L4S A;  5H3J A;  2EDP A;  4WYU A;  3ID2 A;  5HF1 A;  4NMR A;  1QLC A;  5JXB A;  1FC6 A;  1TP3 A;  2QKV A;  2MX6 A;  1FC9 A;  3GDV A;  1UEW A;  2KG2 A;  2KQF A;  2KAW A;  3PV5 A;  2HGA A;  2L4T A;  1OBY A;  2KJD A;  1Q3P A;  3DOR A;  5GND A;  1X8S A;  2R4H A;  3RLE A;  2PNT A;  1R6J A;  2DC2 A;  4NXQ A;  3QJM A;  2DLS A;  1WF7 A;  1WFV A;  1P1E A;  2JOA A;  1UEP A;  2PDZ A;  1K32 A;  3KDG A;  2PZD A;  2VSV A;  1N6D A;  2KYL A;  2FN5 A;  1VAE A;  2F5Y A;  1UM1 A;  3QJN A;  4HOP A;  3PS4 A;  4RI0 A;  5E6P B;  2QG1 A;  1ZUB A;  3NCV A;  1RGR A;  2PKU A;  3PDZ A;  2DB5 A;  5DTH A;  2KOM A;  3FY5 A;  1WI4 A;  3QE1 A;  4JOH A;  1X6D A;  3SOE A;  2EAQ A;  2DAZ A;  4NMQ A;  1BE9 A;  2LA8 A;  3SHU A;  2H2C A;  1D5G A;  1U38 A;  2Z17 A;  3HPK A;  1NF3 C;  1SOT A;  2DKR A;  4WYT A;  4PQW A;  2KPL A;  1I92 A;  2EEG A;  4H11 A;  2VRF A;  2VSP A;  1UJD A;  4L8N A;  1V5L A;  1G9O A;  4Z33 A;  4E35 A;  2G5M B;  3R0H A;  4Q6S A;  5E22 A;  1WFG A;  2G2L A;  4NMP A;  4JOE A;  1WH1 A;  1Y8T A;  1U3B A;  1WHA A;  1KWA A;  1UHP A;  5G1E A;  1FC7 A;  2F0A A;  1TQ3 A;  1GQ5 A;  4K78 A;  3SFJ A;  1RGW A;  2RRM A;  1Q3O A;  1IU0 A;  4E3B A;  4NMT A;  2PKT A;  2M0Z A;  5F67 A;  2ZPL A;  4IC6 A;  5HDY A;  4YYX A;  3VQF A;  2JXO A;  1T2M A;  4JOK A;  4XHV A;  2DM8 A;  2OMJ A;  2KL1 A;  1FCF A;  5GLJ A;  2H3L A;  1U39 A;  2AIN A;  4UU5 A;  5E1Y A;  3MH6 A;  5HF4 A;  1P1D A;  5HET A;  1V6B A;  2OCS A;  4NMV A;  3O5N A;  2QT5 A;  3QIK A;  3GJ9 A;  3CYY A;  2REY A;  3NGH A;  2JRE A;  3SHW A;  3I4W A;  3KDK A;  4JOG A;  1W9Q A;  1IU2 A;  2IWN A;  3I18 A;  1KY9 A;  3ID3 A;  2CSS A;  4O06 A;  2H3M A;  1N7E A;  2K1Z A;  1MFG A;  1TE0 A;  2KOJ A;  1VJ6 A;  1W9O A;  5EYZ A;  3JXT A;  4OEO A;  2UZC A;  4KFW A;  3QO6 A;  3STJ A;  5G1D A;  2I0I A;  3GGE A;  3MH4 A;  3WKL A;  2Z9I A;  3RL8 A;  2OZF A;  2Q3G A;  1UEZ A;  4P0C A;  2W7R A;  1MFL A;  1OZI A;  5HEB A;  2V1W A;  2M0U A;  2KJK A;  1N6E A;  1VA8 A;  3ID1 A;  3GDS A;  5IL9 A;  2I4S A;  2H2B A;  1V62 A;  1V5Q A;  1UEQ A;  3KZD A;  2WL7 A;  3RL7 A;  2FE5 A;  3GDU A;  3LNY A;  3NFK A;  4Q2Q A;  1UJU A;  5HED A;  4Q2O A;  4K76 A;  3EGG C;  2X7Z A;  2I1N A;  2ENO A;  3SUZ A;  2OQS A;  1BFE A;  3OU0 A;  1V1T A;  3HPM A;  5A2P A;  1NTE A;  1UM7 A;  1WF8 A;  4Q3H A;  2LOB A;  3K82 A;  2Q9V A;  1GQ4 A;  2OGP A;  5HFC A;  2QBW A;  1VB7 A;  2QKU A;  4JOJ A;  3DJ1 A;  3VQG A;  1UFX A;  4JJ0 A;  2EGN A;  4REY A;  3QDO A;  4OAJ A;  4Q2N A;  1X5R A;  2M0V A;  5B6L A;  2JIN A;  3DJA A;  4NXR A;  2EJY A;  3PV4 A;  5D13 A;  3R68 A;  2I0L A;  4K6Y A;  3HVQ C;  1WJL A;  2AWW A;  2EDZ A;  2VPH A;  2GEF A;  1PDR A;  1YBO A;  2EEJ A;  4LMM A;  4UU6 A;  3KHF A;  3O46 A;  3DIW A;  2YUY A;  5FB8 C;  2GZV A;  4E34 A;  3GAB A;  4K72 A;  2EHR A;  5HFD A;  1XZ9 A;  4Q6H A;  3I1E A;  4GHN A;  1OBX A;  1X9Z A;  1VCW A;  4NNM A;  2O2T A;  3B76 A;  1WI2 A;  1QAV B;  2I6V A;  2MHO A;  4NXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...