2DC2A

Solution structure of pdz domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
b'PIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords golgi associated PDZ and coiled-coil motif containing isofor
publication title Solution structure of GOPC PDZ domain and its interaction with the C-terminal motif of neuroligin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2dc2A00
1RZXA 2HGAA 2R3YA 2LC7A 3QDOA 1X6DA 4NMOA 3PV5A 2JINA 2JXOA 3LNXA 1U3BA 1GQ5A 1TQ3A 1U37A 1UM1A 5HJ1A 3GDSA 2VZ5A 3K1RA 4NMSA 4K78A 2QKTA 1WI2A 1TP5A 4K6YA 1KY9A 2EDZA 3VQGA 5B6LA 1VB7A 4Z8JA 1I16A 4L8NA 5DTHA 2RRMA 1WJLA 1WFVA 5HEBA 2LA8A 4NMTA 1G9OA 4OEPA 2QKVA 3MH7A 3DIWA 1PDRA 2E7KA 2KL1A 1T2MA 3EGHC 3K50A 4UU5A 1ZOKA 4N6XA 4IC6A 1FC7A 1X5RA 1MC7A 2D90A 2DMZA 1KWAA 4KFVA 1Q3PA 1M5ZA 5HFCA 3RL7A 1MFLA 3SHWA 4NNMA 3L4FD 4JL7A 5HEYA 5G1EA 2DB5A 2QBWA 2H2CA 5E22A 3I1EA 3QO6A 3CBZA 2F5YA 2ZPLA 2EEIA 4PQWA 2JWEA 1U38A 4R2ZA 1Y8TA 2KYLA 1WG6A 5HFDA 2KV8A 4NMVA 1UEPA 4JOGA 1N7FA 1V5QA 4G69A 1UJDA 5GNDA 2OQSA 3O5NA 3CYYA 4K75A 4AMHA 1TE0A 3SFJA 3NFLA 4JOPA 2EEJA 3KZEA 2DAZA 1SOZA 2KJDA 2UZCA 2YUBA 2DLSA 2EAQA 3E17A 3PDVA 4Q2NA 5H3JA 1P1EA 5HFBA 3PS4A 1FCFA 2M3MA 3CBYA 4YYXA 4JORA 1ZUBA 1WHAA 2D8IA 2EXGA 5E21A 2I0IA 2MX6A 1NTEA 3FY5A 3O46A 1N6DA 1IHJA 2EJYA 2HE2A 5D13A 4UU6A 4E35A 2PA1A 2GZVA 2CSSA 5F3XA 1VAEA 3VQFA 3WKMA 1WFGA 2KA9A 4JOHA 3CC0A 2M0UA 2KRGA 1KEFA 2JIKA 1OZIA 2KJKA 1Y7NA 1X45A 2K1ZA 3SUZA 1RY4A 3OTPA 3K82A 1UM7A 3MH4A 1UITA 4NMPA 1RGRA 2W4FA 2CSJA 2AWWA 1V5LA 2OSGA 1TP3A 2EGNA 2KBSA 2P3WA 3QGLA 2QT5A 2KOHA 2BYGA 1OBXA 4GVCA 1WF7A 4JOEA 1RGWA 2QKUA 2MHOA 1P1DA 2F0AA 4NNLA 2ENOA 1N99A 1D5GA 2EGKA 3QE1A 1YBOA 1Z87A 3CS0A 2M0VA 1FC6A 1N7EA 1UEWA 2PKTA 5FHTA 1U39A 3OU0A 5G1DA 2EEGA 2L4SA 5EZ0A 2EGOA 1VA8A 5HFEA 1NF3C 3R0HA 4NMQA 2DJTA 1QAVB 3HPMA 5JXBA 1Q3OA 5HF1A 1LCYA 1W9OA 4F8KA 4Q3HA 1SOTA 1QAVA 2KJPA 4Q6HA 4FGMA 4JOKA 2KPLA 2KG2A 2VWRA 2L97A 1WI4A 3PV2A 2LUIA 2D92A 4HOPB 2YTWA 3GCNA 2OCSA 2V1WA 1GQ4A 2DM8A 2FN5A 2M0TA 5E6PB 2X7ZA 1K32A 5HFFA 3GDUA 3MH6A 4YDPA 2FNEA 5HEDA 1WF8A 3HPKA 2ZPMA 3TSZA 3GGEA 1OBYA 4O06A 4P2AB 2Z17A 1OBZA 3GSLA 3QIKA 3RLEA 2KPKA 2EV8A 4K76A 4NXQA 3SHUA 2VPHA 1UFXA 2WL7A 4Z33A 4H11A 3ZRTA 1BE9A 1BFEA 1XZ9A 5E1YA 2Q3GA 2CS5A 1Q7XA 2LC6A 1IU2A 3I18A 3AXAA 5F67A 2KOMA 4MPAA 1VCWA 2H2BA 2JILA 3WKLA 2PDZA 3ID3A 5HDYA 1X8SA 4E3BA 2O2TA 3HVQC 1GM1A 2IWOA 2Q9VA 4WYTA 2EEHA 2IWQA 2JOAA 2KOJA 3GCOA 4LMMA 2G5MB 1R6JA 1V1TA 2DC2A 2KQFA 2IWNA 2RCZA 2L4TA 2FE5A 2K20A 3B76A 5HETA 2I4SA 3DJAA 3KHFA 4E34A 3NGHA 3PDZA 1X5NA 2JREA 3KZDA 2AINA 4JOFA 1WHDA 4OEOA 5E11A 3R68A 2KAWA 1UHPA 2I04A 2EDVA 3NFKA 2QG1A 3LNYA 3EGGC 5HF4A 3R69A 3TSVA 3DJ3A 2YT7A 3CH8A 3GDVA 1WIFA 2OS6A 1VJ6A 3QJNA 4Q2QA 3I4WA 4Q6SA 3RL8A 4Q2OA 4KFWA 3TMHA 2FCFA 1Z86A 3ID4A 2Z9IA 4K72A 4XHVA 4EDJA 4WYUA 2VSPA 5EYZA 3TSWA 2OPGA 2PNTA 2VRFA 2YT8A 2V90A 4NMRA 1N6FA 2M0ZA 4JOJA 2PZDA 1W9EA 3ID2A 3GJ9A 3STJA 1UJVA 2AWUA 4REYA 2I1NA 1I92A 2LOBA 2HE4A 2IWPA 3QJMA 2H3MA 3BPUA 4HOPA 4Q2PA 1UJUA 1X5QA 2M10A 2OGPA 4NXRA 3SOEA 2DKRA 1FC9A 3DJ1A 2DLUA 4RI0A 5FB8C 4GHNA 2REYA 1N7TA 2VSVA 2YUYA 2PKUA 3PV4A 1V62A 3JXTA 3CBXA 4P0CA 2W7RA 2OMJA 1B8QA 2I6VA 3DORA 3ID1A 2H3LA 1WH1A 2G2LA 4NXPA 5I7ZA 2EHRA 2R4HA 1QLCA 5GLJA 1L6OA 4OAJA 1UEZA 1N6EA 5A2PA 2AWXA 2EDPA 2I0LA 1UEQA 1QAUA 1IU0A 1W9QA 4GVDA 1UF1A 1V6BA 1MFGA 2OZFA
chains in the Genus database with same CATH superfamily
1RZXA 2HGAA 2R3YA 2LC7A 3QDOA 1X6DA 4NMOA 3PV5A 2JINA 2JXOA 3LNXA 1U3BA 1GQ5A 1TQ3A 1U37A 1UM1A 5HJ1A 3GDSA 2VZ5A 3K1RA 4NMSA 4K78A 2QKTA 1WI2A 2JSNA 1TP5A 4K6YA 1KY9A 2EDZA 3VQGA 5B6LA 1VB7A 4Z8JA 1I16A 4L8NA 5DTHA 2RRMA 1WJLA 1X9ZA 1WFVA 5HEBA 2LA8A 4NMTA 1G9OA 4OEPA 2QKVA 3MH7A 3DIWA 1PDRA 2E7KA 2KL1A 1T2MA 3EGHC 3K50A 4UU5A 1ZOKA 4N6XA 4IC6A 1FC7A 1X5RA 1MC7A 2D90A 2DMZA 1KWAA 4KFVA 1Q3PA 1M5ZA 5HFCA 3RL7A 1MFLA 3SHWA 4NNMA 3L4FD 4JL7A 5HEYA 5G1EA 2DB5A 2QBWA 2H2CA 5E22A 3I1EA 3QO6A 3CBZA 2F5YA 2ZPLA 2EEIA 4PQWA 2JWEA 1U38A 4R2ZA 1Y8TA 2KYLA 1WG6A 5HFDA 2KV8A 4NMVA 1UEPA 4JOGA 1N7FA 1V5QA 4G69A 1UJDA 5GNDA 2OQSA 3O5NA 3CYYA 4K75A 4AMHA 1TE0A 3SFJA 3NFLA 4JOPA 2EEJA 3KZEA 2DAZA 1SOZA 2KJDA 2UZCA 2YUBA 2DLSA 2EAQA 3E17A 3PDVA 4Q2NA 5H3JA 1P1EA 5HFBA 3PS4A 1FCFA 2M3MA 3CBYA 3KDKA 4YYXA 4JORA 1ZUBA 1WHAA 2D8IA 2EXGA 5E21A 2I0IA 2MX6A 1NTEA 4FLNA 4JJ3A 3FY5A 3O46A 1N6DA 1IHJA 2EJYA 2HE2A 4JJ0A 5D13A 4UU6A 4E35A 2PA1A 2GZVA 2CSSA 5F3XA 3GABA 1VAEA 3VQFA 3WKMA 1WFGA 2KA9A 4JOHA 3CC0A 2M0UA 2KRGA 1KEFA 2JIKA 1OZIA 2KJKA 1Y7NA 1X45A 2K1ZA 3SUZA 1RY4A 3OTPA 3K82A 1UM7A 3MH4A 1UITA 4NMPA 1RGRA 2W4FA 2CSJA 2AWWA 1V5LA 2OSGA 1TP3A 2EGNA 2KBSA 2P3WA 3QGLA 2QT5A 2KOHA 2BYGA 1OBXA 4GVCA 1WF7A 4JOEA 1RGWA 2QKUA 2MHOA 1P1DA 2F0AA 2GEFA 4NNLA 2ENOA 1N99A 1D5GA 2EGKA 3QE1A 1YBOA 1Z87A 3CS0A 2M0VA 1FC6A 1N7EA 1UEWA 2PKTA 5FHTA 1U39A 3OU0A 5G1DA 2EEGA 2L4SA 5EZ0A 2EGOA 1VA8A 3NCVA 5HFEA 1NF3C 3R0HA 4NMQA 2DJTA 1QAVB 3HPMA 5JXBA 1Q3OA 5HF1A 1LCYA 1W9OA 4F8KA 4Q3HA 1SOTA 3KDGA 1QAVA 2KJPA 4Q6HA 4FGMA 4JOKA 2KPLA 2KG2A 2VWRA 2L97A 1WI4A 3PV2A 2LUIA 2D92A 4HOPB 2YTWA 3GCNA 2OCSA 2V1WA 1GQ4A 2DM8A 2FN5A 2M0TA 5E6PB 2X7ZA 1K32A 5HFFA 3GDUA 3MH6A 4YDPA 2FNEA 5HEDA 1WF8A 3HPKA 2ZPMA 3TSZA 3GGEA 1OBYA 4O06A 4P2AB 2Z17A 1OBZA 3GSLA 3QIKA 3RLEA 2KPKA 2EV8A 4K76A 4NXQA 3SHUA 2VPHA 1UFXA 2WL7A 4Z33A 4H11A 3ZRTA 1BE9A 1BFEA 1XZ9A 5E1YA 2Q3GA 2CS5A 1Q7XA 2LC6A 1IU2A 3I18A 3AXAA 5F67A 2KOMA 4MPAA 1VCWA 2H2BA 2JILA 3WKLA 2PDZA 3ID3A 5HDYA 1X8SA 4E3BA 2O2TA 3HVQC 1GM1A 2IWOA 2Q9VA 4WYTA 2EEHA 2IWQA 2JOAA 2KOJA 3GCOA 4LMMA 2G5MB 1R6JA 1V1TA 2DC2A 2KQFA 2IWNA 2RCZA 2L4TA 2FE5A 2K20A 3B76A 5HETA 2I4SA 3DJAA 3KHFA 4E34A 3NGHA 3PDZA 1X5NA 2JREA 3KZDA 2AINA 4JOFA 1WHDA 4OEOA 5E11A 3R68A 2KAWA 1UHPA 2I04A 2EDVA 3NFKA 2QG1A 3LNYA 3EGGC 5HF4A 3R69A 3TSVA 3DJ3A 2YT7A 3CH8A 3GDVA 1WIFA 2OS6A 1VJ6A 3QJNA 4Q2QA 3I4WA 4Q6SA 3RL8A 4Q2OA 4KFWA 3TMHA 2FCFA 1Z86A 3ID4A 2Z9IA 4K72A 4XHVA 5IL9A 4EDJA 4WYUA 2VSPA 5EYZA 3TSWA 2OPGA 2PNTA 2VRFA 2YT8A 2V90A 4NMRA 1N6FA 2M0ZA 4JOJA 2PZDA 1W9EA 3ID2A 3GJ9A 3STJA 1UJVA 2AWUA 4REYA 2I1NA 1I92A 2LOBA 2HE4A 2IWPA 3QJMA 2H3MA 3BPUA 4HOPA 4Q2PA 1UJUA 1X5QA 2M10A 2OGPA 4NXRA 3SOEA 2DKRA 1FC9A 3DJ1A 2DLUA 4RI0A 5FB8C 5B42A 4GHNA 2REYA 1N7TA 2VSVA 2YUYA 2PKUA 3PV4A 1V62A 3JXTA 3CBXA 4P0CA 2W7RA 2OMJA 1B8QA 2I6VA 3DORA 3ID1A 2H3LA 1WH1A 2G2LA 4NXPA 5I7ZA 2EHRA 2R4HA 1QLCA 5GLJA 1L6OA 4OAJA 1UEZA 1N6EA 5A2PA 2AWXA 2EDPA 2I0LA 1UEQA 1QAUA 5ILBA 1IU0A 1W9QA 4GVDA 1UF1A 1V6BA 1MFGA 2OZFA
chains in the Genus database with same CATH topology
1RZXA 2HGAA 2R3YA 2LC7A 3QDOA 1X6DA 4NMOA 3PV5A 2JINA 2JXOA 3LNXA 1U3BA 1GQ5A 1TQ3A 1U37A 1UM1A 5HJ1A 3GDSA 2VZ5A 3K1RA 4NMSA 4K78A 2QKTA 1WI2A 2JSNA 1TP5A 4K6YA 1KY9A 2EDZA 3VQGA 5B6LA 1VB7A 4Z8JA 1I16A 4L8NA 5DTHA 2RRMA 1WJLA 1X9ZA 1WFVA 5HEBA 2LA8A 4NMTA 1G9OA 4OEPA 2QKVA 3MH7A 3DIWA 1PDRA 2E7KA 2KL1A 1T2MA 3EGHC 3K50A 4UU5A 1ZOKA 4N6XA 4IC6A 1FC7A 1X5RA 1MC7A 2D90A 2DMZA 1KWAA 4KFVA 1Q3PA 1M5ZA 5HFCA 3RL7A 1MFLA 3SHWA 4NNMA 3L4FD 4JL7A 5HEYA 5G1EA 2DB5A 2QBWA 2H2CA 5E22A 3I1EA 3QO6A 3CBZA 2F5YA 2ZPLA 2EEIA 4PQWA 2JWEA 1U38A 4R2ZA 1Y8TA 2KYLA 1WG6A 5HFDA 2KV8A 4NMVA 1UEPA 4JOGA 1N7FA 1V5QA 4G69A 1UJDA 5GNDA 2OQSA 3O5NA 3CYYA 4K75A 4AMHA 1TE0A 3SFJA 3NFLA 4JOPA 2EEJA 3KZEA 2DAZA 1SOZA 2KJDA 2UZCA 2YUBA 2DLSA 2EAQA 3E17A 3PDVA 4Q2NA 5H3JA 1P1EA 5HFBA 3PS4A 1FCFA 2M3MA 3CBYA 3KDKA 4YYXA 4JORA 1ZUBA 1WHAA 2D8IA 2EXGA 5E21A 2I0IA 2MX6A 1NTEA 4FLNA 4JJ3A 3FY5A 3O46A 1N6DA 1IHJA 2EJYA 2HE2A 4JJ0A 5D13A 4UU6A 4E35A 2PA1A 2GZVA 2CSSA 5F3XA 3GABA 1VAEA 3VQFA 3WKMA 1WFGA 2KA9A 4JOHA 3CC0A 2M0UA 2KRGA 1KEFA 2JIKA 1OZIA 2KJKA 1Y7NA 1X45A 2K1ZA 3SUZA 1RY4A 3OTPA 3K82A 1UM7A 3MH4A 1UITA 4NMPA 1RGRA 2W4FA 2CSJA 2AWWA 1V5LA 2OSGA 1TP3A 2EGNA 2KBSA 2P3WA 3QGLA 2QT5A 2KOHA 2BYGA 1OBXA 4GVCA 1WF7A 4JOEA 1RGWA 2QKUA 2MHOA 1P1DA 2F0AA 2GEFA 4NNLA 2ENOA 1N99A 1D5GA 2EGKA 3QE1A 1YBOA 1Z87A 3CS0A 2M0VA 1FC6A 1N7EA 1UEWA 2PKTA 5FHTA 1U39A 3OU0A 5G1DA 2EEGA 2L4SA 5EZ0A 2EGOA 1VA8A 3NCVA 5HFEA 1NF3C 3R0HA 4NMQA 2DJTA 1QAVB 3HPMA 5JXBA 1Q3OA 5HF1A 1LCYA 1W9OA 4F8KA 4Q3HA 1SOTA 3KDGA 1QAVA 2KJPA 4Q6HA 4FGMA 4JOKA 2KPLA 2KG2A 2VWRA 2L97A 1WI4A 3PV2A 2LUIA 2D92A 4HOPB 2YTWA 3GCNA 2OCSA 2V1WA 1GQ4A 2DM8A 2FN5A 2M0TA 5E6PB 2X7ZA 1K32A 5HFFA 3GDUA 3MH6A 4YDPA 2FNEA 5HEDA 1WF8A 3HPKA 2ZPMA 3TSZA 3GGEA 1OBYA 4O06A 4P2AB 2Z17A 1OBZA 3GSLA 3QIKA 3RLEA 2KPKA 2EV8A 4K76A 4NXQA 3SHUA 2VPHA 1UFXA 2WL7A 4Z33A 4H11A 3ZRTA 1BE9A 1BFEA 1XZ9A 5E1YA 2Q3GA 2CS5A 1Q7XA 2LC6A 1IU2A 3I18A 3AXAA 5F67A 2KOMA 4MPAA 1VCWA 2H2BA 2JILA 3WKLA 2PDZA 3ID3A 5HDYA 1X8SA 4E3BA 2O2TA 3HVQC 1GM1A 2IWOA 2Q9VA 4WYTA 2EEHA 2IWQA 2JOAA 2KOJA 3GCOA 4LMMA 2G5MB 1R6JA 1V1TA 2DC2A 2KQFA 2IWNA 2RCZA 2L4TA 2FE5A 2K20A 3B76A 5HETA 2I4SA 3DJAA 3KHFA 4E34A 3NGHA 3PDZA 1X5NA 2JREA 3KZDA 2AINA 4JOFA 1WHDA 4OEOA 5E11A 3R68A 2KAWA 1UHPA 2I04A 2EDVA 3NFKA 2QG1A 3LNYA 3EGGC 5HF4A 3R69A 3TSVA 3DJ3A 2YT7A 3CH8A 3GDVA 1WIFA 2OS6A 1VJ6A 3QJNA 4Q2QA 3I4WA 4Q6SA 3RL8A 4Q2OA 4KFWA 3TMHA 2FCFA 1Z86A 3ID4A 2Z9IA 4K72A 4XHVA 5IL9A 4EDJA 4WYUA 2VSPA 5EYZA 3TSWA 2OPGA 2PNTA 2VRFA 2YT8A 2V90A 4NMRA 1N6FA 2M0ZA 4JOJA 2PZDA 1W9EA 3ID2A 3GJ9A 3STJA 1UJVA 2AWUA 4REYA 2I1NA 1I92A 2LOBA 2HE4A 2IWPA 3QJMA 2H3MA 3BPUA 4HOPA 4Q2PA 1UJUA 1X5QA 2M10A 2OGPA 4NXRA 3SOEA 2DKRA 1FC9A 3DJ1A 2DLUA 4RI0A 5FB8C 5B42A 4GHNA 2REYA 1N7TA 2VSVA 2YUYA 2PKUA 3PV4A 1V62A 3JXTA 3CBXA 4P0CA 2W7RA 2OMJA 1B8QA 2I6VA 3DORA 3ID1A 2H3LA 1WH1A 2G2LA 4NXPA 5I7ZA 2EHRA 2R4HA 1QLCA 5GLJA 1L6OA 4OAJA 1UEZA 1N6EA 5A2PA 2AWXA 2EDPA 2I0LA 1UEQA 1QAUA 5ILBA 1IU0A 1W9QA 4GVDA 1UF1A 1V6BA 1MFGA 2OZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RZX A;  2HGA A;  2R3Y A;  2LC7 A;  3QDO A;  1X6D A;  4NMO A;  3PV5 A;  2JIN A;  2JXO A;  3LNX A;  1U3B A;  1GQ5 A;  1TQ3 A;  1U37 A;  1UM1 A;  5HJ1 A;  3GDS A;  2VZ5 A;  3K1R A;  4NMS A;  4K78 A;  2QKT A;  1WI2 A;  1TP5 A;  4K6Y A;  1KY9 A;  2EDZ A;  3VQG A;  5B6L A;  1VB7 A;  4Z8J A;  1I16 A;  4L8N A;  5DTH A;  2RRM A;  1WJL A;  1WFV A;  5HEB A;  2LA8 A;  4NMT A;  1G9O A;  4OEP A;  2QKV A;  3MH7 A;  3DIW A;  1PDR A;  2E7K A;  2KL1 A;  1T2M A;  3EGH C;  3K50 A;  4UU5 A;  1ZOK A;  4N6X A;  4IC6 A;  1FC7 A;  1X5R A;  1MC7 A;  2D90 A;  2DMZ A;  1KWA A;  4KFV A;  1Q3P A;  1M5Z A;  5HFC A;  3RL7 A;  1MFL A;  3SHW A;  4NNM A;  3L4F D;  4JL7 A;  5HEY A;  5G1E A;  2DB5 A;  2QBW A;  2H2C A;  5E22 A;  3I1E A;  3QO6 A;  3CBZ A;  2F5Y A;  2ZPL A;  2EEI A;  4PQW A;  2JWE A;  1U38 A;  4R2Z A;  1Y8T A;  2KYL A;  1WG6 A;  5HFD A;  2KV8 A;  4NMV A;  1UEP A;  4JOG A;  1N7F A;  1V5Q A;  4G69 A;  1UJD A;  5GND A;  2OQS A;  3O5N A;  3CYY A;  4K75 A;  4AMH A;  1TE0 A;  3SFJ A;  3NFL A;  4JOP A;  2EEJ A;  3KZE A;  2DAZ A;  1SOZ A;  2KJD A;  2UZC A;  2YUB A;  2DLS A;  2EAQ A;  3E17 A;  3PDV A;  4Q2N A;  5H3J A;  1P1E A;  5HFB A;  3PS4 A;  1FCF A;  2M3M A;  3CBY A;  4YYX A;  4JOR A;  1ZUB A;  1WHA A;  2D8I A;  2EXG A;  5E21 A;  2I0I A;  2MX6 A;  1NTE A;  3FY5 A;  3O46 A;  1N6D A;  1IHJ A;  2EJY A;  2HE2 A;  5D13 A;  4UU6 A;  4E35 A;  2PA1 A;  2GZV A;  2CSS A;  5F3X A;  1VAE A;  3VQF A;  3WKM A;  1WFG A;  2KA9 A;  4JOH A;  3CC0 A;  2M0U A;  2KRG A;  1KEF A;  2JIK A;  1OZI A;  2KJK A;  1Y7N A;  1X45 A;  2K1Z A;  3SUZ A;  1RY4 A;  3OTP A;  3K82 A;  1UM7 A;  3MH4 A;  1UIT A;  4NMP A;  1RGR A;  2W4F A;  2CSJ A;  2AWW A;  1V5L A;  2OSG A;  1TP3 A;  2EGN A;  2KBS A;  2P3W A;  3QGL A;  2QT5 A;  2KOH A;  2BYG A;  1OBX A;  4GVC A;  1WF7 A;  4JOE A;  1RGW A;  2QKU A;  2MHO A;  1P1D A;  2F0A A;  4NNL A;  2ENO A;  1N99 A;  1D5G A;  2EGK A;  3QE1 A;  1YBO A;  1Z87 A;  3CS0 A;  2M0V A;  1FC6 A;  1N7E A;  1UEW A;  2PKT A;  5FHT A;  1U39 A;  3OU0 A;  5G1D A;  2EEG A;  2L4S A;  5EZ0 A;  2EGO A;  1VA8 A;  5HFE A;  1NF3 C;  3R0H A;  4NMQ A;  2DJT A;  1QAV B;  3HPM A;  5JXB A;  1Q3O A;  5HF1 A;  1LCY A;  1W9O A;  4F8K A;  4Q3H A;  1SOT A;  1QAV A;  2KJP A;  4Q6H A;  4FGM A;  4JOK A;  2KPL A;  2KG2 A;  2VWR A;  2L97 A;  1WI4 A;  3PV2 A;  2LUI A;  2D92 A;  4HOP B;  2YTW A;  3GCN A;  2OCS A;  2V1W A;  1GQ4 A;  2DM8 A;  2FN5 A;  2M0T A;  5E6P B;  2X7Z A;  1K32 A;  5HFF A;  3GDU A;  3MH6 A;  4YDP A;  2FNE A;  5HED A;  1WF8 A;  3HPK A;  2ZPM A;  3TSZ A;  3GGE A;  1OBY A;  4O06 A;  4P2A B;  2Z17 A;  1OBZ A;  3GSL A;  3QIK A;  3RLE A;  2KPK A;  2EV8 A;  4K76 A;  4NXQ A;  3SHU A;  2VPH A;  1UFX A;  2WL7 A;  4Z33 A;  4H11 A;  3ZRT A;  1BE9 A;  1BFE A;  1XZ9 A;  5E1Y A;  2Q3G A;  2CS5 A;  1Q7X A;  2LC6 A;  1IU2 A;  3I18 A;  3AXA A;  5F67 A;  2KOM A;  4MPA A;  1VCW A;  2H2B A;  2JIL A;  3WKL A;  2PDZ A;  3ID3 A;  5HDY A;  1X8S A;  4E3B A;  2O2T A;  3HVQ C;  1GM1 A;  2IWO A;  2Q9V A;  4WYT A;  2EEH A;  2IWQ A;  2JOA A;  2KOJ A;  3GCO A;  4LMM A;  2G5M B;  1R6J A;  1V1T A;  2DC2 A;  2KQF A;  2IWN A;  2RCZ A;  2L4T A;  2FE5 A;  2K20 A;  3B76 A;  5HET A;  2I4S A;  3DJA A;  3KHF A;  4E34 A;  3NGH A;  3PDZ A;  1X5N A;  2JRE A;  3KZD A;  2AIN A;  4JOF A;  1WHD A;  4OEO A;  5E11 A;  3R68 A;  2KAW A;  1UHP A;  2I04 A;  2EDV A;  3NFK A;  2QG1 A;  3LNY A;  3EGG C;  5HF4 A;  3R69 A;  3TSV A;  3DJ3 A;  2YT7 A;  3CH8 A;  3GDV A;  1WIF A;  2OS6 A;  1VJ6 A;  3QJN A;  4Q2Q A;  3I4W A;  4Q6S A;  3RL8 A;  4Q2O A;  4KFW A;  3TMH A;  2FCF A;  1Z86 A;  3ID4 A;  2Z9I A;  4K72 A;  4XHV A;  4EDJ A;  4WYU A;  2VSP A;  5EYZ A;  3TSW A;  2OPG A;  2PNT A;  2VRF A;  2YT8 A;  2V90 A;  4NMR A;  1N6F A;  2M0Z A;  4JOJ A;  2PZD A;  1W9E A;  3ID2 A;  3GJ9 A;  3STJ A;  1UJV A;  2AWU A;  4REY A;  2I1N A;  1I92 A;  2LOB A;  2HE4 A;  2IWP A;  3QJM A;  2H3M A;  3BPU A;  4HOP A;  4Q2P A;  1UJU A;  1X5Q A;  2M10 A;  2OGP A;  4NXR A;  3SOE A;  2DKR A;  1FC9 A;  3DJ1 A;  2DLU A;  4RI0 A;  5FB8 C;  4GHN A;  2REY A;  1N7T A;  2VSV A;  2YUY A;  2PKU A;  3PV4 A;  1V62 A;  3JXT A;  3CBX A;  4P0C A;  2W7R A;  2OMJ A;  1B8Q A;  2I6V A;  3DOR A;  3ID1 A;  2H3L A;  1WH1 A;  2G2L A;  4NXP A;  5I7Z A;  2EHR A;  2R4H A;  1QLC A;  5GLJ A;  1L6O A;  4OAJ A;  1UEZ A;  1N6E A;  5A2P A;  2AWX A;  2EDP A;  2I0L A;  1UEQ A;  1QAU A;  1IU0 A;  1W9Q A;  4GVD A;  1UF1 A;  1V6B A;  1MFG A;  2OZF A; 
#chains in the Genus database with same CATH topology
 1RZX A;  2HGA A;  2R3Y A;  2LC7 A;  3QDO A;  1X6D A;  4NMO A;  3PV5 A;  2JIN A;  2JXO A;  3LNX A;  1U3B A;  1GQ5 A;  1TQ3 A;  1U37 A;  1UM1 A;  5HJ1 A;  3GDS A;  2VZ5 A;  3K1R A;  4NMS A;  4K78 A;  2QKT A;  1WI2 A;  2JSN A;  1TP5 A;  4K6Y A;  1KY9 A;  2EDZ A;  3VQG A;  5B6L A;  1VB7 A;  4Z8J A;  1I16 A;  4L8N A;  5DTH A;  2RRM A;  1WJL A;  1X9Z A;  1WFV A;  5HEB A;  2LA8 A;  4NMT A;  1G9O A;  4OEP A;  2QKV A;  3MH7 A;  3DIW A;  1PDR A;  2E7K A;  2KL1 A;  1T2M A;  3EGH C;  3K50 A;  4UU5 A;  1ZOK A;  4N6X A;  4IC6 A;  1FC7 A;  1X5R A;  1MC7 A;  2D90 A;  2DMZ A;  1KWA A;  4KFV A;  1Q3P A;  1M5Z A;  5HFC A;  3RL7 A;  1MFL A;  3SHW A;  4NNM A;  3L4F D;  4JL7 A;  5HEY A;  5G1E A;  2DB5 A;  2QBW A;  2H2C A;  5E22 A;  3I1E A;  3QO6 A;  3CBZ A;  2F5Y A;  2ZPL A;  2EEI A;  4PQW A;  2JWE A;  1U38 A;  4R2Z A;  1Y8T A;  2KYL A;  1WG6 A;  5HFD A;  2KV8 A;  4NMV A;  1UEP A;  4JOG A;  1N7F A;  1V5Q A;  4G69 A;  1UJD A;  5GND A;  2OQS A;  3O5N A;  3CYY A;  4K75 A;  4AMH A;  1TE0 A;  3SFJ A;  3NFL A;  4JOP A;  2EEJ A;  3KZE A;  2DAZ A;  1SOZ A;  2KJD A;  2UZC A;  2YUB A;  2DLS A;  2EAQ A;  3E17 A;  3PDV A;  4Q2N A;  5H3J A;  1P1E A;  5HFB A;  3PS4 A;  1FCF A;  2M3M A;  3CBY A;  3KDK A;  4YYX A;  4JOR A;  1ZUB A;  1WHA A;  2D8I A;  2EXG A;  5E21 A;  2I0I A;  2MX6 A;  1NTE A;  4FLN A;  4JJ3 A;  3FY5 A;  3O46 A;  1N6D A;  1IHJ A;  2EJY A;  2HE2 A;  4JJ0 A;  5D13 A;  4UU6 A;  4E35 A;  2PA1 A;  2GZV A;  2CSS A;  5F3X A;  3GAB A;  1VAE A;  3VQF A;  3WKM A;  1WFG A;  2KA9 A;  4JOH A;  3CC0 A;  2M0U A;  2KRG A;  1KEF A;  2JIK A;  1OZI A;  2KJK A;  1Y7N A;  1X45 A;  2K1Z A;  3SUZ A;  1RY4 A;  3OTP A;  3K82 A;  1UM7 A;  3MH4 A;  1UIT A;  4NMP A;  1RGR A;  2W4F A;  2CSJ A;  2AWW A;  1V5L A;  2OSG A;  1TP3 A;  2EGN A;  2KBS A;  2P3W A;  3QGL A;  2QT5 A;  2KOH A;  2BYG A;  1OBX A;  4GVC A;  1WF7 A;  4JOE A;  1RGW A;  2QKU A;  2MHO A;  1P1D A;  2F0A A;  2GEF A;  4NNL A;  2ENO A;  1N99 A;  1D5G A;  2EGK A;  3QE1 A;  1YBO A;  1Z87 A;  3CS0 A;  2M0V A;  1FC6 A;  1N7E A;  1UEW A;  2PKT A;  5FHT A;  1U39 A;  3OU0 A;  5G1D A;  2EEG A;  2L4S A;  5EZ0 A;  2EGO A;  1VA8 A;  3NCV A;  5HFE A;  1NF3 C;  3R0H A;  4NMQ A;  2DJT A;  1QAV B;  3HPM A;  5JXB A;  1Q3O A;  5HF1 A;  1LCY A;  1W9O A;  4F8K A;  4Q3H A;  1SOT A;  3KDG A;  1QAV A;  2KJP A;  4Q6H A;  4FGM A;  4JOK A;  2KPL A;  2KG2 A;  2VWR A;  2L97 A;  1WI4 A;  3PV2 A;  2LUI A;  2D92 A;  4HOP B;  2YTW A;  3GCN A;  2OCS A;  2V1W A;  1GQ4 A;  2DM8 A;  2FN5 A;  2M0T A;  5E6P B;  2X7Z A;  1K32 A;  5HFF A;  3GDU A;  3MH6 A;  4YDP A;  2FNE A;  5HED A;  1WF8 A;  3HPK A;  2ZPM A;  3TSZ A;  3GGE A;  1OBY A;  4O06 A;  4P2A B;  2Z17 A;  1OBZ A;  3GSL A;  3QIK A;  3RLE A;  2KPK A;  2EV8 A;  4K76 A;  4NXQ A;  3SHU A;  2VPH A;  1UFX A;  2WL7 A;  4Z33 A;  4H11 A;  3ZRT A;  1BE9 A;  1BFE A;  1XZ9 A;  5E1Y A;  2Q3G A;  2CS5 A;  1Q7X A;  2LC6 A;  1IU2 A;  3I18 A;  3AXA A;  5F67 A;  2KOM A;  4MPA A;  1VCW A;  2H2B A;  2JIL A;  3WKL A;  2PDZ A;  3ID3 A;  5HDY A;  1X8S A;  4E3B A;  2O2T A;  3HVQ C;  1GM1 A;  2IWO A;  2Q9V A;  4WYT A;  2EEH A;  2IWQ A;  2JOA A;  2KOJ A;  3GCO A;  4LMM A;  2G5M B;  1R6J A;  1V1T A;  2DC2 A;  2KQF A;  2IWN A;  2RCZ A;  2L4T A;  2FE5 A;  2K20 A;  3B76 A;  5HET A;  2I4S A;  3DJA A;  3KHF A;  4E34 A;  3NGH A;  3PDZ A;  1X5N A;  2JRE A;  3KZD A;  2AIN A;  4JOF A;  1WHD A;  4OEO A;  5E11 A;  3R68 A;  2KAW A;  1UHP A;  2I04 A;  2EDV A;  3NFK A;  2QG1 A;  3LNY A;  3EGG C;  5HF4 A;  3R69 A;  3TSV A;  3DJ3 A;  2YT7 A;  3CH8 A;  3GDV A;  1WIF A;  2OS6 A;  1VJ6 A;  3QJN A;  4Q2Q A;  3I4W A;  4Q6S A;  3RL8 A;  4Q2O A;  4KFW A;  3TMH A;  2FCF A;  1Z86 A;  3ID4 A;  2Z9I A;  4K72 A;  4XHV A;  5IL9 A;  4EDJ A;  4WYU A;  2VSP A;  5EYZ A;  3TSW A;  2OPG A;  2PNT A;  2VRF A;  2YT8 A;  2V90 A;  4NMR A;  1N6F A;  2M0Z A;  4JOJ A;  2PZD A;  1W9E A;  3ID2 A;  3GJ9 A;  3STJ A;  1UJV A;  2AWU A;  4REY A;  2I1N A;  1I92 A;  2LOB A;  2HE4 A;  2IWP A;  3QJM A;  2H3M A;  3BPU A;  4HOP A;  4Q2P A;  1UJU A;  1X5Q A;  2M10 A;  2OGP A;  4NXR A;  3SOE A;  2DKR A;  1FC9 A;  3DJ1 A;  2DLU A;  4RI0 A;  5FB8 C;  5B42 A;  4GHN A;  2REY A;  1N7T A;  2VSV A;  2YUY A;  2PKU A;  3PV4 A;  1V62 A;  3JXT A;  3CBX A;  4P0C A;  2W7R A;  2OMJ A;  1B8Q A;  2I6V A;  3DOR A;  3ID1 A;  2H3L A;  1WH1 A;  2G2L A;  4NXP A;  5I7Z A;  2EHR A;  2R4H A;  1QLC A;  5GLJ A;  1L6O A;  4OAJ A;  1UEZ A;  1N6E A;  5A2P A;  2AWX A;  2EDP A;  2I0L A;  1UEQ A;  1QAU A;  5ILB A;  1IU0 A;  1W9Q A;  4GVD A;  1UF1 A;  1V6B A;  1MFG A;  2OZF A; 
#chains in the Genus database with same CATH homology
 1RZX A;  2HGA A;  2R3Y A;  2LC7 A;  3QDO A;  1X6D A;  4NMO A;  3PV5 A;  2JIN A;  2JXO A;  3LNX A;  1U3B A;  1GQ5 A;  1TQ3 A;  1U37 A;  1UM1 A;  5HJ1 A;  3GDS A;  2VZ5 A;  3K1R A;  4NMS A;  4K78 A;  2QKT A;  1WI2 A;  2JSN A;  1TP5 A;  4K6Y A;  1KY9 A;  2EDZ A;  3VQG A;  5B6L A;  1VB7 A;  4Z8J A;  1I16 A;  4L8N A;  5DTH A;  2RRM A;  1WJL A;  1X9Z A;  1WFV A;  5HEB A;  2LA8 A;  4NMT A;  1G9O A;  4OEP A;  2QKV A;  3MH7 A;  3DIW A;  1PDR A;  2E7K A;  2KL1 A;  1T2M A;  3EGH C;  3K50 A;  4UU5 A;  1ZOK A;  4N6X A;  4IC6 A;  1FC7 A;  1X5R A;  1MC7 A;  2D90 A;  2DMZ A;  1KWA A;  4KFV A;  1Q3P A;  1M5Z A;  5HFC A;  3RL7 A;  1MFL A;  3SHW A;  4NNM A;  3L4F D;  4JL7 A;  5HEY A;  5G1E A;  2DB5 A;  2QBW A;  2H2C A;  5E22 A;  3I1E A;  3QO6 A;  3CBZ A;  2F5Y A;  2ZPL A;  2EEI A;  4PQW A;  2JWE A;  1U38 A;  4R2Z A;  1Y8T A;  2KYL A;  1WG6 A;  5HFD A;  2KV8 A;  4NMV A;  1UEP A;  4JOG A;  1N7F A;  1V5Q A;  4G69 A;  1UJD A;  5GND A;  2OQS A;  3O5N A;  3CYY A;  4K75 A;  4AMH A;  1TE0 A;  3SFJ A;  3NFL A;  4JOP A;  2EEJ A;  3KZE A;  2DAZ A;  1SOZ A;  2KJD A;  2UZC A;  2YUB A;  2DLS A;  2EAQ A;  3E17 A;  3PDV A;  4Q2N A;  5H3J A;  1P1E A;  5HFB A;  3PS4 A;  1FCF A;  2M3M A;  3CBY A;  3KDK A;  4YYX A;  4JOR A;  1ZUB A;  1WHA A;  2D8I A;  2EXG A;  5E21 A;  2I0I A;  2MX6 A;  1NTE A;  4FLN A;  4JJ3 A;  3FY5 A;  3O46 A;  1N6D A;  1IHJ A;  2EJY A;  2HE2 A;  4JJ0 A;  5D13 A;  4UU6 A;  4E35 A;  2PA1 A;  2GZV A;  2CSS A;  5F3X A;  3GAB A;  1VAE A;  3VQF A;  3WKM A;  1WFG A;  2KA9 A;  4JOH A;  3CC0 A;  2M0U A;  2KRG A;  1KEF A;  2JIK A;  1OZI A;  2KJK A;  1Y7N A;  1X45 A;  2K1Z A;  3SUZ A;  1RY4 A;  3OTP A;  3K82 A;  1UM7 A;  3MH4 A;  1UIT A;  4NMP A;  1RGR A;  2W4F A;  2CSJ A;  2AWW A;  1V5L A;  2OSG A;  1TP3 A;  2EGN A;  2KBS A;  2P3W A;  3QGL A;  2QT5 A;  2KOH A;  2BYG A;  1OBX A;  4GVC A;  1WF7 A;  4JOE A;  1RGW A;  2QKU A;  2MHO A;  1P1D A;  2F0A A;  2GEF A;  4NNL A;  2ENO A;  1N99 A;  1D5G A;  2EGK A;  3QE1 A;  1YBO A;  1Z87 A;  3CS0 A;  2M0V A;  1FC6 A;  1N7E A;  1UEW A;  2PKT A;  5FHT A;  1U39 A;  3OU0 A;  5G1D A;  2EEG A;  2L4S A;  5EZ0 A;  2EGO A;  1VA8 A;  3NCV A;  5HFE A;  1NF3 C;  3R0H A;  4NMQ A;  2DJT A;  1QAV B;  3HPM A;  5JXB A;  1Q3O A;  5HF1 A;  1LCY A;  1W9O A;  4F8K A;  4Q3H A;  1SOT A;  3KDG A;  1QAV A;  2KJP A;  4Q6H A;  4FGM A;  4JOK A;  2KPL A;  2KG2 A;  2VWR A;  2L97 A;  1WI4 A;  3PV2 A;  2LUI A;  2D92 A;  4HOP B;  2YTW A;  3GCN A;  2OCS A;  2V1W A;  1GQ4 A;  2DM8 A;  2FN5 A;  2M0T A;  5E6P B;  2X7Z A;  1K32 A;  5HFF A;  3GDU A;  3MH6 A;  4YDP A;  2FNE A;  5HED A;  1WF8 A;  3HPK A;  2ZPM A;  3TSZ A;  3GGE A;  1OBY A;  4O06 A;  4P2A B;  2Z17 A;  1OBZ A;  3GSL A;  3QIK A;  3RLE A;  2KPK A;  2EV8 A;  4K76 A;  4NXQ A;  3SHU A;  2VPH A;  1UFX A;  2WL7 A;  4Z33 A;  4H11 A;  3ZRT A;  1BE9 A;  1BFE A;  1XZ9 A;  5E1Y A;  2Q3G A;  2CS5 A;  1Q7X A;  2LC6 A;  1IU2 A;  3I18 A;  3AXA A;  5F67 A;  2KOM A;  4MPA A;  1VCW A;  2H2B A;  2JIL A;  3WKL A;  2PDZ A;  3ID3 A;  5HDY A;  1X8S A;  4E3B A;  2O2T A;  3HVQ C;  1GM1 A;  2IWO A;  2Q9V A;  4WYT A;  2EEH A;  2IWQ A;  2JOA A;  2KOJ A;  3GCO A;  4LMM A;  2G5M B;  1R6J A;  1V1T A;  2DC2 A;  2KQF A;  2IWN A;  2RCZ A;  2L4T A;  2FE5 A;  2K20 A;  3B76 A;  5HET A;  2I4S A;  3DJA A;  3KHF A;  4E34 A;  3NGH A;  3PDZ A;  1X5N A;  2JRE A;  3KZD A;  2AIN A;  4JOF A;  1WHD A;  4OEO A;  5E11 A;  3R68 A;  2KAW A;  1UHP A;  2I04 A;  2EDV A;  3NFK A;  2QG1 A;  3LNY A;  3EGG C;  5HF4 A;  3R69 A;  3TSV A;  3DJ3 A;  2YT7 A;  3CH8 A;  3GDV A;  1WIF A;  2OS6 A;  1VJ6 A;  3QJN A;  4Q2Q A;  3I4W A;  4Q6S A;  3RL8 A;  4Q2O A;  4KFW A;  3TMH A;  2FCF A;  1Z86 A;  3ID4 A;  2Z9I A;  4K72 A;  4XHV A;  5IL9 A;  4EDJ A;  4WYU A;  2VSP A;  5EYZ A;  3TSW A;  2OPG A;  2PNT A;  2VRF A;  2YT8 A;  2V90 A;  4NMR A;  1N6F A;  2M0Z A;  4JOJ A;  2PZD A;  1W9E A;  3ID2 A;  3GJ9 A;  3STJ A;  1UJV A;  2AWU A;  4REY A;  2I1N A;  1I92 A;  2LOB A;  2HE4 A;  2IWP A;  3QJM A;  2H3M A;  3BPU A;  4HOP A;  4Q2P A;  1UJU A;  1X5Q A;  2M10 A;  2OGP A;  4NXR A;  3SOE A;  2DKR A;  1FC9 A;  3DJ1 A;  2DLU A;  4RI0 A;  5FB8 C;  5B42 A;  4GHN A;  2REY A;  1N7T A;  2VSV A;  2YUY A;  2PKU A;  3PV4 A;  1V62 A;  3JXT A;  3CBX A;  4P0C A;  2W7R A;  2OMJ A;  1B8Q A;  2I6V A;  3DOR A;  3ID1 A;  2H3L A;  1WH1 A;  2G2L A;  4NXP A;  5I7Z A;  2EHR A;  2R4H A;  1QLC A;  5GLJ A;  1L6O A;  4OAJ A;  1UEZ A;  1N6E A;  5A2P A;  2AWX A;  2EDP A;  2I0L A;  1UEQ A;  1QAU A;  5ILB A;  1IU0 A;  1W9Q A;  4GVD A;  1UF1 A;  1V6B A;  1MFG A;  2OZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...