2L4SA

Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of gip with glutaminase l
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
b'MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 3
publication title Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2l4sA01
2EGOA 4YDPA 2OQSA 1RGRA 2VRFA 3CYYA 1WIFA 1UITA 2DB5A 4NXRA 1X5QA 4L8NA 4NNLA 5HEYA 3MH7A 2RRMA 1WF7A 3CH8A 4JOHA 1VCWA 1RY4A 2KRGA 2VSVA 2EHRA 1N7FA 2G5MB 1V6BA 3R68A 1NTEA 5F3XA 3QDOA 4GVCA 3O5NA 2KG2A 2EEIA 2JIKA 4K76A 4O06A 3RL8A 1I92A 1P1EA 1QAVB 4NXPA 1U37A 3OU0A 5HJ1A 1KY9A 4E34A 2EXGA 1UEQA 2JREA 3QJNA 5HEBA 3QIKA 3B76A 2ENOA 3TMHA 2WL7A 2I0IA 3ID3A 4AMHA 1VJ6A 3TSWA 5D13A 1PDRA 3WKLA 3RLEA 2OSGA 1OBYA 2GZVA 1B8QA 5E22A 5E21A 1Q3PA 1UM7A 1N6FA 1Q3OA 2KQFA 3R0HA 3HPKA 2EAQA 4Q3HA 3DJ3A 2R3YA 1XZ9A 3VQGA 2M0VA 1OBXA 5FB8C 2D8IA 3GCOA 2M10A 2LUIA 3K82A 2EJYA 4JOKA 1N7TA 4NMSA 4NMTA 1V62A 2L97A 2OGPA 2YT8A 2AWXA 2Q3GA 4R2ZA 2KV8A 1VA8A 1OZIA 2YT7A 2EDPA 2FE5A 3DORA 4PQWA 2Z9IA 1FC6A 2IWPA 3SUZA 3JXTA 2YUBA 4EDJA 2DAZA 3GJ9A 1X6DA 4P2AB 1Z86A 3GDVA 2F0AA 2L4TA 1BFEA 3LNXA 3QE1A 2OZFA 4G69A 2DJTA 1GQ4A 3DIWA 1WG6A 2OMJA 4GHNA 4IC6A 4MPAA 1V5QA 3MH6A 1Y7NA 3I4WA 2JXOA 3PV5A 5HF1A 2EGKA 1WI4A 1GM1A 2DC2A 4WYUA 2CSSA 2VWRA 5HETA 1L6OA 1N6DA 1X5NA 3ID1A 1KEFA 4NNMA 4K75A 2YTWA 2H2BA 1UJUA 1IU0A 1WFVA 3QO6A 4JOPA 4HOPB 1VB7A 2M3MA 2V90A 1FC7A 2R4HA 2P3WA 1TQ3A 3KZEA 2DLSA 1SOTA 2D92A 3QJMA 5A2PA 3RL7A 2X7ZA 2LC6A 4OEOA 2PA1A 2LC7A 3CBYA 3CBXA 4K72A 2KA9A 2OS6A 2M0TA 1MFLA 3DJ1A 1WHDA 2IWOA 2G2LA 3DJAA 4NMPA 2Q9VA 3PDZA 5HFBA 4Z33A 2QG1A 1TE0A 1U38A 4JOGA 2PNTA 1RZXA 4Q2PA 4Q2NA 2VPHA 3VQFA 2EV8A 5HDYA 5HFEA 2M0UA 3CC0A 4REYA 4NMVA 1V1TA 5G1EA 1QAUA 1ZOKA 1WH1A 1KWAA 2L4SA 1TP3A 2DMZA 4JOJA 1OBZA 1UF1A 3PS4A 2KOJA 2QKVA 2AINA 3KHFA 2EEJA 2K1ZA 1M5ZA 2F5YA 3GSLA 1ZUBA 1VAEA 2MHOA 1X45A 1NF3C 1N6EA 1U3BA 3STJA 2O2TA 2Z17A 4WYTA 3SFJA 5E11A 3I1EA 1UEPA 1K32A 1WF8A 2AWWA 1SOZA 2DM8A 1X8SA 1X5RA 3CBZA 4JOEA 3GDUA 2I1NA 2KJPA 3E17A 3BPUA 1W9OA 1WHAA 2EDZA 1Q7XA 1FC9A 1UFXA 2EGNA 5E1YA 2QT5A 4Z8JA 1IU2A 2QKTA 2ZPMA 1W9QA 1MFGA 3L4FD 4UU5A 4Q2OA 5HFCA 4HOPA 5EYZA 2BYGA 2LOBA 3PV4A 4OEPA 3K50A 2M0ZA 2JINA 5H3JA 1UJDA 2QBWA 2JWEA 3HPMA 4E35A 4XHVA 2HE2A 4NXQA 3ID4A 4JOFA 2RCZA 1BE9A 2FCFA 5HEDA 3GGEA 1GQ5A 2OCSA 1W9EA 2ZPLA 2H3LA 3PDVA 5FHTA 3SHWA 5E6PB 5JXBA 4Q2QA 1QAVA 2H2CA 1UJVA 2EDVA 2OPGA 1UEZA 4LMMA 3ZRTA 2PKUA 5I7ZA 2KL1A 4NMQA 1U39A 3MH4A 4FGMA 2I6VA 2PDZA 2VSPA 2I4SA 1N7EA 2K20A 5EZ0A 4OAJA 2JILA 1TP5A 1QLCA 5HFFA 4Q6HA 1G9OA 1I16A 3HVQC 1R6JA 1LCYA 5DTHA 4F8KA 2HGAA 2KAWA 2JOAA 2KPKA 4K78A 2D90A 4Q6SA 2I0LA 2PKTA 2REYA 4NMRA 1T2MA 4UU6A 4E3BA 2W7RA 3CS0A 2KJDA 1MC7A 3GDSA 5HFDA 3ID2A 1WI2A 3SHUA 1Y8TA 1RGWA 2KPLA 3NFLA 1UM1A 2LA8A 5G1DA 2VZ5A 2EEGA 4NMOA 1P1DA 5F67A 3TSZA 3I18A 5HF4A 2IWQA 2V1WA 3AXAA 3K1RA 3NGHA 1FCFA 5GLJA 2KOHA 4KFVA 4KFWA 4RI0A 2KOMA 2KJKA 1D5GA 1YBOA 3OTPA 1Z87A 3NFKA 3EGGC 2I04A 3EGHC 2CSJA 1UEWA 2KBSA 1WFGA 3LNYA 2CS5A 3SOEA 3R69A 4N6XA 3TSVA 2FNEA 2YUYA 2QKUA 1WJLA 4JL7A 1UHPA 2FN5A 4P0CA 2AWUA 2HE4A 2PZDA 5B6LA 2W4FA 2H3MA 5GNDA 2E7KA 2UZCA 2EEHA 2IWNA 2MX6A 1N99A 1V5LA 3O46A 2DKRA 2KYLA 3GCNA 4GVDA 2DLUA 4YYXA 1IHJA 4H11A 4JORA 4K6YA 3PV2A 3WKMA 3KZDA 3QGLA 3FY5A
chains in the Genus database with same CATH superfamily
2EGOA 4YDPA 2OQSA 1RGRA 2VRFA 3CYYA 1WIFA 1UITA 2DB5A 4NXRA 1X5QA 4L8NA 4NNLA 5HEYA 3MH7A 2RRMA 1WF7A 3CH8A 4JOHA 1VCWA 1RY4A 2KRGA 2VSVA 2EHRA 1N7FA 2G5MB 1V6BA 3R68A 1NTEA 5F3XA 3QDOA 4GVCA 3O5NA 2KG2A 2EEIA 2JIKA 4K76A 4O06A 3RL8A 1I92A 1P1EA 1QAVB 4NXPA 1U37A 3OU0A 5HJ1A 1KY9A 4E34A 2EXGA 1UEQA 2JREA 3QJNA 5HEBA 3QIKA 3B76A 2ENOA 3TMHA 2WL7A 2I0IA 3ID3A 4AMHA 1VJ6A 3TSWA 5D13A 1PDRA 3WKLA 3RLEA 2OSGA 1OBYA 2GZVA 1B8QA 5E22A 5E21A 1Q3PA 1UM7A 1N6FA 1Q3OA 2KQFA 3R0HA 3HPKA 2EAQA 4Q3HA 3DJ3A 2R3YA 1XZ9A 3VQGA 2M0VA 1OBXA 5FB8C 2D8IA 3GCOA 2M10A 2LUIA 3K82A 2EJYA 4JOKA 1N7TA 4NMSA 4NMTA 1V62A 2L97A 2OGPA 2YT8A 2AWXA 2Q3GA 4R2ZA 2KV8A 1VA8A 1OZIA 2YT7A 2EDPA 2FE5A 3DORA 4PQWA 2Z9IA 1FC6A 2IWPA 3SUZA 3JXTA 2YUBA 4EDJA 2DAZA 3GJ9A 1X6DA 4P2AB 1Z86A 3GDVA 2F0AA 2L4TA 1BFEA 3LNXA 3QE1A 2OZFA 4G69A 2DJTA 1GQ4A 3DIWA 1WG6A 2OMJA 4GHNA 4IC6A 4MPAA 1V5QA 3MH6A 2JSNA 1Y7NA 3I4WA 2JXOA 3PV5A 5HF1A 2EGKA 1WI4A 1GM1A 2DC2A 4WYUA 2CSSA 2VWRA 5HETA 1L6OA 1N6DA 1X5NA 3ID1A 1KEFA 4NNMA 4K75A 2YTWA 2H2BA 1UJUA 1IU0A 1WFVA 3QO6A 4JOPA 4HOPB 1VB7A 2M3MA 2V90A 1FC7A 2R4HA 2P3WA 1TQ3A 3KZEA 2DLSA 1SOTA 2D92A 3QJMA 5A2PA 3RL7A 2X7ZA 2LC6A 4OEOA 2PA1A 2LC7A 3CBYA 3CBXA 4K72A 2KA9A 2OS6A 2M0TA 1MFLA 3DJ1A 1WHDA 2IWOA 2G2LA 3DJAA 4NMPA 2Q9VA 3PDZA 5HFBA 4Z33A 2QG1A 1TE0A 1U38A 4JOGA 2PNTA 1RZXA 4Q2PA 4Q2NA 2VPHA 3VQFA 2EV8A 5HDYA 5IL9A 5HFEA 2M0UA 3CC0A 4REYA 4NMVA 1V1TA 5G1EA 1QAUA 1ZOKA 1WH1A 1KWAA 2L4SA 1TP3A 2DMZA 4JOJA 1OBZA 1UF1A 3PS4A 2KOJA 2QKVA 2AINA 3KHFA 2EEJA 2K1ZA 1M5ZA 4JJ0A 2F5YA 3GSLA 1ZUBA 1VAEA 2MHOA 1X45A 1NF3C 1N6EA 3GABA 1U3BA 3STJA 2O2TA 2Z17A 4WYTA 3SFJA 5E11A 3I1EA 1UEPA 1X9ZA 1K32A 1WF8A 2AWWA 1SOZA 2DM8A 1X8SA 1X5RA 3CBZA 4JOEA 3GDUA 2I1NA 2KJPA 3E17A 3BPUA 1W9OA 1WHAA 2EDZA 1Q7XA 1FC9A 1UFXA 2EGNA 5E1YA 2QT5A 4Z8JA 1IU2A 2QKTA 2ZPMA 1W9QA 1MFGA 3L4FD 4UU5A 4Q2OA 5HFCA 4HOPA 5EYZA 2BYGA 2LOBA 3PV4A 4OEPA 3K50A 2M0ZA 2JINA 5H3JA 1UJDA 2QBWA 2JWEA 3HPMA 4E35A 4XHVA 2HE2A 4NXQA 3ID4A 4JOFA 2RCZA 1BE9A 2FCFA 5HEDA 4JJ3A 3GGEA 1GQ5A 2OCSA 1W9EA 2ZPLA 2H3LA 3PDVA 5FHTA 3SHWA 5E6PB 5B42A 5JXBA 4Q2QA 3KDGA 1QAVA 2H2CA 1UJVA 2EDVA 2OPGA 1UEZA 4LMMA 3ZRTA 2PKUA 5I7ZA 2KL1A 4NMQA 1U39A 3MH4A 4FGMA 2I6VA 2PDZA 2VSPA 2I4SA 1N7EA 2K20A 5EZ0A 4OAJA 2JILA 1TP5A 1QLCA 3NCVA 5HFFA 4Q6HA 1G9OA 1I16A 3HVQC 1R6JA 1LCYA 5DTHA 4F8KA 2GEFA 2HGAA 2KAWA 2JOAA 2KPKA 4K78A 2D90A 4Q6SA 2I0LA 2PKTA 2REYA 4NMRA 1T2MA 4UU6A 4E3BA 2W7RA 3CS0A 2KJDA 1MC7A 3GDSA 5HFDA 3ID2A 1WI2A 3SHUA 1Y8TA 1RGWA 2KPLA 3NFLA 1UM1A 2LA8A 5G1DA 2VZ5A 2EEGA 4NMOA 3KDKA 4FLNA 1P1DA 5F67A 3TSZA 3I18A 5HF4A 2IWQA 2V1WA 3AXAA 3K1RA 3NGHA 1FCFA 5GLJA 2KOHA 4KFVA 4KFWA 4RI0A 2KOMA 2KJKA 1D5GA 1YBOA 3OTPA 1Z87A 3NFKA 3EGGC 2I04A 3EGHC 2CSJA 1UEWA 2KBSA 1WFGA 3LNYA 5ILBA 2CS5A 3SOEA 3R69A 4N6XA 3TSVA 2FNEA 2YUYA 2QKUA 1WJLA 4JL7A 1UHPA 2FN5A 4P0CA 2AWUA 2HE4A 2PZDA 5B6LA 2W4FA 2H3MA 5GNDA 2E7KA 2UZCA 2EEHA 2IWNA 2MX6A 1N99A 1V5LA 3O46A 2DKRA 2KYLA 3GCNA 4GVDA 2DLUA 4YYXA 1IHJA 4H11A 4JORA 4K6YA 3PV2A 3WKMA 3KZDA 3QGLA 3FY5A
chains in the Genus database with same CATH topology
2EGOA 4YDPA 2OQSA 1RGRA 2VRFA 3CYYA 1WIFA 1UITA 2DB5A 4NXRA 1X5QA 4L8NA 4NNLA 5HEYA 3MH7A 2RRMA 1WF7A 3CH8A 4JOHA 1VCWA 1RY4A 2KRGA 2VSVA 2EHRA 1N7FA 2G5MB 1V6BA 3R68A 1NTEA 5F3XA 3QDOA 4GVCA 3O5NA 2KG2A 2EEIA 2JIKA 4K76A 4O06A 3RL8A 1I92A 1P1EA 1QAVB 4NXPA 1U37A 3OU0A 5HJ1A 1KY9A 4E34A 2EXGA 1UEQA 2JREA 3QJNA 5HEBA 3QIKA 3B76A 2ENOA 3TMHA 2WL7A 2I0IA 3ID3A 4AMHA 1VJ6A 3TSWA 5D13A 1PDRA 3WKLA 3RLEA 2OSGA 1OBYA 2GZVA 1B8QA 5E22A 5E21A 1Q3PA 1UM7A 1N6FA 1Q3OA 2KQFA 3R0HA 3HPKA 2EAQA 4Q3HA 3DJ3A 2R3YA 1XZ9A 3VQGA 2M0VA 1OBXA 5FB8C 2D8IA 3GCOA 2M10A 2LUIA 3K82A 2EJYA 4JOKA 1N7TA 4NMSA 4NMTA 1V62A 2L97A 2OGPA 2YT8A 2AWXA 2Q3GA 4R2ZA 2KV8A 1VA8A 1OZIA 2YT7A 2EDPA 2FE5A 3DORA 4PQWA 2Z9IA 1FC6A 2IWPA 3SUZA 3JXTA 2YUBA 4EDJA 2DAZA 3GJ9A 1X6DA 4P2AB 1Z86A 3GDVA 2F0AA 2L4TA 1BFEA 3LNXA 3QE1A 2OZFA 4G69A 2DJTA 1GQ4A 3DIWA 1WG6A 2OMJA 4GHNA 4IC6A 4MPAA 1V5QA 3MH6A 2JSNA 1Y7NA 3I4WA 2JXOA 3PV5A 5HF1A 2EGKA 1WI4A 1GM1A 2DC2A 4WYUA 2CSSA 2VWRA 5HETA 1L6OA 1N6DA 1X5NA 3ID1A 1KEFA 4NNMA 4K75A 2YTWA 2H2BA 1UJUA 1IU0A 1WFVA 3QO6A 4JOPA 4HOPB 1VB7A 2M3MA 2V90A 1FC7A 2R4HA 2P3WA 1TQ3A 3KZEA 2DLSA 1SOTA 2D92A 3QJMA 5A2PA 3RL7A 2X7ZA 2LC6A 4OEOA 2PA1A 2LC7A 3CBYA 3CBXA 4K72A 2KA9A 2OS6A 2M0TA 1MFLA 3DJ1A 1WHDA 2IWOA 2G2LA 3DJAA 4NMPA 2Q9VA 3PDZA 5HFBA 4Z33A 2QG1A 1TE0A 1U38A 4JOGA 2PNTA 1RZXA 4Q2PA 4Q2NA 2VPHA 3VQFA 2EV8A 5HDYA 5IL9A 5HFEA 2M0UA 3CC0A 4REYA 4NMVA 1V1TA 5G1EA 1QAUA 1ZOKA 1WH1A 1KWAA 2L4SA 1TP3A 2DMZA 4JOJA 1OBZA 1UF1A 3PS4A 2KOJA 2QKVA 2AINA 3KHFA 2EEJA 2K1ZA 1M5ZA 4JJ0A 2F5YA 3GSLA 1ZUBA 1VAEA 2MHOA 1X45A 1NF3C 1N6EA 3GABA 1U3BA 3STJA 2O2TA 2Z17A 4WYTA 3SFJA 5E11A 3I1EA 1UEPA 1X9ZA 1K32A 1WF8A 2AWWA 1SOZA 2DM8A 1X8SA 1X5RA 3CBZA 4JOEA 3GDUA 2I1NA 2KJPA 3E17A 3BPUA 1W9OA 1WHAA 2EDZA 1Q7XA 1FC9A 1UFXA 2EGNA 5E1YA 2QT5A 4Z8JA 1IU2A 2QKTA 2ZPMA 1W9QA 1MFGA 3L4FD 4UU5A 4Q2OA 5HFCA 4HOPA 5EYZA 2BYGA 2LOBA 3PV4A 4OEPA 3K50A 2M0ZA 2JINA 5H3JA 1UJDA 2QBWA 2JWEA 3HPMA 4E35A 4XHVA 2HE2A 4NXQA 3ID4A 4JOFA 2RCZA 1BE9A 2FCFA 5HEDA 4JJ3A 3GGEA 1GQ5A 2OCSA 1W9EA 2ZPLA 2H3LA 3PDVA 5FHTA 3SHWA 5E6PB 5B42A 5JXBA 4Q2QA 3KDGA 1QAVA 2H2CA 1UJVA 2EDVA 2OPGA 1UEZA 4LMMA 3ZRTA 2PKUA 5I7ZA 2KL1A 4NMQA 1U39A 3MH4A 4FGMA 2I6VA 2PDZA 2VSPA 2I4SA 1N7EA 2K20A 5EZ0A 4OAJA 2JILA 1TP5A 1QLCA 3NCVA 5HFFA 4Q6HA 1G9OA 1I16A 3HVQC 1R6JA 1LCYA 5DTHA 4F8KA 2GEFA 2HGAA 2KAWA 2JOAA 2KPKA 4K78A 2D90A 4Q6SA 2I0LA 2PKTA 2REYA 4NMRA 1T2MA 4UU6A 4E3BA 2W7RA 3CS0A 2KJDA 1MC7A 3GDSA 5HFDA 3ID2A 1WI2A 3SHUA 1Y8TA 1RGWA 2KPLA 3NFLA 1UM1A 2LA8A 5G1DA 2VZ5A 2EEGA 4NMOA 3KDKA 4FLNA 1P1DA 5F67A 3TSZA 3I18A 5HF4A 2IWQA 2V1WA 3AXAA 3K1RA 3NGHA 1FCFA 5GLJA 2KOHA 4KFVA 4KFWA 4RI0A 2KOMA 2KJKA 1D5GA 1YBOA 3OTPA 1Z87A 3NFKA 3EGGC 2I04A 3EGHC 2CSJA 1UEWA 2KBSA 1WFGA 3LNYA 5ILBA 2CS5A 3SOEA 3R69A 4N6XA 3TSVA 2FNEA 2YUYA 2QKUA 1WJLA 4JL7A 1UHPA 2FN5A 4P0CA 2AWUA 2HE4A 2PZDA 5B6LA 2W4FA 2H3MA 5GNDA 2E7KA 2UZCA 2EEHA 2IWNA 2MX6A 1N99A 1V5LA 3O46A 2DKRA 2KYLA 3GCNA 4GVDA 2DLUA 4YYXA 1IHJA 4H11A 4JORA 4K6YA 3PV2A 3WKMA 3KZDA 3QGLA 3FY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGO A;  4YDP A;  2OQS A;  1RGR A;  2VRF A;  3CYY A;  1WIF A;  1UIT A;  2DB5 A;  4NXR A;  1X5Q A;  4L8N A;  4NNL A;  5HEY A;  3MH7 A;  2RRM A;  1WF7 A;  3CH8 A;  4JOH A;  1VCW A;  1RY4 A;  2KRG A;  2VSV A;  2EHR A;  1N7F A;  2G5M B;  1V6B A;  3R68 A;  1NTE A;  5F3X A;  3QDO A;  4GVC A;  3O5N A;  2KG2 A;  2EEI A;  2JIK A;  4K76 A;  4O06 A;  3RL8 A;  1I92 A;  1P1E A;  1QAV B;  4NXP A;  1U37 A;  3OU0 A;  5HJ1 A;  1KY9 A;  4E34 A;  2EXG A;  1UEQ A;  2JRE A;  3QJN A;  5HEB A;  3QIK A;  3B76 A;  2ENO A;  3TMH A;  2WL7 A;  2I0I A;  3ID3 A;  4AMH A;  1VJ6 A;  3TSW A;  5D13 A;  1PDR A;  3WKL A;  3RLE A;  2OSG A;  1OBY A;  2GZV A;  1B8Q A;  5E22 A;  5E21 A;  1Q3P A;  1UM7 A;  1N6F A;  1Q3O A;  2KQF A;  3R0H A;  3HPK A;  2EAQ A;  4Q3H A;  3DJ3 A;  2R3Y A;  1XZ9 A;  3VQG A;  2M0V A;  1OBX A;  5FB8 C;  2D8I A;  3GCO A;  2M10 A;  2LUI A;  3K82 A;  2EJY A;  4JOK A;  1N7T A;  4NMS A;  4NMT A;  1V62 A;  2L97 A;  2OGP A;  2YT8 A;  2AWX A;  2Q3G A;  4R2Z A;  2KV8 A;  1VA8 A;  1OZI A;  2YT7 A;  2EDP A;  2FE5 A;  3DOR A;  4PQW A;  2Z9I A;  1FC6 A;  2IWP A;  3SUZ A;  3JXT A;  2YUB A;  4EDJ A;  2DAZ A;  3GJ9 A;  1X6D A;  4P2A B;  1Z86 A;  3GDV A;  2F0A A;  2L4T A;  1BFE A;  3LNX A;  3QE1 A;  2OZF A;  4G69 A;  2DJT A;  1GQ4 A;  3DIW A;  1WG6 A;  2OMJ A;  4GHN A;  4IC6 A;  4MPA A;  1V5Q A;  3MH6 A;  1Y7N A;  3I4W A;  2JXO A;  3PV5 A;  5HF1 A;  2EGK A;  1WI4 A;  1GM1 A;  2DC2 A;  4WYU A;  2CSS A;  2VWR A;  5HET A;  1L6O A;  1N6D A;  1X5N A;  3ID1 A;  1KEF A;  4NNM A;  4K75 A;  2YTW A;  2H2B A;  1UJU A;  1IU0 A;  1WFV A;  3QO6 A;  4JOP A;  4HOP B;  1VB7 A;  2M3M A;  2V90 A;  1FC7 A;  2R4H A;  2P3W A;  1TQ3 A;  3KZE A;  2DLS A;  1SOT A;  2D92 A;  3QJM A;  5A2P A;  3RL7 A;  2X7Z A;  2LC6 A;  4OEO A;  2PA1 A;  2LC7 A;  3CBY A;  3CBX A;  4K72 A;  2KA9 A;  2OS6 A;  2M0T A;  1MFL A;  3DJ1 A;  1WHD A;  2IWO A;  2G2L A;  3DJA A;  4NMP A;  2Q9V A;  3PDZ A;  5HFB A;  4Z33 A;  2QG1 A;  1TE0 A;  1U38 A;  4JOG A;  2PNT A;  1RZX A;  4Q2P A;  4Q2N A;  2VPH A;  3VQF A;  2EV8 A;  5HDY A;  5HFE A;  2M0U A;  3CC0 A;  4REY A;  4NMV A;  1V1T A;  5G1E A;  1QAU A;  1ZOK A;  1WH1 A;  1KWA A;  2L4S A;  1TP3 A;  2DMZ A;  4JOJ A;  1OBZ A;  1UF1 A;  3PS4 A;  2KOJ A;  2QKV A;  2AIN A;  3KHF A;  2EEJ A;  2K1Z A;  1M5Z A;  2F5Y A;  3GSL A;  1ZUB A;  1VAE A;  2MHO A;  1X45 A;  1NF3 C;  1N6E A;  1U3B A;  3STJ A;  2O2T A;  2Z17 A;  4WYT A;  3SFJ A;  5E11 A;  3I1E A;  1UEP A;  1K32 A;  1WF8 A;  2AWW A;  1SOZ A;  2DM8 A;  1X8S A;  1X5R A;  3CBZ A;  4JOE A;  3GDU A;  2I1N A;  2KJP A;  3E17 A;  3BPU A;  1W9O A;  1WHA A;  2EDZ A;  1Q7X A;  1FC9 A;  1UFX A;  2EGN A;  5E1Y A;  2QT5 A;  4Z8J A;  1IU2 A;  2QKT A;  2ZPM A;  1W9Q A;  1MFG A;  3L4F D;  4UU5 A;  4Q2O A;  5HFC A;  4HOP A;  5EYZ A;  2BYG A;  2LOB A;  3PV4 A;  4OEP A;  3K50 A;  2M0Z A;  2JIN A;  5H3J A;  1UJD A;  2QBW A;  2JWE A;  3HPM A;  4E35 A;  4XHV A;  2HE2 A;  4NXQ A;  3ID4 A;  4JOF A;  2RCZ A;  1BE9 A;  2FCF A;  5HED A;  3GGE A;  1GQ5 A;  2OCS A;  1W9E A;  2ZPL A;  2H3L A;  3PDV A;  5FHT A;  3SHW A;  5E6P B;  5JXB A;  4Q2Q A;  1QAV A;  2H2C A;  1UJV A;  2EDV A;  2OPG A;  1UEZ A;  4LMM A;  3ZRT A;  2PKU A;  5I7Z A;  2KL1 A;  4NMQ A;  1U39 A;  3MH4 A;  4FGM A;  2I6V A;  2PDZ A;  2VSP A;  2I4S A;  1N7E A;  2K20 A;  5EZ0 A;  4OAJ A;  2JIL A;  1TP5 A;  1QLC A;  5HFF A;  4Q6H A;  1G9O A;  1I16 A;  3HVQ C;  1R6J A;  1LCY A;  5DTH A;  4F8K A;  2HGA A;  2KAW A;  2JOA A;  2KPK A;  4K78 A;  2D90 A;  4Q6S A;  2I0L A;  2PKT A;  2REY A;  4NMR A;  1T2M A;  4UU6 A;  4E3B A;  2W7R A;  3CS0 A;  2KJD A;  1MC7 A;  3GDS A;  5HFD A;  3ID2 A;  1WI2 A;  3SHU A;  1Y8T A;  1RGW A;  2KPL A;  3NFL A;  1UM1 A;  2LA8 A;  5G1D A;  2VZ5 A;  2EEG A;  4NMO A;  1P1D A;  5F67 A;  3TSZ A;  3I18 A;  5HF4 A;  2IWQ A;  2V1W A;  3AXA A;  3K1R A;  3NGH A;  1FCF A;  5GLJ A;  2KOH A;  4KFV A;  4KFW A;  4RI0 A;  2KOM A;  2KJK A;  1D5G A;  1YBO A;  3OTP A;  1Z87 A;  3NFK A;  3EGG C;  2I04 A;  3EGH C;  2CSJ A;  1UEW A;  2KBS A;  1WFG A;  3LNY A;  2CS5 A;  3SOE A;  3R69 A;  4N6X A;  3TSV A;  2FNE A;  2YUY A;  2QKU A;  1WJL A;  4JL7 A;  1UHP A;  2FN5 A;  4P0C A;  2AWU A;  2HE4 A;  2PZD A;  5B6L A;  2W4F A;  2H3M A;  5GND A;  2E7K A;  2UZC A;  2EEH A;  2IWN A;  2MX6 A;  1N99 A;  1V5L A;  3O46 A;  2DKR A;  2KYL A;  3GCN A;  4GVD A;  2DLU A;  4YYX A;  1IHJ A;  4H11 A;  4JOR A;  4K6Y A;  3PV2 A;  3WKM A;  3KZD A;  3QGL A;  3FY5 A; 
#chains in the Genus database with same CATH topology
 2EGO A;  4YDP A;  2OQS A;  1RGR A;  2VRF A;  3CYY A;  1WIF A;  1UIT A;  2DB5 A;  4NXR A;  1X5Q A;  4L8N A;  4NNL A;  5HEY A;  3MH7 A;  2RRM A;  1WF7 A;  3CH8 A;  4JOH A;  1VCW A;  1RY4 A;  2KRG A;  2VSV A;  2EHR A;  1N7F A;  2G5M B;  1V6B A;  3R68 A;  1NTE A;  5F3X A;  3QDO A;  4GVC A;  3O5N A;  2KG2 A;  2EEI A;  2JIK A;  4K76 A;  4O06 A;  3RL8 A;  1I92 A;  1P1E A;  1QAV B;  4NXP A;  1U37 A;  3OU0 A;  5HJ1 A;  1KY9 A;  4E34 A;  2EXG A;  1UEQ A;  2JRE A;  3QJN A;  5HEB A;  3QIK A;  3B76 A;  2ENO A;  3TMH A;  2WL7 A;  2I0I A;  3ID3 A;  4AMH A;  1VJ6 A;  3TSW A;  5D13 A;  1PDR A;  3WKL A;  3RLE A;  2OSG A;  1OBY A;  2GZV A;  1B8Q A;  5E22 A;  5E21 A;  1Q3P A;  1UM7 A;  1N6F A;  1Q3O A;  2KQF A;  3R0H A;  3HPK A;  2EAQ A;  4Q3H A;  3DJ3 A;  2R3Y A;  1XZ9 A;  3VQG A;  2M0V A;  1OBX A;  5FB8 C;  2D8I A;  3GCO A;  2M10 A;  2LUI A;  3K82 A;  2EJY A;  4JOK A;  1N7T A;  4NMS A;  4NMT A;  1V62 A;  2L97 A;  2OGP A;  2YT8 A;  2AWX A;  2Q3G A;  4R2Z A;  2KV8 A;  1VA8 A;  1OZI A;  2YT7 A;  2EDP A;  2FE5 A;  3DOR A;  4PQW A;  2Z9I A;  1FC6 A;  2IWP A;  3SUZ A;  3JXT A;  2YUB A;  4EDJ A;  2DAZ A;  3GJ9 A;  1X6D A;  4P2A B;  1Z86 A;  3GDV A;  2F0A A;  2L4T A;  1BFE A;  3LNX A;  3QE1 A;  2OZF A;  4G69 A;  2DJT A;  1GQ4 A;  3DIW A;  1WG6 A;  2OMJ A;  4GHN A;  4IC6 A;  4MPA A;  1V5Q A;  3MH6 A;  2JSN A;  1Y7N A;  3I4W A;  2JXO A;  3PV5 A;  5HF1 A;  2EGK A;  1WI4 A;  1GM1 A;  2DC2 A;  4WYU A;  2CSS A;  2VWR A;  5HET A;  1L6O A;  1N6D A;  1X5N A;  3ID1 A;  1KEF A;  4NNM A;  4K75 A;  2YTW A;  2H2B A;  1UJU A;  1IU0 A;  1WFV A;  3QO6 A;  4JOP A;  4HOP B;  1VB7 A;  2M3M A;  2V90 A;  1FC7 A;  2R4H A;  2P3W A;  1TQ3 A;  3KZE A;  2DLS A;  1SOT A;  2D92 A;  3QJM A;  5A2P A;  3RL7 A;  2X7Z A;  2LC6 A;  4OEO A;  2PA1 A;  2LC7 A;  3CBY A;  3CBX A;  4K72 A;  2KA9 A;  2OS6 A;  2M0T A;  1MFL A;  3DJ1 A;  1WHD A;  2IWO A;  2G2L A;  3DJA A;  4NMP A;  2Q9V A;  3PDZ A;  5HFB A;  4Z33 A;  2QG1 A;  1TE0 A;  1U38 A;  4JOG A;  2PNT A;  1RZX A;  4Q2P A;  4Q2N A;  2VPH A;  3VQF A;  2EV8 A;  5HDY A;  5IL9 A;  5HFE A;  2M0U A;  3CC0 A;  4REY A;  4NMV A;  1V1T A;  5G1E A;  1QAU A;  1ZOK A;  1WH1 A;  1KWA A;  2L4S A;  1TP3 A;  2DMZ A;  4JOJ A;  1OBZ A;  1UF1 A;  3PS4 A;  2KOJ A;  2QKV A;  2AIN A;  3KHF A;  2EEJ A;  2K1Z A;  1M5Z A;  4JJ0 A;  2F5Y A;  3GSL A;  1ZUB A;  1VAE A;  2MHO A;  1X45 A;  1NF3 C;  1N6E A;  3GAB A;  1U3B A;  3STJ A;  2O2T A;  2Z17 A;  4WYT A;  3SFJ A;  5E11 A;  3I1E A;  1UEP A;  1X9Z A;  1K32 A;  1WF8 A;  2AWW A;  1SOZ A;  2DM8 A;  1X8S A;  1X5R A;  3CBZ A;  4JOE A;  3GDU A;  2I1N A;  2KJP A;  3E17 A;  3BPU A;  1W9O A;  1WHA A;  2EDZ A;  1Q7X A;  1FC9 A;  1UFX A;  2EGN A;  5E1Y A;  2QT5 A;  4Z8J A;  1IU2 A;  2QKT A;  2ZPM A;  1W9Q A;  1MFG A;  3L4F D;  4UU5 A;  4Q2O A;  5HFC A;  4HOP A;  5EYZ A;  2BYG A;  2LOB A;  3PV4 A;  4OEP A;  3K50 A;  2M0Z A;  2JIN A;  5H3J A;  1UJD A;  2QBW A;  2JWE A;  3HPM A;  4E35 A;  4XHV A;  2HE2 A;  4NXQ A;  3ID4 A;  4JOF A;  2RCZ A;  1BE9 A;  2FCF A;  5HED A;  4JJ3 A;  3GGE A;  1GQ5 A;  2OCS A;  1W9E A;  2ZPL A;  2H3L A;  3PDV A;  5FHT A;  3SHW A;  5E6P B;  5B42 A;  5JXB A;  4Q2Q A;  3KDG A;  1QAV A;  2H2C A;  1UJV A;  2EDV A;  2OPG A;  1UEZ A;  4LMM A;  3ZRT A;  2PKU A;  5I7Z A;  2KL1 A;  4NMQ A;  1U39 A;  3MH4 A;  4FGM A;  2I6V A;  2PDZ A;  2VSP A;  2I4S A;  1N7E A;  2K20 A;  5EZ0 A;  4OAJ A;  2JIL A;  1TP5 A;  1QLC A;  3NCV A;  5HFF A;  4Q6H A;  1G9O A;  1I16 A;  3HVQ C;  1R6J A;  1LCY A;  5DTH A;  4F8K A;  2GEF A;  2HGA A;  2KAW A;  2JOA A;  2KPK A;  4K78 A;  2D90 A;  4Q6S A;  2I0L A;  2PKT A;  2REY A;  4NMR A;  1T2M A;  4UU6 A;  4E3B A;  2W7R A;  3CS0 A;  2KJD A;  1MC7 A;  3GDS A;  5HFD A;  3ID2 A;  1WI2 A;  3SHU A;  1Y8T A;  1RGW A;  2KPL A;  3NFL A;  1UM1 A;  2LA8 A;  5G1D A;  2VZ5 A;  2EEG A;  4NMO A;  3KDK A;  4FLN A;  1P1D A;  5F67 A;  3TSZ A;  3I18 A;  5HF4 A;  2IWQ A;  2V1W A;  3AXA A;  3K1R A;  3NGH A;  1FCF A;  5GLJ A;  2KOH A;  4KFV A;  4KFW A;  4RI0 A;  2KOM A;  2KJK A;  1D5G A;  1YBO A;  3OTP A;  1Z87 A;  3NFK A;  3EGG C;  2I04 A;  3EGH C;  2CSJ A;  1UEW A;  2KBS A;  1WFG A;  3LNY A;  5ILB A;  2CS5 A;  3SOE A;  3R69 A;  4N6X A;  3TSV A;  2FNE A;  2YUY A;  2QKU A;  1WJL A;  4JL7 A;  1UHP A;  2FN5 A;  4P0C A;  2AWU A;  2HE4 A;  2PZD A;  5B6L A;  2W4F A;  2H3M A;  5GND A;  2E7K A;  2UZC A;  2EEH A;  2IWN A;  2MX6 A;  1N99 A;  1V5L A;  3O46 A;  2DKR A;  2KYL A;  3GCN A;  4GVD A;  2DLU A;  4YYX A;  1IHJ A;  4H11 A;  4JOR A;  4K6Y A;  3PV2 A;  3WKM A;  3KZD A;  3QGL A;  3FY5 A; 
#chains in the Genus database with same CATH homology
 2EGO A;  4YDP A;  2OQS A;  1RGR A;  2VRF A;  3CYY A;  1WIF A;  1UIT A;  2DB5 A;  4NXR A;  1X5Q A;  4L8N A;  4NNL A;  5HEY A;  3MH7 A;  2RRM A;  1WF7 A;  3CH8 A;  4JOH A;  1VCW A;  1RY4 A;  2KRG A;  2VSV A;  2EHR A;  1N7F A;  2G5M B;  1V6B A;  3R68 A;  1NTE A;  5F3X A;  3QDO A;  4GVC A;  3O5N A;  2KG2 A;  2EEI A;  2JIK A;  4K76 A;  4O06 A;  3RL8 A;  1I92 A;  1P1E A;  1QAV B;  4NXP A;  1U37 A;  3OU0 A;  5HJ1 A;  1KY9 A;  4E34 A;  2EXG A;  1UEQ A;  2JRE A;  3QJN A;  5HEB A;  3QIK A;  3B76 A;  2ENO A;  3TMH A;  2WL7 A;  2I0I A;  3ID3 A;  4AMH A;  1VJ6 A;  3TSW A;  5D13 A;  1PDR A;  3WKL A;  3RLE A;  2OSG A;  1OBY A;  2GZV A;  1B8Q A;  5E22 A;  5E21 A;  1Q3P A;  1UM7 A;  1N6F A;  1Q3O A;  2KQF A;  3R0H A;  3HPK A;  2EAQ A;  4Q3H A;  3DJ3 A;  2R3Y A;  1XZ9 A;  3VQG A;  2M0V A;  1OBX A;  5FB8 C;  2D8I A;  3GCO A;  2M10 A;  2LUI A;  3K82 A;  2EJY A;  4JOK A;  1N7T A;  4NMS A;  4NMT A;  1V62 A;  2L97 A;  2OGP A;  2YT8 A;  2AWX A;  2Q3G A;  4R2Z A;  2KV8 A;  1VA8 A;  1OZI A;  2YT7 A;  2EDP A;  2FE5 A;  3DOR A;  4PQW A;  2Z9I A;  1FC6 A;  2IWP A;  3SUZ A;  3JXT A;  2YUB A;  4EDJ A;  2DAZ A;  3GJ9 A;  1X6D A;  4P2A B;  1Z86 A;  3GDV A;  2F0A A;  2L4T A;  1BFE A;  3LNX A;  3QE1 A;  2OZF A;  4G69 A;  2DJT A;  1GQ4 A;  3DIW A;  1WG6 A;  2OMJ A;  4GHN A;  4IC6 A;  4MPA A;  1V5Q A;  3MH6 A;  2JSN A;  1Y7N A;  3I4W A;  2JXO A;  3PV5 A;  5HF1 A;  2EGK A;  1WI4 A;  1GM1 A;  2DC2 A;  4WYU A;  2CSS A;  2VWR A;  5HET A;  1L6O A;  1N6D A;  1X5N A;  3ID1 A;  1KEF A;  4NNM A;  4K75 A;  2YTW A;  2H2B A;  1UJU A;  1IU0 A;  1WFV A;  3QO6 A;  4JOP A;  4HOP B;  1VB7 A;  2M3M A;  2V90 A;  1FC7 A;  2R4H A;  2P3W A;  1TQ3 A;  3KZE A;  2DLS A;  1SOT A;  2D92 A;  3QJM A;  5A2P A;  3RL7 A;  2X7Z A;  2LC6 A;  4OEO A;  2PA1 A;  2LC7 A;  3CBY A;  3CBX A;  4K72 A;  2KA9 A;  2OS6 A;  2M0T A;  1MFL A;  3DJ1 A;  1WHD A;  2IWO A;  2G2L A;  3DJA A;  4NMP A;  2Q9V A;  3PDZ A;  5HFB A;  4Z33 A;  2QG1 A;  1TE0 A;  1U38 A;  4JOG A;  2PNT A;  1RZX A;  4Q2P A;  4Q2N A;  2VPH A;  3VQF A;  2EV8 A;  5HDY A;  5IL9 A;  5HFE A;  2M0U A;  3CC0 A;  4REY A;  4NMV A;  1V1T A;  5G1E A;  1QAU A;  1ZOK A;  1WH1 A;  1KWA A;  2L4S A;  1TP3 A;  2DMZ A;  4JOJ A;  1OBZ A;  1UF1 A;  3PS4 A;  2KOJ A;  2QKV A;  2AIN A;  3KHF A;  2EEJ A;  2K1Z A;  1M5Z A;  4JJ0 A;  2F5Y A;  3GSL A;  1ZUB A;  1VAE A;  2MHO A;  1X45 A;  1NF3 C;  1N6E A;  3GAB A;  1U3B A;  3STJ A;  2O2T A;  2Z17 A;  4WYT A;  3SFJ A;  5E11 A;  3I1E A;  1UEP A;  1X9Z A;  1K32 A;  1WF8 A;  2AWW A;  1SOZ A;  2DM8 A;  1X8S A;  1X5R A;  3CBZ A;  4JOE A;  3GDU A;  2I1N A;  2KJP A;  3E17 A;  3BPU A;  1W9O A;  1WHA A;  2EDZ A;  1Q7X A;  1FC9 A;  1UFX A;  2EGN A;  5E1Y A;  2QT5 A;  4Z8J A;  1IU2 A;  2QKT A;  2ZPM A;  1W9Q A;  1MFG A;  3L4F D;  4UU5 A;  4Q2O A;  5HFC A;  4HOP A;  5EYZ A;  2BYG A;  2LOB A;  3PV4 A;  4OEP A;  3K50 A;  2M0Z A;  2JIN A;  5H3J A;  1UJD A;  2QBW A;  2JWE A;  3HPM A;  4E35 A;  4XHV A;  2HE2 A;  4NXQ A;  3ID4 A;  4JOF A;  2RCZ A;  1BE9 A;  2FCF A;  5HED A;  4JJ3 A;  3GGE A;  1GQ5 A;  2OCS A;  1W9E A;  2ZPL A;  2H3L A;  3PDV A;  5FHT A;  3SHW A;  5E6P B;  5B42 A;  5JXB A;  4Q2Q A;  3KDG A;  1QAV A;  2H2C A;  1UJV A;  2EDV A;  2OPG A;  1UEZ A;  4LMM A;  3ZRT A;  2PKU A;  5I7Z A;  2KL1 A;  4NMQ A;  1U39 A;  3MH4 A;  4FGM A;  2I6V A;  2PDZ A;  2VSP A;  2I4S A;  1N7E A;  2K20 A;  5EZ0 A;  4OAJ A;  2JIL A;  1TP5 A;  1QLC A;  3NCV A;  5HFF A;  4Q6H A;  1G9O A;  1I16 A;  3HVQ C;  1R6J A;  1LCY A;  5DTH A;  4F8K A;  2GEF A;  2HGA A;  2KAW A;  2JOA A;  2KPK A;  4K78 A;  2D90 A;  4Q6S A;  2I0L A;  2PKT A;  2REY A;  4NMR A;  1T2M A;  4UU6 A;  4E3B A;  2W7R A;  3CS0 A;  2KJD A;  1MC7 A;  3GDS A;  5HFD A;  3ID2 A;  1WI2 A;  3SHU A;  1Y8T A;  1RGW A;  2KPL A;  3NFL A;  1UM1 A;  2LA8 A;  5G1D A;  2VZ5 A;  2EEG A;  4NMO A;  3KDK A;  4FLN A;  1P1D A;  5F67 A;  3TSZ A;  3I18 A;  5HF4 A;  2IWQ A;  2V1W A;  3AXA A;  3K1R A;  3NGH A;  1FCF A;  5GLJ A;  2KOH A;  4KFV A;  4KFW A;  4RI0 A;  2KOM A;  2KJK A;  1D5G A;  1YBO A;  3OTP A;  1Z87 A;  3NFK A;  3EGG C;  2I04 A;  3EGH C;  2CSJ A;  1UEW A;  2KBS A;  1WFG A;  3LNY A;  5ILB A;  2CS5 A;  3SOE A;  3R69 A;  4N6X A;  3TSV A;  2FNE A;  2YUY A;  2QKU A;  1WJL A;  4JL7 A;  1UHP A;  2FN5 A;  4P0C A;  2AWU A;  2HE4 A;  2PZD A;  5B6L A;  2W4F A;  2H3M A;  5GND A;  2E7K A;  2UZC A;  2EEH A;  2IWN A;  2MX6 A;  1N99 A;  1V5L A;  3O46 A;  2DKR A;  2KYL A;  3GCN A;  4GVD A;  2DLU A;  4YYX A;  1IHJ A;  4H11 A;  4JOR A;  4K6Y A;  3PV2 A;  3WKM A;  3KZD A;  3QGL A;  3FY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...