2L4SA

Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of gip with glutaminase l
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
124
structure length
124
Chain Sequence
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 3
publication title Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 21
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2l4sA01
2KG2A 2REYA 3PV5A 4Q6SA 2X7ZA 4F8KA 4LMMA 2EXGA 1KY9A 2OCSA 3ID4A 1W9QA 1WH1A 2JXOA 1BE9A 1X5RA 1V5LA 3KZEA 2K20A 1IHJA 3PDZA 1UJVA 1UJDA 4Q6HA 1FC7A 2KOHA 2KRGA 1VAEA 3FY5A 2FCFA 4JOKA 2DB5A 2M0VA 1Q7XA 3ID2A 4N6XA 2JINA 2KBSA 2QG1A 1NTEA 1SOZA 3ID1A 5HFCA 1FC9A 4RI0A 3TMHA 3SOEA 3DJ1A 2AINA 2H2CA 2VRFA 4GVCA 3VQFA 5GNDA 1WG6A 2YTWA 2R4HA 1XZ9A 2KQFA 3QJNA 4R2ZA 1N6EA 1V6BA 4Q3HA 5F3XA 3B76A 2G2LA 4OAJA 1Z86A 2I0LA 1OZIA 2L4SA 1PDRA 1UEZA 2LC7A 2M0TA 4MPAA 2EV8A 4KFWA 3CBYA 3L4FD 2V90A 1U39A 2HGAA 3MH6A 1WI4A 4K72A 1WFGA 2L4TA 2YT8A 1VJ6A 2KJKA 2EGKA 3QJMA 4NXPA 1TP3A 1W9EA 4NMPA 1N7FA 2JOAA 2BYGA 1IU0A 1UEWA 1RGRA 2IWPA 1UJUA 2EEGA 1KWAA 2I1NA 2VSVA 4FGMA 5JXBA 1WI2A 3KZDA 3TSZA 3LNXA 2M10A 3TSVA 4Q2NA 4JOPA 1N99A 3EGGC 3ZRTA 2PDZA 2M0ZA 1OBXA 3O46A 2LUIA 1TE0A 2VWRA 3DJAA 1Y8TA 2CSSA 3STJA 3RL7A 4WYTA 4KFVA 2EDVA 2IWQA 1TQ3A 2V1WA 2PKTA 2E7KA 4JOJA 2HE2A 2EGNA 2JREA 1N6FA 3HPMA 5HF4A 3DIWA 4E34A 4OEPA 2KAWA 4NMSA 2R3YA 2LOBA 2OS6A 2JILA 3WKLA 4E3BA 1TP5A 2KPLA 4Z8JA 1WF8A 2DLUA 2FNEA 2PA1A 3PS4A 2H3LA 2ENOA 1G9OA 5F67A 4JL7A 3DORA 4REYA 2Q9VA 2W7RA 2M3MA 3CBZA 1QLCA 4NMRA 2AWWA 1L6OA 1I92A 2GZVA 2MHOA 1I16A 2KOMA 2MX6A 5E1YA 1Z87A 1VA8A 2KOJA 5DTHA 3RLEA 1X6DA 5D13A 2QKUA 5A2PA 3PV2A 1W9OA 5HEBA 4NMOA 2EAQA 3CH8A 1Q3PA 2VZ5A 3GDUA 2PZDA 3DJ3A 4H11A 3JXTA 3K1RA 3LNYA 3NFKA 4Q2PA 2CSJA 5E6PB 2Q3GA 2KJDA 2W4FA 2DM8A 3R69A 3I1EA 1D5GA 5FB8C 2EEHA 2DLSA 3CBXA 1X45A 4JORA 5E11A 1MFGA 1X5NA 3EGHC 5HFFA 2JIKA 2QT5A 1P1EA 2FN5A 1WHDA 2KL1A 2DMZA 4YDPA 1OBYA 2F0AA 5GLJA 2EDZA 2QBWA 2LC6A 3R0HA 3K50A 2P3WA 1U3BA 1ZUBA 3GGEA 4K76A 2ZPLA 1N7EA 1RGWA 3QGLA 2AWUA 2D92A 2WL7A 2YT7A 4NXRA 2OZFA 1N6DA 1X8SA 4JOGA 2O2TA 1U38A 3MH7A 4WYUA 3SUZA 2I6VA 1OBZA 2KPKA 4JOFA 3KHFA 2LA8A 2FE5A 1ZOKA 2K1ZA 1QAVA 1BFEA 3QO6A 3VQGA 1GQ5A 1FC6A 5HFEA 3NGHA 5HETA 1UEPA 3RL8A 3QDOA 2G5MB 3GCNA 2I0IA 2QKVA 5E21A 5HJ1A 2D8IA 5G1EA 2L97A 3MH4A 2UZCA 1WIFA 2IWNA 2KA9A 2KYLA 1IU2A 2D90A 5HEYA 5E22A 1RZXA 2OGPA 5EZ0A 1MFLA 4GHNA 1K32A 3K82A 2Z9IA 1UHPA 4E35A 1VCWA 3CS0A 3BPUA 4NMVA 1WFVA 2VSPA 1SOTA 3I4WA 5H3JA 3CC0A 4Q2OA 1R6JA 4L8NA 2OPGA 2OQSA 1UFXA 1P1DA 1N7TA 5G1DA 3AXAA 4AMHA 4K78A 4NMQA 2EHRA 3OU0A 2H2BA 5EYZA 2RCZA 1M5ZA 2M0UA 4JOHA 1YBOA 2RRMA 1B8QA 1UM1A 4PQWA 2I04A 2OSGA 4NNMA 1Y7NA 4Z33A 3CYYA 3GCOA 1X5QA 1KEFA 3QIKA 1UM7A 2DKRA 3GSLA 2YUYA 5FHTA 4K6YA 1LCYA 2EGOA 1WF7A 5HFDA 4Q2QA 2PKUA 4NXQA 1UEQA 2YUBA 2PNTA 3PDVA 1Q3OA 4NNLA 1GQ4A 2QKTA 5HF1A 1UITA 4UU6A 4P0CA 2CS5A 3SHWA 2DJTA 4JOEA 3I18A 3GDSA 3NFLA 5HDYA 1FCFA 4G69A 2IWOA 4YYXA 1VB7A 4XHVA 4OEOA 2Z17A 1V5QA 1GM1A 3GJ9A 5I7ZA 3HVQC 1T2MA 2DC2A 2VPHA 1MC7A 2EDPA 5HFBA 3WKMA 1V62A 4UU5A 4HOPA 2I4SA 3E17A 2AWXA 1WJLA 4IC6A 3R68A 2JWEA 3TSWA 2EEJA 4EDJA 4NMTA 1RY4A 4P2AB 2EEIA 1U37A 2EJYA 2ZPMA 4HOPB 3PV4A 2KJPA 5HEDA 4O06A 3O5NA 4K75A 1NF3C 3SHUA 1V1TA 1UF1A 1WHAA 3OTPA 4GVDA 3QE1A 1QAVB 3SFJA 2HE4A 2H3MA 3ID3A 2DAZA 2KV8A 2F5YA 5B6LA 2OMJA 3HPKA 1QAUA 3GDVA
chains in the Genus database with same CATH superfamily
2GEFA 2KG2A 2REYA 3PV5A 4Q6SA 2X7ZA 4F8KA 4LMMA 2EXGA 1KY9A 2OCSA 3ID4A 1W9QA 1WH1A 2JXOA 1BE9A 1X5RA 1V5LA 3KZEA 2K20A 1IHJA 3PDZA 1UJVA 1UJDA 4Q6HA 1FC7A 2KOHA 2KRGA 1VAEA 3FY5A 2FCFA 4JOKA 2DB5A 2M0VA 1Q7XA 3ID2A 4N6XA 2JINA 4JJ3A 2KBSA 2QG1A 1NTEA 1SOZA 3ID1A 5HFCA 1FC9A 4RI0A 3TMHA 3SOEA 3DJ1A 2AINA 2H2CA 2VRFA 4GVCA 3VQFA 5GNDA 1WG6A 2YTWA 2R4HA 1XZ9A 2KQFA 3QJNA 4R2ZA 1N6EA 1V6BA 4Q3HA 5F3XA 3B76A 2G2LA 4OAJA 1Z86A 2I0LA 1OZIA 2L4SA 1PDRA 1UEZA 2LC7A 2M0TA 4MPAA 2EV8A 4KFWA 3CBYA 3L4FD 2V90A 1U39A 2HGAA 3MH6A 1WI4A 4K72A 1WFGA 2L4TA 2YT8A 1VJ6A 2KJKA 2EGKA 3QJMA 4NXPA 1TP3A 1W9EA 4NMPA 1N7FA 2JOAA 2BYGA 1IU0A 1UEWA 1RGRA 2IWPA 1UJUA 2EEGA 1KWAA 2I1NA 2VSVA 4FGMA 5JXBA 1WI2A 3KZDA 3TSZA 3LNXA 2M10A 3TSVA 5IL9A 4Q2NA 4JOPA 1N99A 3EGGC 3ZRTA 2PDZA 2M0ZA 1OBXA 3O46A 2LUIA 1TE0A 2VWRA 3DJAA 1Y8TA 2CSSA 3STJA 3RL7A 4WYTA 4KFVA 2EDVA 2IWQA 1TQ3A 2V1WA 2PKTA 2E7KA 4JOJA 2HE2A 2EGNA 2JREA 1N6FA 3HPMA 5HF4A 3DIWA 4E34A 4OEPA 2KAWA 4NMSA 2R3YA 2LOBA 2OS6A 2JILA 3WKLA 4E3BA 1TP5A 2KPLA 4Z8JA 1WF8A 2DLUA 2FNEA 2PA1A 3PS4A 2H3LA 2ENOA 1G9OA 5F67A 4JL7A 3DORA 4REYA 2Q9VA 2W7RA 3GABA 2M3MA 3CBZA 1QLCA 4NMRA 2AWWA 1L6OA 1I92A 2GZVA 2MHOA 1I16A 2KOMA 2MX6A 5E1YA 1Z87A 1VA8A 3KDKA 2KOJA 5DTHA 3RLEA 1X6DA 5D13A 2QKUA 5A2PA 3PV2A 1W9OA 5HEBA 4NMOA 2EAQA 3CH8A 1Q3PA 2VZ5A 3GDUA 2PZDA 3DJ3A 4H11A 3JXTA 3K1RA 3LNYA 3NFKA 4Q2PA 2JSNA 2CSJA 5E6PB 2Q3GA 2KJDA 2W4FA 2DM8A 3R69A 3I1EA 1D5GA 5FB8C 2EEHA 2DLSA 3CBXA 1X45A 4JORA 5E11A 1MFGA 1X5NA 3EGHC 5HFFA 2JIKA 2QT5A 1P1EA 2FN5A 1WHDA 2KL1A 2DMZA 4YDPA 1OBYA 2F0AA 5GLJA 2EDZA 2QBWA 2LC6A 3R0HA 3K50A 2P3WA 4JJ0A 1U3BA 1ZUBA 3GGEA 4K76A 2ZPLA 1N7EA 1RGWA 3QGLA 2AWUA 2D92A 2WL7A 2YT7A 4NXRA 2OZFA 1N6DA 1X8SA 4JOGA 2O2TA 1U38A 3MH7A 4WYUA 3SUZA 2I6VA 1OBZA 2KPKA 4JOFA 3KHFA 2LA8A 2FE5A 1ZOKA 2K1ZA 1QAVA 1BFEA 3QO6A 3VQGA 1GQ5A 1FC6A 5HFEA 3NGHA 5HETA 1UEPA 5ILBA 3RL8A 3QDOA 2G5MB 3GCNA 2I0IA 2QKVA 5E21A 5HJ1A 2D8IA 5G1EA 2L97A 3MH4A 2UZCA 1WIFA 2IWNA 2KA9A 2KYLA 1IU2A 2D90A 5HEYA 5E22A 1RZXA 2OGPA 5EZ0A 1MFLA 4GHNA 1K32A 3K82A 2Z9IA 1UHPA 4E35A 1VCWA 3CS0A 3BPUA 4NMVA 1WFVA 2VSPA 1SOTA 3I4WA 5H3JA 3CC0A 4Q2OA 1R6JA 4L8NA 2OPGA 2OQSA 1UFXA 1P1DA 1N7TA 5G1DA 3AXAA 4AMHA 4K78A 4NMQA 2EHRA 3OU0A 2H2BA 5EYZA 2RCZA 1M5ZA 2M0UA 4JOHA 1YBOA 2RRMA 1B8QA 1UM1A 4PQWA 2I04A 2OSGA 4NNMA 1Y7NA 4Z33A 3CYYA 3GCOA 1X5QA 1KEFA 3QIKA 1UM7A 2DKRA 3GSLA 2YUYA 5FHTA 4K6YA 1LCYA 2EGOA 1X9ZA 1WF7A 5HFDA 4Q2QA 2PKUA 4NXQA 1UEQA 2YUBA 2PNTA 3PDVA 1Q3OA 4NNLA 1GQ4A 2QKTA 5HF1A 1UITA 4UU6A 4P0CA 2CS5A 3SHWA 2DJTA 4JOEA 3I18A 3KDGA 3GDSA 3NFLA 5HDYA 1FCFA 4G69A 2IWOA 4YYXA 1VB7A 4XHVA 4OEOA 2Z17A 1V5QA 1GM1A 3GJ9A 5I7ZA 4FLNA 3HVQC 1T2MA 3NCVA 2DC2A 2VPHA 1MC7A 2EDPA 5HFBA 3WKMA 1V62A 4UU5A 4HOPA 2I4SA 3E17A 2AWXA 1WJLA 4IC6A 3R68A 2JWEA 3TSWA 2EEJA 4EDJA 4NMTA 1RY4A 4P2AB 2EEIA 1U37A 2EJYA 5B42A 2ZPMA 4HOPB 3PV4A 2KJPA 5HEDA 4O06A 3O5NA 4K75A 1NF3C 3SHUA 1V1TA 1UF1A 1WHAA 3OTPA 4GVDA 3QE1A 1QAVB 3SFJA 2HE4A 2H3MA 3ID3A 2DAZA 2KV8A 2F5YA 5B6LA 2OMJA 3HPKA 1QAUA 3GDVA
chains in the Genus database with same CATH topology
2GEFA 2KG2A 2REYA 3PV5A 4Q6SA 2X7ZA 4F8KA 4LMMA 2EXGA 1KY9A 2OCSA 3ID4A 1W9QA 1WH1A 2JXOA 1BE9A 1X5RA 1V5LA 3KZEA 2K20A 1IHJA 3PDZA 1UJVA 1UJDA 4Q6HA 1FC7A 2KOHA 2KRGA 1VAEA 3FY5A 2FCFA 4JOKA 2DB5A 2M0VA 1Q7XA 3ID2A 4N6XA 2JINA 4JJ3A 2KBSA 2QG1A 1NTEA 1SOZA 3ID1A 5HFCA 1FC9A 4RI0A 3TMHA 3SOEA 3DJ1A 2AINA 2H2CA 2VRFA 4GVCA 3VQFA 5GNDA 1WG6A 2YTWA 2R4HA 1XZ9A 2KQFA 3QJNA 4R2ZA 1N6EA 1V6BA 4Q3HA 5F3XA 3B76A 2G2LA 4OAJA 1Z86A 2I0LA 1OZIA 2L4SA 1PDRA 1UEZA 2LC7A 2M0TA 4MPAA 2EV8A 4KFWA 3CBYA 3L4FD 2V90A 1U39A 2HGAA 3MH6A 1WI4A 4K72A 1WFGA 2L4TA 2YT8A 1VJ6A 2KJKA 2EGKA 3QJMA 4NXPA 1TP3A 1W9EA 4NMPA 1N7FA 2JOAA 2BYGA 1IU0A 1UEWA 1RGRA 2IWPA 1UJUA 2EEGA 1KWAA 2I1NA 2VSVA 4FGMA 5JXBA 1WI2A 3KZDA 3TSZA 3LNXA 2M10A 3TSVA 5IL9A 4Q2NA 4JOPA 1N99A 3EGGC 3ZRTA 2PDZA 2M0ZA 1OBXA 3O46A 2LUIA 1TE0A 2VWRA 3DJAA 1Y8TA 2CSSA 3STJA 3RL7A 4WYTA 4KFVA 2EDVA 2IWQA 1TQ3A 2V1WA 2PKTA 2E7KA 4JOJA 2HE2A 2EGNA 2JREA 1N6FA 3HPMA 5HF4A 3DIWA 4E34A 4OEPA 2KAWA 4NMSA 2R3YA 2LOBA 2OS6A 2JILA 3WKLA 4E3BA 1TP5A 2KPLA 4Z8JA 1WF8A 2DLUA 2FNEA 2PA1A 3PS4A 2H3LA 2ENOA 1G9OA 5F67A 4JL7A 3DORA 4REYA 2Q9VA 2W7RA 3GABA 2M3MA 3CBZA 1QLCA 4NMRA 2AWWA 1L6OA 1I92A 2GZVA 2MHOA 1I16A 2KOMA 2MX6A 5E1YA 1Z87A 1VA8A 3KDKA 2KOJA 5DTHA 3RLEA 1X6DA 5D13A 2QKUA 5A2PA 3PV2A 1W9OA 5HEBA 4NMOA 2EAQA 3CH8A 1Q3PA 2VZ5A 3GDUA 2PZDA 3DJ3A 4H11A 3JXTA 3K1RA 3LNYA 3NFKA 4Q2PA 2JSNA 2CSJA 5E6PB 2Q3GA 2KJDA 2W4FA 2DM8A 3R69A 3I1EA 1D5GA 5FB8C 2EEHA 2DLSA 3CBXA 1X45A 4JORA 5E11A 1MFGA 1X5NA 3EGHC 5HFFA 2JIKA 2QT5A 1P1EA 2FN5A 1WHDA 2KL1A 2DMZA 4YDPA 1OBYA 2F0AA 5GLJA 2EDZA 2QBWA 2LC6A 3R0HA 3K50A 2P3WA 4JJ0A 1U3BA 1ZUBA 3GGEA 4K76A 2ZPLA 1N7EA 1RGWA 3QGLA 2AWUA 2D92A 2WL7A 2YT7A 4NXRA 2OZFA 1N6DA 1X8SA 4JOGA 2O2TA 1U38A 3MH7A 4WYUA 3SUZA 2I6VA 1OBZA 2KPKA 4JOFA 3KHFA 2LA8A 2FE5A 1ZOKA 2K1ZA 1QAVA 1BFEA 3QO6A 3VQGA 1GQ5A 1FC6A 5HFEA 3NGHA 5HETA 1UEPA 5ILBA 3RL8A 3QDOA 2G5MB 3GCNA 2I0IA 2QKVA 5E21A 5HJ1A 2D8IA 5G1EA 2L97A 3MH4A 2UZCA 1WIFA 2IWNA 2KA9A 2KYLA 1IU2A 2D90A 5HEYA 5E22A 1RZXA 2OGPA 5EZ0A 1MFLA 4GHNA 1K32A 3K82A 2Z9IA 1UHPA 4E35A 1VCWA 3CS0A 3BPUA 4NMVA 1WFVA 2VSPA 1SOTA 3I4WA 5H3JA 3CC0A 4Q2OA 1R6JA 4L8NA 2OPGA 2OQSA 1UFXA 1P1DA 1N7TA 5G1DA 3AXAA 4AMHA 4K78A 4NMQA 2EHRA 3OU0A 2H2BA 5EYZA 2RCZA 1M5ZA 2M0UA 4JOHA 1YBOA 2RRMA 1B8QA 1UM1A 4PQWA 2I04A 2OSGA 4NNMA 1Y7NA 4Z33A 3CYYA 3GCOA 1X5QA 1KEFA 3QIKA 1UM7A 2DKRA 3GSLA 2YUYA 5FHTA 4K6YA 1LCYA 2EGOA 1X9ZA 1WF7A 5HFDA 4Q2QA 2PKUA 4NXQA 1UEQA 2YUBA 2PNTA 3PDVA 1Q3OA 4NNLA 1GQ4A 2QKTA 5HF1A 1UITA 4UU6A 4P0CA 2CS5A 3SHWA 2DJTA 4JOEA 3I18A 3KDGA 3GDSA 3NFLA 5HDYA 1FCFA 4G69A 2IWOA 4YYXA 1VB7A 4XHVA 4OEOA 2Z17A 1V5QA 1GM1A 3GJ9A 5I7ZA 4FLNA 3HVQC 1T2MA 3NCVA 2DC2A 2VPHA 1MC7A 2EDPA 5HFBA 3WKMA 1V62A 4UU5A 4HOPA 2I4SA 3E17A 2AWXA 1WJLA 4IC6A 3R68A 2JWEA 3TSWA 2EEJA 4EDJA 4NMTA 1RY4A 4P2AB 2EEIA 1U37A 2EJYA 5B42A 2ZPMA 4HOPB 3PV4A 2KJPA 5HEDA 4O06A 3O5NA 4K75A 1NF3C 3SHUA 1V1TA 1UF1A 1WHAA 3OTPA 4GVDA 3QE1A 1QAVB 3SFJA 2HE4A 2H3MA 3ID3A 2DAZA 2KV8A 2F5YA 5B6LA 2OMJA 3HPKA 1QAUA 3GDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG2 A;  2REY A;  3PV5 A;  4Q6S A;  2X7Z A;  4F8K A;  4LMM A;  2EXG A;  1KY9 A;  2OCS A;  3ID4 A;  1W9Q A;  1WH1 A;  2JXO A;  1BE9 A;  1X5R A;  1V5L A;  3KZE A;  2K20 A;  1IHJ A;  3PDZ A;  1UJV A;  1UJD A;  4Q6H A;  1FC7 A;  2KOH A;  2KRG A;  1VAE A;  3FY5 A;  2FCF A;  4JOK A;  2DB5 A;  2M0V A;  1Q7X A;  3ID2 A;  4N6X A;  2JIN A;  2KBS A;  2QG1 A;  1NTE A;  1SOZ A;  3ID1 A;  5HFC A;  1FC9 A;  4RI0 A;  3TMH A;  3SOE A;  3DJ1 A;  2AIN A;  2H2C A;  2VRF A;  4GVC A;  3VQF A;  5GND A;  1WG6 A;  2YTW A;  2R4H A;  1XZ9 A;  2KQF A;  3QJN A;  4R2Z A;  1N6E A;  1V6B A;  4Q3H A;  5F3X A;  3B76 A;  2G2L A;  4OAJ A;  1Z86 A;  2I0L A;  1OZI A;  2L4S A;  1PDR A;  1UEZ A;  2LC7 A;  2M0T A;  4MPA A;  2EV8 A;  4KFW A;  3CBY A;  3L4F D;  2V90 A;  1U39 A;  2HGA A;  3MH6 A;  1WI4 A;  4K72 A;  1WFG A;  2L4T A;  2YT8 A;  1VJ6 A;  2KJK A;  2EGK A;  3QJM A;  4NXP A;  1TP3 A;  1W9E A;  4NMP A;  1N7F A;  2JOA A;  2BYG A;  1IU0 A;  1UEW A;  1RGR A;  2IWP A;  1UJU A;  2EEG A;  1KWA A;  2I1N A;  2VSV A;  4FGM A;  5JXB A;  1WI2 A;  3KZD A;  3TSZ A;  3LNX A;  2M10 A;  3TSV A;  4Q2N A;  4JOP A;  1N99 A;  3EGG C;  3ZRT A;  2PDZ A;  2M0Z A;  1OBX A;  3O46 A;  2LUI A;  1TE0 A;  2VWR A;  3DJA A;  1Y8T A;  2CSS A;  3STJ A;  3RL7 A;  4WYT A;  4KFV A;  2EDV A;  2IWQ A;  1TQ3 A;  2V1W A;  2PKT A;  2E7K A;  4JOJ A;  2HE2 A;  2EGN A;  2JRE A;  1N6F A;  3HPM A;  5HF4 A;  3DIW A;  4E34 A;  4OEP A;  2KAW A;  4NMS A;  2R3Y A;  2LOB A;  2OS6 A;  2JIL A;  3WKL A;  4E3B A;  1TP5 A;  2KPL A;  4Z8J A;  1WF8 A;  2DLU A;  2FNE A;  2PA1 A;  3PS4 A;  2H3L A;  2ENO A;  1G9O A;  5F67 A;  4JL7 A;  3DOR A;  4REY A;  2Q9V A;  2W7R A;  2M3M A;  3CBZ A;  1QLC A;  4NMR A;  2AWW A;  1L6O A;  1I92 A;  2GZV A;  2MHO A;  1I16 A;  2KOM A;  2MX6 A;  5E1Y A;  1Z87 A;  1VA8 A;  2KOJ A;  5DTH A;  3RLE A;  1X6D A;  5D13 A;  2QKU A;  5A2P A;  3PV2 A;  1W9O A;  5HEB A;  4NMO A;  2EAQ A;  3CH8 A;  1Q3P A;  2VZ5 A;  3GDU A;  2PZD A;  3DJ3 A;  4H11 A;  3JXT A;  3K1R A;  3LNY A;  3NFK A;  4Q2P A;  2CSJ A;  5E6P B;  2Q3G A;  2KJD A;  2W4F A;  2DM8 A;  3R69 A;  3I1E A;  1D5G A;  5FB8 C;  2EEH A;  2DLS A;  3CBX A;  1X45 A;  4JOR A;  5E11 A;  1MFG A;  1X5N A;  3EGH C;  5HFF A;  2JIK A;  2QT5 A;  1P1E A;  2FN5 A;  1WHD A;  2KL1 A;  2DMZ A;  4YDP A;  1OBY A;  2F0A A;  5GLJ A;  2EDZ A;  2QBW A;  2LC6 A;  3R0H A;  3K50 A;  2P3W A;  1U3B A;  1ZUB A;  3GGE A;  4K76 A;  2ZPL A;  1N7E A;  1RGW A;  3QGL A;  2AWU A;  2D92 A;  2WL7 A;  2YT7 A;  4NXR A;  2OZF A;  1N6D A;  1X8S A;  4JOG A;  2O2T A;  1U38 A;  3MH7 A;  4WYU A;  3SUZ A;  2I6V A;  1OBZ A;  2KPK A;  4JOF A;  3KHF A;  2LA8 A;  2FE5 A;  1ZOK A;  2K1Z A;  1QAV A;  1BFE A;  3QO6 A;  3VQG A;  1GQ5 A;  1FC6 A;  5HFE A;  3NGH A;  5HET A;  1UEP A;  3RL8 A;  3QDO A;  2G5M B;  3GCN A;  2I0I A;  2QKV A;  5E21 A;  5HJ1 A;  2D8I A;  5G1E A;  2L97 A;  3MH4 A;  2UZC A;  1WIF A;  2IWN A;  2KA9 A;  2KYL A;  1IU2 A;  2D90 A;  5HEY A;  5E22 A;  1RZX A;  2OGP A;  5EZ0 A;  1MFL A;  4GHN A;  1K32 A;  3K82 A;  2Z9I A;  1UHP A;  4E35 A;  1VCW A;  3CS0 A;  3BPU A;  4NMV A;  1WFV A;  2VSP A;  1SOT A;  3I4W A;  5H3J A;  3CC0 A;  4Q2O A;  1R6J A;  4L8N A;  2OPG A;  2OQS A;  1UFX A;  1P1D A;  1N7T A;  5G1D A;  3AXA A;  4AMH A;  4K78 A;  4NMQ A;  2EHR A;  3OU0 A;  2H2B A;  5EYZ A;  2RCZ A;  1M5Z A;  2M0U A;  4JOH A;  1YBO A;  2RRM A;  1B8Q A;  1UM1 A;  4PQW A;  2I04 A;  2OSG A;  4NNM A;  1Y7N A;  4Z33 A;  3CYY A;  3GCO A;  1X5Q A;  1KEF A;  3QIK A;  1UM7 A;  2DKR A;  3GSL A;  2YUY A;  5FHT A;  4K6Y A;  1LCY A;  2EGO A;  1WF7 A;  5HFD A;  4Q2Q A;  2PKU A;  4NXQ A;  1UEQ A;  2YUB A;  2PNT A;  3PDV A;  1Q3O A;  4NNL A;  1GQ4 A;  2QKT A;  5HF1 A;  1UIT A;  4UU6 A;  4P0C A;  2CS5 A;  3SHW A;  2DJT A;  4JOE A;  3I18 A;  3GDS A;  3NFL A;  5HDY A;  1FCF A;  4G69 A;  2IWO A;  4YYX A;  1VB7 A;  4XHV A;  4OEO A;  2Z17 A;  1V5Q A;  1GM1 A;  3GJ9 A;  5I7Z A;  3HVQ C;  1T2M A;  2DC2 A;  2VPH A;  1MC7 A;  2EDP A;  5HFB A;  3WKM A;  1V62 A;  4UU5 A;  4HOP A;  2I4S A;  3E17 A;  2AWX A;  1WJL A;  4IC6 A;  3R68 A;  2JWE A;  3TSW A;  2EEJ A;  4EDJ A;  4NMT A;  1RY4 A;  4P2A B;  2EEI A;  1U37 A;  2EJY A;  2ZPM A;  4HOP B;  3PV4 A;  2KJP A;  5HED A;  4O06 A;  3O5N A;  4K75 A;  1NF3 C;  3SHU A;  1V1T A;  1UF1 A;  1WHA A;  3OTP A;  4GVD A;  3QE1 A;  1QAV B;  3SFJ A;  2HE4 A;  2H3M A;  3ID3 A;  2DAZ A;  2KV8 A;  2F5Y A;  5B6L A;  2OMJ A;  3HPK A;  1QAU A;  3GDV A; 
#chains in the Genus database with same CATH topology
 2GEF A;  2KG2 A;  2REY A;  3PV5 A;  4Q6S A;  2X7Z A;  4F8K A;  4LMM A;  2EXG A;  1KY9 A;  2OCS A;  3ID4 A;  1W9Q A;  1WH1 A;  2JXO A;  1BE9 A;  1X5R A;  1V5L A;  3KZE A;  2K20 A;  1IHJ A;  3PDZ A;  1UJV A;  1UJD A;  4Q6H A;  1FC7 A;  2KOH A;  2KRG A;  1VAE A;  3FY5 A;  2FCF A;  4JOK A;  2DB5 A;  2M0V A;  1Q7X A;  3ID2 A;  4N6X A;  2JIN A;  4JJ3 A;  2KBS A;  2QG1 A;  1NTE A;  1SOZ A;  3ID1 A;  5HFC A;  1FC9 A;  4RI0 A;  3TMH A;  3SOE A;  3DJ1 A;  2AIN A;  2H2C A;  2VRF A;  4GVC A;  3VQF A;  5GND A;  1WG6 A;  2YTW A;  2R4H A;  1XZ9 A;  2KQF A;  3QJN A;  4R2Z A;  1N6E A;  1V6B A;  4Q3H A;  5F3X A;  3B76 A;  2G2L A;  4OAJ A;  1Z86 A;  2I0L A;  1OZI A;  2L4S A;  1PDR A;  1UEZ A;  2LC7 A;  2M0T A;  4MPA A;  2EV8 A;  4KFW A;  3CBY A;  3L4F D;  2V90 A;  1U39 A;  2HGA A;  3MH6 A;  1WI4 A;  4K72 A;  1WFG A;  2L4T A;  2YT8 A;  1VJ6 A;  2KJK A;  2EGK A;  3QJM A;  4NXP A;  1TP3 A;  1W9E A;  4NMP A;  1N7F A;  2JOA A;  2BYG A;  1IU0 A;  1UEW A;  1RGR A;  2IWP A;  1UJU A;  2EEG A;  1KWA A;  2I1N A;  2VSV A;  4FGM A;  5JXB A;  1WI2 A;  3KZD A;  3TSZ A;  3LNX A;  2M10 A;  3TSV A;  5IL9 A;  4Q2N A;  4JOP A;  1N99 A;  3EGG C;  3ZRT A;  2PDZ A;  2M0Z A;  1OBX A;  3O46 A;  2LUI A;  1TE0 A;  2VWR A;  3DJA A;  1Y8T A;  2CSS A;  3STJ A;  3RL7 A;  4WYT A;  4KFV A;  2EDV A;  2IWQ A;  1TQ3 A;  2V1W A;  2PKT A;  2E7K A;  4JOJ A;  2HE2 A;  2EGN A;  2JRE A;  1N6F A;  3HPM A;  5HF4 A;  3DIW A;  4E34 A;  4OEP A;  2KAW A;  4NMS A;  2R3Y A;  2LOB A;  2OS6 A;  2JIL A;  3WKL A;  4E3B A;  1TP5 A;  2KPL A;  4Z8J A;  1WF8 A;  2DLU A;  2FNE A;  2PA1 A;  3PS4 A;  2H3L A;  2ENO A;  1G9O A;  5F67 A;  4JL7 A;  3DOR A;  4REY A;  2Q9V A;  2W7R A;  3GAB A;  2M3M A;  3CBZ A;  1QLC A;  4NMR A;  2AWW A;  1L6O A;  1I92 A;  2GZV A;  2MHO A;  1I16 A;  2KOM A;  2MX6 A;  5E1Y A;  1Z87 A;  1VA8 A;  3KDK A;  2KOJ A;  5DTH A;  3RLE A;  1X6D A;  5D13 A;  2QKU A;  5A2P A;  3PV2 A;  1W9O A;  5HEB A;  4NMO A;  2EAQ A;  3CH8 A;  1Q3P A;  2VZ5 A;  3GDU A;  2PZD A;  3DJ3 A;  4H11 A;  3JXT A;  3K1R A;  3LNY A;  3NFK A;  4Q2P A;  2JSN A;  2CSJ A;  5E6P B;  2Q3G A;  2KJD A;  2W4F A;  2DM8 A;  3R69 A;  3I1E A;  1D5G A;  5FB8 C;  2EEH A;  2DLS A;  3CBX A;  1X45 A;  4JOR A;  5E11 A;  1MFG A;  1X5N A;  3EGH C;  5HFF A;  2JIK A;  2QT5 A;  1P1E A;  2FN5 A;  1WHD A;  2KL1 A;  2DMZ A;  4YDP A;  1OBY A;  2F0A A;  5GLJ A;  2EDZ A;  2QBW A;  2LC6 A;  3R0H A;  3K50 A;  2P3W A;  4JJ0 A;  1U3B A;  1ZUB A;  3GGE A;  4K76 A;  2ZPL A;  1N7E A;  1RGW A;  3QGL A;  2AWU A;  2D92 A;  2WL7 A;  2YT7 A;  4NXR A;  2OZF A;  1N6D A;  1X8S A;  4JOG A;  2O2T A;  1U38 A;  3MH7 A;  4WYU A;  3SUZ A;  2I6V A;  1OBZ A;  2KPK A;  4JOF A;  3KHF A;  2LA8 A;  2FE5 A;  1ZOK A;  2K1Z A;  1QAV A;  1BFE A;  3QO6 A;  3VQG A;  1GQ5 A;  1FC6 A;  5HFE A;  3NGH A;  5HET A;  1UEP A;  5ILB A;  3RL8 A;  3QDO A;  2G5M B;  3GCN A;  2I0I A;  2QKV A;  5E21 A;  5HJ1 A;  2D8I A;  5G1E A;  2L97 A;  3MH4 A;  2UZC A;  1WIF A;  2IWN A;  2KA9 A;  2KYL A;  1IU2 A;  2D90 A;  5HEY A;  5E22 A;  1RZX A;  2OGP A;  5EZ0 A;  1MFL A;  4GHN A;  1K32 A;  3K82 A;  2Z9I A;  1UHP A;  4E35 A;  1VCW A;  3CS0 A;  3BPU A;  4NMV A;  1WFV A;  2VSP A;  1SOT A;  3I4W A;  5H3J A;  3CC0 A;  4Q2O A;  1R6J A;  4L8N A;  2OPG A;  2OQS A;  1UFX A;  1P1D A;  1N7T A;  5G1D A;  3AXA A;  4AMH A;  4K78 A;  4NMQ A;  2EHR A;  3OU0 A;  2H2B A;  5EYZ A;  2RCZ A;  1M5Z A;  2M0U A;  4JOH A;  1YBO A;  2RRM A;  1B8Q A;  1UM1 A;  4PQW A;  2I04 A;  2OSG A;  4NNM A;  1Y7N A;  4Z33 A;  3CYY A;  3GCO A;  1X5Q A;  1KEF A;  3QIK A;  1UM7 A;  2DKR A;  3GSL A;  2YUY A;  5FHT A;  4K6Y A;  1LCY A;  2EGO A;  1X9Z A;  1WF7 A;  5HFD A;  4Q2Q A;  2PKU A;  4NXQ A;  1UEQ A;  2YUB A;  2PNT A;  3PDV A;  1Q3O A;  4NNL A;  1GQ4 A;  2QKT A;  5HF1 A;  1UIT A;  4UU6 A;  4P0C A;  2CS5 A;  3SHW A;  2DJT A;  4JOE A;  3I18 A;  3KDG A;  3GDS A;  3NFL A;  5HDY A;  1FCF A;  4G69 A;  2IWO A;  4YYX A;  1VB7 A;  4XHV A;  4OEO A;  2Z17 A;  1V5Q A;  1GM1 A;  3GJ9 A;  5I7Z A;  4FLN A;  3HVQ C;  1T2M A;  3NCV A;  2DC2 A;  2VPH A;  1MC7 A;  2EDP A;  5HFB A;  3WKM A;  1V62 A;  4UU5 A;  4HOP A;  2I4S A;  3E17 A;  2AWX A;  1WJL A;  4IC6 A;  3R68 A;  2JWE A;  3TSW A;  2EEJ A;  4EDJ A;  4NMT A;  1RY4 A;  4P2A B;  2EEI A;  1U37 A;  2EJY A;  5B42 A;  2ZPM A;  4HOP B;  3PV4 A;  2KJP A;  5HED A;  4O06 A;  3O5N A;  4K75 A;  1NF3 C;  3SHU A;  1V1T A;  1UF1 A;  1WHA A;  3OTP A;  4GVD A;  3QE1 A;  1QAV B;  3SFJ A;  2HE4 A;  2H3M A;  3ID3 A;  2DAZ A;  2KV8 A;  2F5Y A;  5B6L A;  2OMJ A;  3HPK A;  1QAU A;  3GDV A; 
#chains in the Genus database with same CATH homology
 2GEF A;  2KG2 A;  2REY A;  3PV5 A;  4Q6S A;  2X7Z A;  4F8K A;  4LMM A;  2EXG A;  1KY9 A;  2OCS A;  3ID4 A;  1W9Q A;  1WH1 A;  2JXO A;  1BE9 A;  1X5R A;  1V5L A;  3KZE A;  2K20 A;  1IHJ A;  3PDZ A;  1UJV A;  1UJD A;  4Q6H A;  1FC7 A;  2KOH A;  2KRG A;  1VAE A;  3FY5 A;  2FCF A;  4JOK A;  2DB5 A;  2M0V A;  1Q7X A;  3ID2 A;  4N6X A;  2JIN A;  4JJ3 A;  2KBS A;  2QG1 A;  1NTE A;  1SOZ A;  3ID1 A;  5HFC A;  1FC9 A;  4RI0 A;  3TMH A;  3SOE A;  3DJ1 A;  2AIN A;  2H2C A;  2VRF A;  4GVC A;  3VQF A;  5GND A;  1WG6 A;  2YTW A;  2R4H A;  1XZ9 A;  2KQF A;  3QJN A;  4R2Z A;  1N6E A;  1V6B A;  4Q3H A;  5F3X A;  3B76 A;  2G2L A;  4OAJ A;  1Z86 A;  2I0L A;  1OZI A;  2L4S A;  1PDR A;  1UEZ A;  2LC7 A;  2M0T A;  4MPA A;  2EV8 A;  4KFW A;  3CBY A;  3L4F D;  2V90 A;  1U39 A;  2HGA A;  3MH6 A;  1WI4 A;  4K72 A;  1WFG A;  2L4T A;  2YT8 A;  1VJ6 A;  2KJK A;  2EGK A;  3QJM A;  4NXP A;  1TP3 A;  1W9E A;  4NMP A;  1N7F A;  2JOA A;  2BYG A;  1IU0 A;  1UEW A;  1RGR A;  2IWP A;  1UJU A;  2EEG A;  1KWA A;  2I1N A;  2VSV A;  4FGM A;  5JXB A;  1WI2 A;  3KZD A;  3TSZ A;  3LNX A;  2M10 A;  3TSV A;  5IL9 A;  4Q2N A;  4JOP A;  1N99 A;  3EGG C;  3ZRT A;  2PDZ A;  2M0Z A;  1OBX A;  3O46 A;  2LUI A;  1TE0 A;  2VWR A;  3DJA A;  1Y8T A;  2CSS A;  3STJ A;  3RL7 A;  4WYT A;  4KFV A;  2EDV A;  2IWQ A;  1TQ3 A;  2V1W A;  2PKT A;  2E7K A;  4JOJ A;  2HE2 A;  2EGN A;  2JRE A;  1N6F A;  3HPM A;  5HF4 A;  3DIW A;  4E34 A;  4OEP A;  2KAW A;  4NMS A;  2R3Y A;  2LOB A;  2OS6 A;  2JIL A;  3WKL A;  4E3B A;  1TP5 A;  2KPL A;  4Z8J A;  1WF8 A;  2DLU A;  2FNE A;  2PA1 A;  3PS4 A;  2H3L A;  2ENO A;  1G9O A;  5F67 A;  4JL7 A;  3DOR A;  4REY A;  2Q9V A;  2W7R A;  3GAB A;  2M3M A;  3CBZ A;  1QLC A;  4NMR A;  2AWW A;  1L6O A;  1I92 A;  2GZV A;  2MHO A;  1I16 A;  2KOM A;  2MX6 A;  5E1Y A;  1Z87 A;  1VA8 A;  3KDK A;  2KOJ A;  5DTH A;  3RLE A;  1X6D A;  5D13 A;  2QKU A;  5A2P A;  3PV2 A;  1W9O A;  5HEB A;  4NMO A;  2EAQ A;  3CH8 A;  1Q3P A;  2VZ5 A;  3GDU A;  2PZD A;  3DJ3 A;  4H11 A;  3JXT A;  3K1R A;  3LNY A;  3NFK A;  4Q2P A;  2JSN A;  2CSJ A;  5E6P B;  2Q3G A;  2KJD A;  2W4F A;  2DM8 A;  3R69 A;  3I1E A;  1D5G A;  5FB8 C;  2EEH A;  2DLS A;  3CBX A;  1X45 A;  4JOR A;  5E11 A;  1MFG A;  1X5N A;  3EGH C;  5HFF A;  2JIK A;  2QT5 A;  1P1E A;  2FN5 A;  1WHD A;  2KL1 A;  2DMZ A;  4YDP A;  1OBY A;  2F0A A;  5GLJ A;  2EDZ A;  2QBW A;  2LC6 A;  3R0H A;  3K50 A;  2P3W A;  4JJ0 A;  1U3B A;  1ZUB A;  3GGE A;  4K76 A;  2ZPL A;  1N7E A;  1RGW A;  3QGL A;  2AWU A;  2D92 A;  2WL7 A;  2YT7 A;  4NXR A;  2OZF A;  1N6D A;  1X8S A;  4JOG A;  2O2T A;  1U38 A;  3MH7 A;  4WYU A;  3SUZ A;  2I6V A;  1OBZ A;  2KPK A;  4JOF A;  3KHF A;  2LA8 A;  2FE5 A;  1ZOK A;  2K1Z A;  1QAV A;  1BFE A;  3QO6 A;  3VQG A;  1GQ5 A;  1FC6 A;  5HFE A;  3NGH A;  5HET A;  1UEP A;  5ILB A;  3RL8 A;  3QDO A;  2G5M B;  3GCN A;  2I0I A;  2QKV A;  5E21 A;  5HJ1 A;  2D8I A;  5G1E A;  2L97 A;  3MH4 A;  2UZC A;  1WIF A;  2IWN A;  2KA9 A;  2KYL A;  1IU2 A;  2D90 A;  5HEY A;  5E22 A;  1RZX A;  2OGP A;  5EZ0 A;  1MFL A;  4GHN A;  1K32 A;  3K82 A;  2Z9I A;  1UHP A;  4E35 A;  1VCW A;  3CS0 A;  3BPU A;  4NMV A;  1WFV A;  2VSP A;  1SOT A;  3I4W A;  5H3J A;  3CC0 A;  4Q2O A;  1R6J A;  4L8N A;  2OPG A;  2OQS A;  1UFX A;  1P1D A;  1N7T A;  5G1D A;  3AXA A;  4AMH A;  4K78 A;  4NMQ A;  2EHR A;  3OU0 A;  2H2B A;  5EYZ A;  2RCZ A;  1M5Z A;  2M0U A;  4JOH A;  1YBO A;  2RRM A;  1B8Q A;  1UM1 A;  4PQW A;  2I04 A;  2OSG A;  4NNM A;  1Y7N A;  4Z33 A;  3CYY A;  3GCO A;  1X5Q A;  1KEF A;  3QIK A;  1UM7 A;  2DKR A;  3GSL A;  2YUY A;  5FHT A;  4K6Y A;  1LCY A;  2EGO A;  1X9Z A;  1WF7 A;  5HFD A;  4Q2Q A;  2PKU A;  4NXQ A;  1UEQ A;  2YUB A;  2PNT A;  3PDV A;  1Q3O A;  4NNL A;  1GQ4 A;  2QKT A;  5HF1 A;  1UIT A;  4UU6 A;  4P0C A;  2CS5 A;  3SHW A;  2DJT A;  4JOE A;  3I18 A;  3KDG A;  3GDS A;  3NFL A;  5HDY A;  1FCF A;  4G69 A;  2IWO A;  4YYX A;  1VB7 A;  4XHV A;  4OEO A;  2Z17 A;  1V5Q A;  1GM1 A;  3GJ9 A;  5I7Z A;  4FLN A;  3HVQ C;  1T2M A;  3NCV A;  2DC2 A;  2VPH A;  1MC7 A;  2EDP A;  5HFB A;  3WKM A;  1V62 A;  4UU5 A;  4HOP A;  2I4S A;  3E17 A;  2AWX A;  1WJL A;  4IC6 A;  3R68 A;  2JWE A;  3TSW A;  2EEJ A;  4EDJ A;  4NMT A;  1RY4 A;  4P2A B;  2EEI A;  1U37 A;  2EJY A;  5B42 A;  2ZPM A;  4HOP B;  3PV4 A;  2KJP A;  5HED A;  4O06 A;  3O5N A;  4K75 A;  1NF3 C;  3SHU A;  1V1T A;  1UF1 A;  1WHA A;  3OTP A;  4GVD A;  3QE1 A;  1QAV B;  3SFJ A;  2HE4 A;  2H3M A;  3ID3 A;  2DAZ A;  2KV8 A;  2F5Y A;  5B6L A;  2OMJ A;  3HPK A;  1QAU A;  3GDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...