2JIKA

Crystal structure of pdz domain of synaptojanin-2 binding protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
SMDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLESSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNAPTOJANIN-2 BINDING PROTEIN
publication title Crystal Structure of Pdz Domain of Synaptojanin-2 Binding Protein
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 25
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2jikA00
5HFCA 4OEOA 2G5MB 3GDVA 4F8KA 1X6DA 3QO6A 1U39A 2VSVA 2W4FA 3PV4A 1FC7A 4UU6A 2ZPMA 3PV2A 4O06A 4E35A 1KY9A 5D13A 4XHVA 3EGHC 2OCSA 5HFFA 1QAVA 1IU0A 2Z9IA 1FCFA 1MFLA 1N6EA 1G9OA 2F0AA 1RY4A 2PA1A 2VZ5A 3RLEA 2OMJA 2LC6A 3K1RA 3KZDA 3TSZA 2DLSA 2I4SA 3EGGC 3QE1A 4G69A 3I1EA 5HDYA 2KBSA 2M0TA 2KPLA 2QG1A 2KL1A 2KRGA 2EGKA 5HEDA 3WKLA 3KHFA 2KOHA 2AWWA 1VCWA 3LNXA 1V1TA 4JOJA 1WFGA 2DMZA 4NMOA 2M0UA 2HE2A 2FCFA 2YTWA 3CBXA 1L6OA 4FGMA 4P0CA 3ID3A 2EGOA 2QKTA 5E1YA 1NTEA 1BE9A 1FC6A 4GVDA 2E7KA 3K82A 3GDSA 4Z33A 5G1EA 4NMPA 4K76A 4E3BA 1UJUA 4JOFA 3MH6A 3DJAA 2F5YA 2ZPLA 5FHTA 2D8IA 3PDVA 4NMVA 2X7ZA 1V5LA 3PDZA 2M10A 4IC6A 2EHRA 2Q3GA 1OBYA 4K78A 4NNMA 1N7FA 5HFEA 2PKTA 2JILA 2R3YA 3STJA 3VQGA 2PKUA 1UEQA 1BFEA 1Q3OA 2REYA 4RI0A 1Y7NA 2EXGA 5GNDA 2I1NA 1U37A 2KQFA 2EDZA 2HE4A 2OPGA 2DKRA 4NXPA 1X5NA 3TSWA 1X8SA 4L8NA 1QAVB 3SOEA 2PNTA 1TE0A 4WYTA 3B76A 2CSSA 2YT8A 4KFWA 3ZRTA 1V6BA 2KJDA 1N6DA 2AWXA 2FNEA 3GSLA 1R6JA 2R4HA 2VSPA 4P2AB 5HF4A 2KV8A 2EEIA 2RRMA 1W9QA 3O5NA 2Z17A 3E17A 2YT7A 1NF3C 1N6FA 5HEBA 2YUBA 1FC9A 1WF7A 1V62A 1WHDA 3CBZA 3CC0A 2L4TA 1UJDA 1UITA 3DIWA 2CSJA 3KZEA 4MPAA 4Q2PA 2I0LA 2QKVA 1ZUBA 5E11A 1ZOKA 2IWNA 4HOPA 2RCZA 4NXRA 3R0HA 1WI4A 1W9EA 1RGWA 4Q2QA 3MH4A 2KJKA 5HJ1A 2EEJA 1N99A 5EZ0A 1IHJA 1KEFA 1U3BA 3QJMA 4K6YA 2K20A 3ID1A 3GGEA 2AWUA 1Z86A 1Q3PA 2JOAA 2ENOA 3QIKA 4JORA 1D5GA 2W7RA 3SFJA 2WL7A 1RGRA 2QT5A 2G2LA 1VJ6A 1WIFA 1T2MA 4Q2NA 5F67A 3CS0A 2EJYA 2V1WA 5B6LA 3GCOA 2IWQA 2KOMA 2EDVA 1X5RA 1UFXA 2IWPA 2EGNA 4E34A 2KA9A 2I6VA 1UF1A 4NXQA 1VA8A 2GZVA 2KAWA 5HFDA 1I92A 2H3LA 5EYZA 2I0IA 2CS5A 3HPMA 3L4FD 3DJ1A 5E22A 1OBZA 4Z8JA 2I04A 2K1ZA 1RZXA 2L97A 2VRFA 5HEYA 4YDPA 3LNYA 4Q6HA 4Q6SA 1VAEA 1W9OA 3DJ3A 2YUYA 3SHWA 3CH8A 2PZDA 2EDPA 3TMHA 1VB7A 2LC7A 4PQWA 4R2ZA 3I4WA 2JINA 2KG2A 3ID2A 1PDRA 2EAQA 2DAZA 2KYLA 3JXTA 1Z87A 1I16A 4NMTA 4REYA 4N6XA 2DB5A 3WKMA 1WFVA 5F3XA 3FY5A 3CBYA 3K50A 4OAJA 2DJTA 1P1DA 3OTPA 1MC7A 4JOPA 1GQ4A 4JL7A 3R69A 5A2PA 5HFBA 3DORA 2M3MA 2OQSA 1N7EA 5DTHA 3R68A 2BYGA 2EEHA 1X5QA 1QAUA 2FE5A 4NMRA 2IWOA 1XZ9A 3GDUA 4KFVA 4HOPB 3NFKA 4OEPA 2EV8A 1Q7XA 3BPUA 3O46A 1N7TA 2M0ZA 4JOGA 4GHNA 4AMHA 5HF1A 1TP3A 1LCYA 1UEZA 5HETA 1P1EA 2QBWA 3SHUA 5H3JA 2JXOA 3QJNA 5I7ZA 1OZIA 4JOEA 4Q2OA 2MX6A 2AINA 4NNLA 3GCNA 3MH7A 2JWEA 4JOHA 3HVQC 2MHOA 1OBXA 2P3WA 3PV5A 1SOTA 1WI2A 1X45A 2VPHA 4LMMA 2Q9VA 5JXBA 4NMQA 2LUIA 3GJ9A 4H11A 2LOBA 1B8QA 2O2TA 1IU2A 1MFGA 5E6PB 1TP5A 2VWRA 3SUZA 2OZFA 1UEWA 3NFLA 3NGHA 3CYYA 4K75A 3VQFA 1WH1A 2DC2A 2UZCA 2H2CA 2OSGA 1UM7A 3RL8A 3AXAA 1UEPA 5E21A 2D92A 3TSVA 4NMSA 3QDOA 1WG6A 1KWAA 1M5ZA 1UM1A 2DLUA 3I18A 2QKUA 4JOKA 2H2BA 2HGAA 1YBOA 5G1DA 3OU0A 2L4SA 2LA8A 1UJVA 4GVCA 1WJLA 5FB8C 1SOZA 1GQ5A 3ID4A 2KPKA 4UU5A 4YYXA 2H3MA 1K32A 4Q3HA 2EEGA 1WHAA 1GM1A 1WF8A 2KJPA 2DM8A 3QGLA 1UHPA 3HPKA 2M0VA 3RL7A 4WYUA 2V90A 1U38A 2FN5A 2D90A 1V5QA 1TQ3A 2JIKA 1QLCA 2OS6A 2PDZA 5GLJA 2OGPA 2KOJA 1Y8TA 4EDJA 3PS4A 2JREA 4K72A
chains in the Genus database with same CATH superfamily
5HFCA 4OEOA 2G5MB 3GDVA 4F8KA 1X6DA 3QO6A 1U39A 2VSVA 2W4FA 3PV4A 1FC7A 4UU6A 2ZPMA 3PV2A 4O06A 4E35A 1KY9A 5D13A 4XHVA 3EGHC 2OCSA 5HFFA 1QAVA 1IU0A 2Z9IA 1FCFA 4JJ3A 1MFLA 1N6EA 1G9OA 2F0AA 1RY4A 2PA1A 2VZ5A 3RLEA 2OMJA 2LC6A 3K1RA 3KZDA 3TSZA 2DLSA 2I4SA 3EGGC 3QE1A 4G69A 3I1EA 5HDYA 2KBSA 2M0TA 2KPLA 2QG1A 2KL1A 2KRGA 2GEFA 2EGKA 5HEDA 3WKLA 3KHFA 2KOHA 2AWWA 1VCWA 3LNXA 1V1TA 3GABA 4JOJA 1WFGA 2DMZA 5B42A 4NMOA 2M0UA 2HE2A 2FCFA 2YTWA 3CBXA 1L6OA 4FGMA 4P0CA 3ID3A 2EGOA 2QKTA 5E1YA 1NTEA 1BE9A 1FC6A 4GVDA 2E7KA 3K82A 3GDSA 4Z33A 5G1EA 4NMPA 4K76A 4E3BA 1UJUA 4JOFA 3MH6A 3DJAA 2F5YA 2ZPLA 5FHTA 2D8IA 3PDVA 4NMVA 2X7ZA 1V5LA 3PDZA 2M10A 4IC6A 2EHRA 2Q3GA 1OBYA 4K78A 4NNMA 1N7FA 5HFEA 2PKTA 2JILA 2R3YA 3STJA 3VQGA 2PKUA 1UEQA 1BFEA 1Q3OA 2REYA 4RI0A 1Y7NA 2EXGA 5GNDA 2I1NA 1U37A 2KQFA 2EDZA 2HE4A 2OPGA 2DKRA 4NXPA 1X5NA 3TSWA 1X8SA 4L8NA 1QAVB 3SOEA 2PNTA 1TE0A 4WYTA 3B76A 2CSSA 2YT8A 4KFWA 3ZRTA 1V6BA 2KJDA 1N6DA 2AWXA 2FNEA 3GSLA 1R6JA 2R4HA 2VSPA 4P2AB 5HF4A 2KV8A 2EEIA 2RRMA 1W9QA 3O5NA 2Z17A 5ILBA 3E17A 2YT7A 1NF3C 1N6FA 5HEBA 2YUBA 1FC9A 1WF7A 1V62A 1WHDA 3CBZA 3CC0A 2L4TA 1UJDA 1UITA 3DIWA 2CSJA 3KZEA 4MPAA 4Q2PA 2I0LA 2QKVA 1ZUBA 5E11A 1ZOKA 2IWNA 4HOPA 2RCZA 4NXRA 3R0HA 1WI4A 1W9EA 1RGWA 4Q2QA 3MH4A 2KJKA 5HJ1A 2EEJA 1N99A 5EZ0A 1IHJA 1KEFA 1U3BA 3QJMA 4K6YA 2K20A 3ID1A 3GGEA 4FLNA 2AWUA 1Z86A 1Q3PA 2JOAA 2ENOA 3QIKA 4JORA 1D5GA 2W7RA 3SFJA 2WL7A 1RGRA 2QT5A 2G2LA 1VJ6A 1WIFA 1T2MA 4Q2NA 5F67A 3CS0A 2EJYA 2V1WA 5B6LA 3GCOA 2IWQA 2KOMA 2EDVA 1X5RA 1UFXA 2IWPA 2EGNA 4E34A 2KA9A 2I6VA 1UF1A 4NXQA 1VA8A 2GZVA 2KAWA 5HFDA 1I92A 2H3LA 5EYZA 2I0IA 2CS5A 3HPMA 3L4FD 3DJ1A 5E22A 1OBZA 4Z8JA 2I04A 2K1ZA 1RZXA 2L97A 2VRFA 3KDKA 5HEYA 4YDPA 3LNYA 4Q6HA 4Q6SA 1VAEA 1W9OA 3DJ3A 2YUYA 3SHWA 3CH8A 2PZDA 2EDPA 3TMHA 1VB7A 2LC7A 4PQWA 4R2ZA 3I4WA 2JINA 2KG2A 3ID2A 1PDRA 2EAQA 2DAZA 2KYLA 3JXTA 1Z87A 1I16A 4NMTA 4REYA 4N6XA 2DB5A 3WKMA 1WFVA 5F3XA 3FY5A 3CBYA 3K50A 4OAJA 2DJTA 2JSNA 1P1DA 3OTPA 1MC7A 4JOPA 1GQ4A 4JL7A 3R69A 5A2PA 5HFBA 3DORA 2M3MA 2OQSA 1N7EA 5DTHA 3R68A 2BYGA 2EEHA 1X5QA 1QAUA 2FE5A 4NMRA 2IWOA 3NCVA 1XZ9A 3GDUA 4KFVA 4HOPB 3NFKA 4OEPA 2EV8A 1Q7XA 3BPUA 3O46A 1N7TA 2M0ZA 4JOGA 4GHNA 4AMHA 5HF1A 1TP3A 1LCYA 1UEZA 5HETA 1P1EA 2QBWA 3SHUA 5H3JA 2JXOA 3QJNA 5I7ZA 1OZIA 4JOEA 4Q2OA 2MX6A 2AINA 4NNLA 3GCNA 3MH7A 2JWEA 4JOHA 3HVQC 2MHOA 1OBXA 2P3WA 3PV5A 1SOTA 1WI2A 1X45A 1X9ZA 2VPHA 4LMMA 2Q9VA 5JXBA 4NMQA 2LUIA 3GJ9A 4H11A 2LOBA 1B8QA 2O2TA 1IU2A 1MFGA 5E6PB 1TP5A 5IL9A 2VWRA 3SUZA 2OZFA 1UEWA 3NFLA 3NGHA 3CYYA 4K75A 3VQFA 1WH1A 2DC2A 2UZCA 2H2CA 2OSGA 1UM7A 3RL8A 3AXAA 1UEPA 5E21A 2D92A 3TSVA 4NMSA 3QDOA 1WG6A 1KWAA 1M5ZA 1UM1A 2DLUA 3I18A 2QKUA 4JOKA 2H2BA 2HGAA 1YBOA 5G1DA 3OU0A 2L4SA 2LA8A 1UJVA 4GVCA 1WJLA 5FB8C 1SOZA 1GQ5A 3ID4A 2KPKA 4UU5A 4YYXA 2H3MA 1K32A 4Q3HA 2EEGA 1WHAA 1GM1A 1WF8A 2KJPA 2DM8A 4JJ0A 3QGLA 1UHPA 3HPKA 2M0VA 3RL7A 4WYUA 2V90A 1U38A 2FN5A 2D90A 1V5QA 3KDGA 1TQ3A 2JIKA 1QLCA 2OS6A 2PDZA 5GLJA 2OGPA 2KOJA 1Y8TA 4EDJA 3PS4A 2JREA 4K72A
chains in the Genus database with same CATH topology
5HFCA 4OEOA 2G5MB 3GDVA 4F8KA 1X6DA 3QO6A 1U39A 2VSVA 2W4FA 3PV4A 1FC7A 4UU6A 2ZPMA 3PV2A 4O06A 4E35A 1KY9A 5D13A 4XHVA 3EGHC 2OCSA 5HFFA 1QAVA 1IU0A 2Z9IA 1FCFA 4JJ3A 1MFLA 1N6EA 1G9OA 2F0AA 1RY4A 2PA1A 2VZ5A 3RLEA 2OMJA 2LC6A 3K1RA 3KZDA 3TSZA 2DLSA 2I4SA 3EGGC 3QE1A 4G69A 3I1EA 5HDYA 2KBSA 2M0TA 2KPLA 2QG1A 2KL1A 2KRGA 2GEFA 2EGKA 5HEDA 3WKLA 3KHFA 2KOHA 2AWWA 1VCWA 3LNXA 1V1TA 3GABA 4JOJA 1WFGA 2DMZA 5B42A 4NMOA 2M0UA 2HE2A 2FCFA 2YTWA 3CBXA 1L6OA 4FGMA 4P0CA 3ID3A 2EGOA 2QKTA 5E1YA 1NTEA 1BE9A 1FC6A 4GVDA 2E7KA 3K82A 3GDSA 4Z33A 5G1EA 4NMPA 4K76A 4E3BA 1UJUA 4JOFA 3MH6A 3DJAA 2F5YA 2ZPLA 5FHTA 2D8IA 3PDVA 4NMVA 2X7ZA 1V5LA 3PDZA 2M10A 4IC6A 2EHRA 2Q3GA 1OBYA 4K78A 4NNMA 1N7FA 5HFEA 2PKTA 2JILA 2R3YA 3STJA 3VQGA 2PKUA 1UEQA 1BFEA 1Q3OA 2REYA 4RI0A 1Y7NA 2EXGA 5GNDA 2I1NA 1U37A 2KQFA 2EDZA 2HE4A 2OPGA 2DKRA 4NXPA 1X5NA 3TSWA 1X8SA 4L8NA 1QAVB 3SOEA 2PNTA 1TE0A 4WYTA 3B76A 2CSSA 2YT8A 4KFWA 3ZRTA 1V6BA 2KJDA 1N6DA 2AWXA 2FNEA 3GSLA 1R6JA 2R4HA 2VSPA 4P2AB 5HF4A 2KV8A 2EEIA 2RRMA 1W9QA 3O5NA 2Z17A 5ILBA 3E17A 2YT7A 1NF3C 1N6FA 5HEBA 2YUBA 1FC9A 1WF7A 1V62A 1WHDA 3CBZA 3CC0A 2L4TA 1UJDA 1UITA 3DIWA 2CSJA 3KZEA 4MPAA 4Q2PA 2I0LA 2QKVA 1ZUBA 5E11A 1ZOKA 2IWNA 4HOPA 2RCZA 4NXRA 3R0HA 1WI4A 1W9EA 1RGWA 4Q2QA 3MH4A 2KJKA 5HJ1A 2EEJA 1N99A 5EZ0A 1IHJA 1KEFA 1U3BA 3QJMA 4K6YA 2K20A 3ID1A 3GGEA 4FLNA 2AWUA 1Z86A 1Q3PA 2JOAA 2ENOA 3QIKA 4JORA 1D5GA 2W7RA 3SFJA 2WL7A 1RGRA 2QT5A 2G2LA 1VJ6A 1WIFA 1T2MA 4Q2NA 5F67A 3CS0A 2EJYA 2V1WA 5B6LA 3GCOA 2IWQA 2KOMA 2EDVA 1X5RA 1UFXA 2IWPA 2EGNA 4E34A 2KA9A 2I6VA 1UF1A 4NXQA 1VA8A 2GZVA 2KAWA 5HFDA 1I92A 2H3LA 5EYZA 2I0IA 2CS5A 3HPMA 3L4FD 3DJ1A 5E22A 1OBZA 4Z8JA 2I04A 2K1ZA 1RZXA 2L97A 2VRFA 3KDKA 5HEYA 4YDPA 3LNYA 4Q6HA 4Q6SA 1VAEA 1W9OA 3DJ3A 2YUYA 3SHWA 3CH8A 2PZDA 2EDPA 3TMHA 1VB7A 2LC7A 4PQWA 4R2ZA 3I4WA 2JINA 2KG2A 3ID2A 1PDRA 2EAQA 2DAZA 2KYLA 3JXTA 1Z87A 1I16A 4NMTA 4REYA 4N6XA 2DB5A 3WKMA 1WFVA 5F3XA 3FY5A 3CBYA 3K50A 4OAJA 2DJTA 2JSNA 1P1DA 3OTPA 1MC7A 4JOPA 1GQ4A 4JL7A 3R69A 5A2PA 5HFBA 3DORA 2M3MA 2OQSA 1N7EA 5DTHA 3R68A 2BYGA 2EEHA 1X5QA 1QAUA 2FE5A 4NMRA 2IWOA 3NCVA 1XZ9A 3GDUA 4KFVA 4HOPB 3NFKA 4OEPA 2EV8A 1Q7XA 3BPUA 3O46A 1N7TA 2M0ZA 4JOGA 4GHNA 4AMHA 5HF1A 1TP3A 1LCYA 1UEZA 5HETA 1P1EA 2QBWA 3SHUA 5H3JA 2JXOA 3QJNA 5I7ZA 1OZIA 4JOEA 4Q2OA 2MX6A 2AINA 4NNLA 3GCNA 3MH7A 2JWEA 4JOHA 3HVQC 2MHOA 1OBXA 2P3WA 3PV5A 1SOTA 1WI2A 1X45A 1X9ZA 2VPHA 4LMMA 2Q9VA 5JXBA 4NMQA 2LUIA 3GJ9A 4H11A 2LOBA 1B8QA 2O2TA 1IU2A 1MFGA 5E6PB 1TP5A 5IL9A 2VWRA 3SUZA 2OZFA 1UEWA 3NFLA 3NGHA 3CYYA 4K75A 3VQFA 1WH1A 2DC2A 2UZCA 2H2CA 2OSGA 1UM7A 3RL8A 3AXAA 1UEPA 5E21A 2D92A 3TSVA 4NMSA 3QDOA 1WG6A 1KWAA 1M5ZA 1UM1A 2DLUA 3I18A 2QKUA 4JOKA 2H2BA 2HGAA 1YBOA 5G1DA 3OU0A 2L4SA 2LA8A 1UJVA 4GVCA 1WJLA 5FB8C 1SOZA 1GQ5A 3ID4A 2KPKA 4UU5A 4YYXA 2H3MA 1K32A 4Q3HA 2EEGA 1WHAA 1GM1A 1WF8A 2KJPA 2DM8A 4JJ0A 3QGLA 1UHPA 3HPKA 2M0VA 3RL7A 4WYUA 2V90A 1U38A 2FN5A 2D90A 1V5QA 3KDGA 1TQ3A 2JIKA 1QLCA 2OS6A 2PDZA 5GLJA 2OGPA 2KOJA 1Y8TA 4EDJA 3PS4A 2JREA 4K72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFC A;  4OEO A;  2G5M B;  3GDV A;  4F8K A;  1X6D A;  3QO6 A;  1U39 A;  2VSV A;  2W4F A;  3PV4 A;  1FC7 A;  4UU6 A;  2ZPM A;  3PV2 A;  4O06 A;  4E35 A;  1KY9 A;  5D13 A;  4XHV A;  3EGH C;  2OCS A;  5HFF A;  1QAV A;  1IU0 A;  2Z9I A;  1FCF A;  1MFL A;  1N6E A;  1G9O A;  2F0A A;  1RY4 A;  2PA1 A;  2VZ5 A;  3RLE A;  2OMJ A;  2LC6 A;  3K1R A;  3KZD A;  3TSZ A;  2DLS A;  2I4S A;  3EGG C;  3QE1 A;  4G69 A;  3I1E A;  5HDY A;  2KBS A;  2M0T A;  2KPL A;  2QG1 A;  2KL1 A;  2KRG A;  2EGK A;  5HED A;  3WKL A;  3KHF A;  2KOH A;  2AWW A;  1VCW A;  3LNX A;  1V1T A;  4JOJ A;  1WFG A;  2DMZ A;  4NMO A;  2M0U A;  2HE2 A;  2FCF A;  2YTW A;  3CBX A;  1L6O A;  4FGM A;  4P0C A;  3ID3 A;  2EGO A;  2QKT A;  5E1Y A;  1NTE A;  1BE9 A;  1FC6 A;  4GVD A;  2E7K A;  3K82 A;  3GDS A;  4Z33 A;  5G1E A;  4NMP A;  4K76 A;  4E3B A;  1UJU A;  4JOF A;  3MH6 A;  3DJA A;  2F5Y A;  2ZPL A;  5FHT A;  2D8I A;  3PDV A;  4NMV A;  2X7Z A;  1V5L A;  3PDZ A;  2M10 A;  4IC6 A;  2EHR A;  2Q3G A;  1OBY A;  4K78 A;  4NNM A;  1N7F A;  5HFE A;  2PKT A;  2JIL A;  2R3Y A;  3STJ A;  3VQG A;  2PKU A;  1UEQ A;  1BFE A;  1Q3O A;  2REY A;  4RI0 A;  1Y7N A;  2EXG A;  5GND A;  2I1N A;  1U37 A;  2KQF A;  2EDZ A;  2HE4 A;  2OPG A;  2DKR A;  4NXP A;  1X5N A;  3TSW A;  1X8S A;  4L8N A;  1QAV B;  3SOE A;  2PNT A;  1TE0 A;  4WYT A;  3B76 A;  2CSS A;  2YT8 A;  4KFW A;  3ZRT A;  1V6B A;  2KJD A;  1N6D A;  2AWX A;  2FNE A;  3GSL A;  1R6J A;  2R4H A;  2VSP A;  4P2A B;  5HF4 A;  2KV8 A;  2EEI A;  2RRM A;  1W9Q A;  3O5N A;  2Z17 A;  3E17 A;  2YT7 A;  1NF3 C;  1N6F A;  5HEB A;  2YUB A;  1FC9 A;  1WF7 A;  1V62 A;  1WHD A;  3CBZ A;  3CC0 A;  2L4T A;  1UJD A;  1UIT A;  3DIW A;  2CSJ A;  3KZE A;  4MPA A;  4Q2P A;  2I0L A;  2QKV A;  1ZUB A;  5E11 A;  1ZOK A;  2IWN A;  4HOP A;  2RCZ A;  4NXR A;  3R0H A;  1WI4 A;  1W9E A;  1RGW A;  4Q2Q A;  3MH4 A;  2KJK A;  5HJ1 A;  2EEJ A;  1N99 A;  5EZ0 A;  1IHJ A;  1KEF A;  1U3B A;  3QJM A;  4K6Y A;  2K20 A;  3ID1 A;  3GGE A;  2AWU A;  1Z86 A;  1Q3P A;  2JOA A;  2ENO A;  3QIK A;  4JOR A;  1D5G A;  2W7R A;  3SFJ A;  2WL7 A;  1RGR A;  2QT5 A;  2G2L A;  1VJ6 A;  1WIF A;  1T2M A;  4Q2N A;  5F67 A;  3CS0 A;  2EJY A;  2V1W A;  5B6L A;  3GCO A;  2IWQ A;  2KOM A;  2EDV A;  1X5R A;  1UFX A;  2IWP A;  2EGN A;  4E34 A;  2KA9 A;  2I6V A;  1UF1 A;  4NXQ A;  1VA8 A;  2GZV A;  2KAW A;  5HFD A;  1I92 A;  2H3L A;  5EYZ A;  2I0I A;  2CS5 A;  3HPM A;  3L4F D;  3DJ1 A;  5E22 A;  1OBZ A;  4Z8J A;  2I04 A;  2K1Z A;  1RZX A;  2L97 A;  2VRF A;  5HEY A;  4YDP A;  3LNY A;  4Q6H A;  4Q6S A;  1VAE A;  1W9O A;  3DJ3 A;  2YUY A;  3SHW A;  3CH8 A;  2PZD A;  2EDP A;  3TMH A;  1VB7 A;  2LC7 A;  4PQW A;  4R2Z A;  3I4W A;  2JIN A;  2KG2 A;  3ID2 A;  1PDR A;  2EAQ A;  2DAZ A;  2KYL A;  3JXT A;  1Z87 A;  1I16 A;  4NMT A;  4REY A;  4N6X A;  2DB5 A;  3WKM A;  1WFV A;  5F3X A;  3FY5 A;  3CBY A;  3K50 A;  4OAJ A;  2DJT A;  1P1D A;  3OTP A;  1MC7 A;  4JOP A;  1GQ4 A;  4JL7 A;  3R69 A;  5A2P A;  5HFB A;  3DOR A;  2M3M A;  2OQS A;  1N7E A;  5DTH A;  3R68 A;  2BYG A;  2EEH A;  1X5Q A;  1QAU A;  2FE5 A;  4NMR A;  2IWO A;  1XZ9 A;  3GDU A;  4KFV A;  4HOP B;  3NFK A;  4OEP A;  2EV8 A;  1Q7X A;  3BPU A;  3O46 A;  1N7T A;  2M0Z A;  4JOG A;  4GHN A;  4AMH A;  5HF1 A;  1TP3 A;  1LCY A;  1UEZ A;  5HET A;  1P1E A;  2QBW A;  3SHU A;  5H3J A;  2JXO A;  3QJN A;  5I7Z A;  1OZI A;  4JOE A;  4Q2O A;  2MX6 A;  2AIN A;  4NNL A;  3GCN A;  3MH7 A;  2JWE A;  4JOH A;  3HVQ C;  2MHO A;  1OBX A;  2P3W A;  3PV5 A;  1SOT A;  1WI2 A;  1X45 A;  2VPH A;  4LMM A;  2Q9V A;  5JXB A;  4NMQ A;  2LUI A;  3GJ9 A;  4H11 A;  2LOB A;  1B8Q A;  2O2T A;  1IU2 A;  1MFG A;  5E6P B;  1TP5 A;  2VWR A;  3SUZ A;  2OZF A;  1UEW A;  3NFL A;  3NGH A;  3CYY A;  4K75 A;  3VQF A;  1WH1 A;  2DC2 A;  2UZC A;  2H2C A;  2OSG A;  1UM7 A;  3RL8 A;  3AXA A;  1UEP A;  5E21 A;  2D92 A;  3TSV A;  4NMS A;  3QDO A;  1WG6 A;  1KWA A;  1M5Z A;  1UM1 A;  2DLU A;  3I18 A;  2QKU A;  4JOK A;  2H2B A;  2HGA A;  1YBO A;  5G1D A;  3OU0 A;  2L4S A;  2LA8 A;  1UJV A;  4GVC A;  1WJL A;  5FB8 C;  1SOZ A;  1GQ5 A;  3ID4 A;  2KPK A;  4UU5 A;  4YYX A;  2H3M A;  1K32 A;  4Q3H A;  2EEG A;  1WHA A;  1GM1 A;  1WF8 A;  2KJP A;  2DM8 A;  3QGL A;  1UHP A;  3HPK A;  2M0V A;  3RL7 A;  4WYU A;  2V90 A;  1U38 A;  2FN5 A;  2D90 A;  1V5Q A;  1TQ3 A;  2JIK A;  1QLC A;  2OS6 A;  2PDZ A;  5GLJ A;  2OGP A;  2KOJ A;  1Y8T A;  4EDJ A;  3PS4 A;  2JRE A;  4K72 A; 
#chains in the Genus database with same CATH topology
 5HFC A;  4OEO A;  2G5M B;  3GDV A;  4F8K A;  1X6D A;  3QO6 A;  1U39 A;  2VSV A;  2W4F A;  3PV4 A;  1FC7 A;  4UU6 A;  2ZPM A;  3PV2 A;  4O06 A;  4E35 A;  1KY9 A;  5D13 A;  4XHV A;  3EGH C;  2OCS A;  5HFF A;  1QAV A;  1IU0 A;  2Z9I A;  1FCF A;  4JJ3 A;  1MFL A;  1N6E A;  1G9O A;  2F0A A;  1RY4 A;  2PA1 A;  2VZ5 A;  3RLE A;  2OMJ A;  2LC6 A;  3K1R A;  3KZD A;  3TSZ A;  2DLS A;  2I4S A;  3EGG C;  3QE1 A;  4G69 A;  3I1E A;  5HDY A;  2KBS A;  2M0T A;  2KPL A;  2QG1 A;  2KL1 A;  2KRG A;  2GEF A;  2EGK A;  5HED A;  3WKL A;  3KHF A;  2KOH A;  2AWW A;  1VCW A;  3LNX A;  1V1T A;  3GAB A;  4JOJ A;  1WFG A;  2DMZ A;  5B42 A;  4NMO A;  2M0U A;  2HE2 A;  2FCF A;  2YTW A;  3CBX A;  1L6O A;  4FGM A;  4P0C A;  3ID3 A;  2EGO A;  2QKT A;  5E1Y A;  1NTE A;  1BE9 A;  1FC6 A;  4GVD A;  2E7K A;  3K82 A;  3GDS A;  4Z33 A;  5G1E A;  4NMP A;  4K76 A;  4E3B A;  1UJU A;  4JOF A;  3MH6 A;  3DJA A;  2F5Y A;  2ZPL A;  5FHT A;  2D8I A;  3PDV A;  4NMV A;  2X7Z A;  1V5L A;  3PDZ A;  2M10 A;  4IC6 A;  2EHR A;  2Q3G A;  1OBY A;  4K78 A;  4NNM A;  1N7F A;  5HFE A;  2PKT A;  2JIL A;  2R3Y A;  3STJ A;  3VQG A;  2PKU A;  1UEQ A;  1BFE A;  1Q3O A;  2REY A;  4RI0 A;  1Y7N A;  2EXG A;  5GND A;  2I1N A;  1U37 A;  2KQF A;  2EDZ A;  2HE4 A;  2OPG A;  2DKR A;  4NXP A;  1X5N A;  3TSW A;  1X8S A;  4L8N A;  1QAV B;  3SOE A;  2PNT A;  1TE0 A;  4WYT A;  3B76 A;  2CSS A;  2YT8 A;  4KFW A;  3ZRT A;  1V6B A;  2KJD A;  1N6D A;  2AWX A;  2FNE A;  3GSL A;  1R6J A;  2R4H A;  2VSP A;  4P2A B;  5HF4 A;  2KV8 A;  2EEI A;  2RRM A;  1W9Q A;  3O5N A;  2Z17 A;  5ILB A;  3E17 A;  2YT7 A;  1NF3 C;  1N6F A;  5HEB A;  2YUB A;  1FC9 A;  1WF7 A;  1V62 A;  1WHD A;  3CBZ A;  3CC0 A;  2L4T A;  1UJD A;  1UIT A;  3DIW A;  2CSJ A;  3KZE A;  4MPA A;  4Q2P A;  2I0L A;  2QKV A;  1ZUB A;  5E11 A;  1ZOK A;  2IWN A;  4HOP A;  2RCZ A;  4NXR A;  3R0H A;  1WI4 A;  1W9E A;  1RGW A;  4Q2Q A;  3MH4 A;  2KJK A;  5HJ1 A;  2EEJ A;  1N99 A;  5EZ0 A;  1IHJ A;  1KEF A;  1U3B A;  3QJM A;  4K6Y A;  2K20 A;  3ID1 A;  3GGE A;  4FLN A;  2AWU A;  1Z86 A;  1Q3P A;  2JOA A;  2ENO A;  3QIK A;  4JOR A;  1D5G A;  2W7R A;  3SFJ A;  2WL7 A;  1RGR A;  2QT5 A;  2G2L A;  1VJ6 A;  1WIF A;  1T2M A;  4Q2N A;  5F67 A;  3CS0 A;  2EJY A;  2V1W A;  5B6L A;  3GCO A;  2IWQ A;  2KOM A;  2EDV A;  1X5R A;  1UFX A;  2IWP A;  2EGN A;  4E34 A;  2KA9 A;  2I6V A;  1UF1 A;  4NXQ A;  1VA8 A;  2GZV A;  2KAW A;  5HFD A;  1I92 A;  2H3L A;  5EYZ A;  2I0I A;  2CS5 A;  3HPM A;  3L4F D;  3DJ1 A;  5E22 A;  1OBZ A;  4Z8J A;  2I04 A;  2K1Z A;  1RZX A;  2L97 A;  2VRF A;  3KDK A;  5HEY A;  4YDP A;  3LNY A;  4Q6H A;  4Q6S A;  1VAE A;  1W9O A;  3DJ3 A;  2YUY A;  3SHW A;  3CH8 A;  2PZD A;  2EDP A;  3TMH A;  1VB7 A;  2LC7 A;  4PQW A;  4R2Z A;  3I4W A;  2JIN A;  2KG2 A;  3ID2 A;  1PDR A;  2EAQ A;  2DAZ A;  2KYL A;  3JXT A;  1Z87 A;  1I16 A;  4NMT A;  4REY A;  4N6X A;  2DB5 A;  3WKM A;  1WFV A;  5F3X A;  3FY5 A;  3CBY A;  3K50 A;  4OAJ A;  2DJT A;  2JSN A;  1P1D A;  3OTP A;  1MC7 A;  4JOP A;  1GQ4 A;  4JL7 A;  3R69 A;  5A2P A;  5HFB A;  3DOR A;  2M3M A;  2OQS A;  1N7E A;  5DTH A;  3R68 A;  2BYG A;  2EEH A;  1X5Q A;  1QAU A;  2FE5 A;  4NMR A;  2IWO A;  3NCV A;  1XZ9 A;  3GDU A;  4KFV A;  4HOP B;  3NFK A;  4OEP A;  2EV8 A;  1Q7X A;  3BPU A;  3O46 A;  1N7T A;  2M0Z A;  4JOG A;  4GHN A;  4AMH A;  5HF1 A;  1TP3 A;  1LCY A;  1UEZ A;  5HET A;  1P1E A;  2QBW A;  3SHU A;  5H3J A;  2JXO A;  3QJN A;  5I7Z A;  1OZI A;  4JOE A;  4Q2O A;  2MX6 A;  2AIN A;  4NNL A;  3GCN A;  3MH7 A;  2JWE A;  4JOH A;  3HVQ C;  2MHO A;  1OBX A;  2P3W A;  3PV5 A;  1SOT A;  1WI2 A;  1X45 A;  1X9Z A;  2VPH A;  4LMM A;  2Q9V A;  5JXB A;  4NMQ A;  2LUI A;  3GJ9 A;  4H11 A;  2LOB A;  1B8Q A;  2O2T A;  1IU2 A;  1MFG A;  5E6P B;  1TP5 A;  5IL9 A;  2VWR A;  3SUZ A;  2OZF A;  1UEW A;  3NFL A;  3NGH A;  3CYY A;  4K75 A;  3VQF A;  1WH1 A;  2DC2 A;  2UZC A;  2H2C A;  2OSG A;  1UM7 A;  3RL8 A;  3AXA A;  1UEP A;  5E21 A;  2D92 A;  3TSV A;  4NMS A;  3QDO A;  1WG6 A;  1KWA A;  1M5Z A;  1UM1 A;  2DLU A;  3I18 A;  2QKU A;  4JOK A;  2H2B A;  2HGA A;  1YBO A;  5G1D A;  3OU0 A;  2L4S A;  2LA8 A;  1UJV A;  4GVC A;  1WJL A;  5FB8 C;  1SOZ A;  1GQ5 A;  3ID4 A;  2KPK A;  4UU5 A;  4YYX A;  2H3M A;  1K32 A;  4Q3H A;  2EEG A;  1WHA A;  1GM1 A;  1WF8 A;  2KJP A;  2DM8 A;  4JJ0 A;  3QGL A;  1UHP A;  3HPK A;  2M0V A;  3RL7 A;  4WYU A;  2V90 A;  1U38 A;  2FN5 A;  2D90 A;  1V5Q A;  3KDG A;  1TQ3 A;  2JIK A;  1QLC A;  2OS6 A;  2PDZ A;  5GLJ A;  2OGP A;  2KOJ A;  1Y8T A;  4EDJ A;  3PS4 A;  2JRE A;  4K72 A; 
#chains in the Genus database with same CATH homology
 5HFC A;  4OEO A;  2G5M B;  3GDV A;  4F8K A;  1X6D A;  3QO6 A;  1U39 A;  2VSV A;  2W4F A;  3PV4 A;  1FC7 A;  4UU6 A;  2ZPM A;  3PV2 A;  4O06 A;  4E35 A;  1KY9 A;  5D13 A;  4XHV A;  3EGH C;  2OCS A;  5HFF A;  1QAV A;  1IU0 A;  2Z9I A;  1FCF A;  4JJ3 A;  1MFL A;  1N6E A;  1G9O A;  2F0A A;  1RY4 A;  2PA1 A;  2VZ5 A;  3RLE A;  2OMJ A;  2LC6 A;  3K1R A;  3KZD A;  3TSZ A;  2DLS A;  2I4S A;  3EGG C;  3QE1 A;  4G69 A;  3I1E A;  5HDY A;  2KBS A;  2M0T A;  2KPL A;  2QG1 A;  2KL1 A;  2KRG A;  2GEF A;  2EGK A;  5HED A;  3WKL A;  3KHF A;  2KOH A;  2AWW A;  1VCW A;  3LNX A;  1V1T A;  3GAB A;  4JOJ A;  1WFG A;  2DMZ A;  5B42 A;  4NMO A;  2M0U A;  2HE2 A;  2FCF A;  2YTW A;  3CBX A;  1L6O A;  4FGM A;  4P0C A;  3ID3 A;  2EGO A;  2QKT A;  5E1Y A;  1NTE A;  1BE9 A;  1FC6 A;  4GVD A;  2E7K A;  3K82 A;  3GDS A;  4Z33 A;  5G1E A;  4NMP A;  4K76 A;  4E3B A;  1UJU A;  4JOF A;  3MH6 A;  3DJA A;  2F5Y A;  2ZPL A;  5FHT A;  2D8I A;  3PDV A;  4NMV A;  2X7Z A;  1V5L A;  3PDZ A;  2M10 A;  4IC6 A;  2EHR A;  2Q3G A;  1OBY A;  4K78 A;  4NNM A;  1N7F A;  5HFE A;  2PKT A;  2JIL A;  2R3Y A;  3STJ A;  3VQG A;  2PKU A;  1UEQ A;  1BFE A;  1Q3O A;  2REY A;  4RI0 A;  1Y7N A;  2EXG A;  5GND A;  2I1N A;  1U37 A;  2KQF A;  2EDZ A;  2HE4 A;  2OPG A;  2DKR A;  4NXP A;  1X5N A;  3TSW A;  1X8S A;  4L8N A;  1QAV B;  3SOE A;  2PNT A;  1TE0 A;  4WYT A;  3B76 A;  2CSS A;  2YT8 A;  4KFW A;  3ZRT A;  1V6B A;  2KJD A;  1N6D A;  2AWX A;  2FNE A;  3GSL A;  1R6J A;  2R4H A;  2VSP A;  4P2A B;  5HF4 A;  2KV8 A;  2EEI A;  2RRM A;  1W9Q A;  3O5N A;  2Z17 A;  5ILB A;  3E17 A;  2YT7 A;  1NF3 C;  1N6F A;  5HEB A;  2YUB A;  1FC9 A;  1WF7 A;  1V62 A;  1WHD A;  3CBZ A;  3CC0 A;  2L4T A;  1UJD A;  1UIT A;  3DIW A;  2CSJ A;  3KZE A;  4MPA A;  4Q2P A;  2I0L A;  2QKV A;  1ZUB A;  5E11 A;  1ZOK A;  2IWN A;  4HOP A;  2RCZ A;  4NXR A;  3R0H A;  1WI4 A;  1W9E A;  1RGW A;  4Q2Q A;  3MH4 A;  2KJK A;  5HJ1 A;  2EEJ A;  1N99 A;  5EZ0 A;  1IHJ A;  1KEF A;  1U3B A;  3QJM A;  4K6Y A;  2K20 A;  3ID1 A;  3GGE A;  4FLN A;  2AWU A;  1Z86 A;  1Q3P A;  2JOA A;  2ENO A;  3QIK A;  4JOR A;  1D5G A;  2W7R A;  3SFJ A;  2WL7 A;  1RGR A;  2QT5 A;  2G2L A;  1VJ6 A;  1WIF A;  1T2M A;  4Q2N A;  5F67 A;  3CS0 A;  2EJY A;  2V1W A;  5B6L A;  3GCO A;  2IWQ A;  2KOM A;  2EDV A;  1X5R A;  1UFX A;  2IWP A;  2EGN A;  4E34 A;  2KA9 A;  2I6V A;  1UF1 A;  4NXQ A;  1VA8 A;  2GZV A;  2KAW A;  5HFD A;  1I92 A;  2H3L A;  5EYZ A;  2I0I A;  2CS5 A;  3HPM A;  3L4F D;  3DJ1 A;  5E22 A;  1OBZ A;  4Z8J A;  2I04 A;  2K1Z A;  1RZX A;  2L97 A;  2VRF A;  3KDK A;  5HEY A;  4YDP A;  3LNY A;  4Q6H A;  4Q6S A;  1VAE A;  1W9O A;  3DJ3 A;  2YUY A;  3SHW A;  3CH8 A;  2PZD A;  2EDP A;  3TMH A;  1VB7 A;  2LC7 A;  4PQW A;  4R2Z A;  3I4W A;  2JIN A;  2KG2 A;  3ID2 A;  1PDR A;  2EAQ A;  2DAZ A;  2KYL A;  3JXT A;  1Z87 A;  1I16 A;  4NMT A;  4REY A;  4N6X A;  2DB5 A;  3WKM A;  1WFV A;  5F3X A;  3FY5 A;  3CBY A;  3K50 A;  4OAJ A;  2DJT A;  2JSN A;  1P1D A;  3OTP A;  1MC7 A;  4JOP A;  1GQ4 A;  4JL7 A;  3R69 A;  5A2P A;  5HFB A;  3DOR A;  2M3M A;  2OQS A;  1N7E A;  5DTH A;  3R68 A;  2BYG A;  2EEH A;  1X5Q A;  1QAU A;  2FE5 A;  4NMR A;  2IWO A;  3NCV A;  1XZ9 A;  3GDU A;  4KFV A;  4HOP B;  3NFK A;  4OEP A;  2EV8 A;  1Q7X A;  3BPU A;  3O46 A;  1N7T A;  2M0Z A;  4JOG A;  4GHN A;  4AMH A;  5HF1 A;  1TP3 A;  1LCY A;  1UEZ A;  5HET A;  1P1E A;  2QBW A;  3SHU A;  5H3J A;  2JXO A;  3QJN A;  5I7Z A;  1OZI A;  4JOE A;  4Q2O A;  2MX6 A;  2AIN A;  4NNL A;  3GCN A;  3MH7 A;  2JWE A;  4JOH A;  3HVQ C;  2MHO A;  1OBX A;  2P3W A;  3PV5 A;  1SOT A;  1WI2 A;  1X45 A;  1X9Z A;  2VPH A;  4LMM A;  2Q9V A;  5JXB A;  4NMQ A;  2LUI A;  3GJ9 A;  4H11 A;  2LOB A;  1B8Q A;  2O2T A;  1IU2 A;  1MFG A;  5E6P B;  1TP5 A;  5IL9 A;  2VWR A;  3SUZ A;  2OZF A;  1UEW A;  3NFL A;  3NGH A;  3CYY A;  4K75 A;  3VQF A;  1WH1 A;  2DC2 A;  2UZC A;  2H2C A;  2OSG A;  1UM7 A;  3RL8 A;  3AXA A;  1UEP A;  5E21 A;  2D92 A;  3TSV A;  4NMS A;  3QDO A;  1WG6 A;  1KWA A;  1M5Z A;  1UM1 A;  2DLU A;  3I18 A;  2QKU A;  4JOK A;  2H2B A;  2HGA A;  1YBO A;  5G1D A;  3OU0 A;  2L4S A;  2LA8 A;  1UJV A;  4GVC A;  1WJL A;  5FB8 C;  1SOZ A;  1GQ5 A;  3ID4 A;  2KPK A;  4UU5 A;  4YYX A;  2H3M A;  1K32 A;  4Q3H A;  2EEG A;  1WHA A;  1GM1 A;  1WF8 A;  2KJP A;  2DM8 A;  4JJ0 A;  3QGL A;  1UHP A;  3HPK A;  2M0V A;  3RL7 A;  4WYU A;  2V90 A;  1U38 A;  2FN5 A;  2D90 A;  1V5Q A;  3KDG A;  1TQ3 A;  2JIK A;  1QLC A;  2OS6 A;  2PDZ A;  5GLJ A;  2OGP A;  2KOJ A;  1Y8T A;  4EDJ A;  3PS4 A;  2JRE A;  4K72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...