2AINA

Solution structure of the af-6 pdz domain complexed with the c-terminal peptide from the bcr protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
b'MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Afadin
publication title Solution structure and backbone dynamics of the AF-6 PDZ domain/Bcr peptide complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/transferase
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2ainA00
1Q3PA 2EGKA 3QJMA 4LMMA 2G5MB 2RRMA 1V62A 1TQ3A 2K1ZA 2EV8A 2I1NA 3CC0A 1FC7A 4NXQA 2OPGA 5FHTA 1P1DA 2I6VA 5H3JA 1WI4A 2PKTA 1N6EA 2X7ZA 2HE2A 1UM1A 2EXGA 4GVCA 1Y8TA 4YDPA 3DJ1A 4H11A 2GZVA 4WYTA 2KBSA 2YUBA 3QJNA 4KFWA 2JOAA 4F8KA 3GGEA 2AWUA 2DKRA 3GDVA 3JXTA 2KPLA 3DORA 2KOMA 2OGPA 1N7FA 2EEJA 5I7ZA 3TSZA 2PKUA 1U37A 3QIKA 2QG1A 1UEQA 1X6DA 2JINA 5FB8C 1N7EA 2EAQA 2CSSA 2LC6A 4Q2OA 1Q3OA 1U39A 2DB5A 2Z17A 2EDPA 3FY5A 2I0IA 1TE0A 1OBZA 2I04A 3SFJA 2EDZA 4GVDA 3MH7A 5EZ0A 2QKVA 3TSWA 2ZPLA 3MH4A 2OCSA 4NMTA 5HEDA 5HEBA 2V90A 1V5LA 4OEPA 3CS0A 2D90A 3RL7A 5E6PB 2YT8A 2KJPA 2DAZA 4Q2PA 2HGAA 1W9QA 2EEHA 2H3MA 2BYGA 3SHWA 2IWNA 1OZIA 4Q6HA 4JORA 2WL7A 1ZOKA 1R6JA 3R69A 1FC9A 1RGRA 2LC7A 2QT5A 3PV2A 1UJDA 1M5ZA 1PDRA 3PDZA 2EDVA 1D5GA 3KZDA 2KA9A 2DJTA 2L97A 2G2LA 2AWXA 2DMZA 3MH6A 2RCZA 1QAVB 3VQGA 3SUZA 2KRGA 1VJ6A 2REYA 1G9OA 1GQ5A 2M0TA 2JXOA 3GCOA 4JOFA 5HFBA 1VAEA 1VA8A 1P1EA 2KJKA 4N6XA 2PZDA 2IWQA 5HFCA 2EGOA 3LNXA 3E17A 3QE1A 4JOGA 1UM7A 2KPKA 4PQWA 5HDYA 4JOPA 1WHAA 4Z33A 1KEFA 2M0VA 3EGGC 2DM8A 3TSVA 2EEGA 3NFLA 3ID2A 5GLJA 2W4FA 1WF8A 2PNTA 2QKUA 1V5QA 5D13A 3SOEA 2EJYA 5HF4A 3ID3A 5HFFA 2L4TA 1TP3A 3AXAA 3CYYA 2OQSA 1NTEA 2OMJA 4UU5A 3I4WA 4KFVA 2M10A 2M0ZA 4G69A 2EHRA 5HETA 3GSLA 2KJDA 4O06A 1ZUBA 2V1WA 2K20A 3QDOA 2FCFA 5F67A 2D8IA 1GM1A 3NGHA 1B8QA 4OEOA 1IU0A 1MFGA 3DJAA 1KY9A 3PV4A 4IC6A 2Q9VA 2EEIA 2Z9IA 5E1YA 1FC6A 2OS6A 5B6LA 1X5RA 1WI2A 5GNDA 1X8SA 3R0HA 3ZRTA 2VRFA 5EYZA 2AWWA 2DC2A 2F0AA 5HFDA 1RGWA 3GDUA 5F3XA 4NNLA 1W9OA 4K78A 1UEPA 3O5NA 1WHDA 2IWOA 3PDVA 2LOBA 1MFLA 3GCNA 1X5NA 1X45A 2IWPA 2JWEA 4NXPA 1UJUA 1BFEA 3VQFA 3BPUA 1Z87A 4JOHA 2M0UA 3K82A 1UITA 1WFGA 2OSGA 3SHUA 4HOPA 4JL7A 4AMHA 2HE4A 3STJA 4JOJA 3R68A 1T2MA 1GQ4A 4K72A 2O2TA 4NXRA 2R4HA 2ZPMA 1UJVA 4JOKA 4E35A 5E11A 1TP5A 1YBOA 3KHFA 2W7RA 5HEYA 3EGHC 3L4FD 4JOEA 2MX6A 5HF1A 1QAUA 2KG2A 2KYLA 1SOZA 1V6BA 3B76A 2UZCA 5G1DA 2H2BA 2CS5A 4GHNA 2FNEA 4NNMA 2KAWA 3WKLA 2VZ5A 2LUIA 2YUYA 1Y7NA 4EDJA 5E21A 1I92A 4MPAA 3KZEA 4K76A 4HOPB 1XZ9A 5DTHA 2R3YA 1OBYA 1UEWA 4P0CA 1WIFA 4UU6A 4R2ZA 2YT7A 1OBXA 4E3BA 3ID4A 1MC7A 3TMHA 4Q2NA 2KL1A 2E7KA 3HVQC 2FN5A 4NMVA 1IHJA 1Z86A 1WF7A 1IU2A 2YTWA 1I16A 3OTPA 4Q3HA 4NMPA 3DJ3A 1VCWA 1LCYA 1WFVA 5HJ1A 3PS4A 4RI0A 3CBXA 2VWRA 3GJ9A 1N7TA 3I1EA 4NMRA 5E22A 2D92A 3K50A 3HPMA 2L4SA 3CBYA 2H2CA 2CSJA 1UEZA 1RZXA 2P3WA 3K1RA 4NMOA 1FCFA 4P2AB 1SOTA 3WKMA 1UF1A 1U3BA 4Q6SA 1U38A 5G1EA 2VSVA 1KWAA 2JIKA 2LA8A 3CH8A 3HPKA 2DLUA 2KOJA 4FGMA 2OZFA 1N6DA 3LNYA 3PV5A 4K6YA 5HFEA 4REYA 3RL8A 3I18A 2Q3GA 1UHPA 1Q7XA 3RLEA 4Z8JA 2FE5A 1VB7A 1K32A 2M3MA 3OU0A 2KQFA 3QO6A 2JILA 2EGNA 3O46A 2KV8A 1NF3C 3DIWA 4OAJA 1V1TA 1QAVA 3ID1A 1UFXA 3NFKA 2I0LA 3QGLA 2MHOA 2I4SA 3CBZA 1QLCA 4XHVA 2QBWA 1X5QA 2VSPA 1WG6A 4NMQA 2KOHA 1BE9A 1N99A 4E34A 1WH1A 4K75A 1W9EA 2PA1A 2PDZA 4WYUA 2JREA 2QKTA 2DLSA 2F5YA 1L6OA 2AINA 5A2PA 1WJLA 3GDSA 4L8NA 1N6FA 2H3LA 5JXBA 2ENOA 4YYXA 4Q2QA 2VPHA 4NMSA 1RY4A
chains in the Genus database with same CATH superfamily
4FLNA 1Q3PA 2EGKA 3QJMA 4LMMA 2G5MB 2RRMA 1V62A 1TQ3A 2K1ZA 2EV8A 2I1NA 3CC0A 1FC7A 4NXQA 2OPGA 5FHTA 1P1DA 2I6VA 5H3JA 1WI4A 2PKTA 1N6EA 2X7ZA 2HE2A 1UM1A 2EXGA 4GVCA 1Y8TA 4YDPA 3DJ1A 4H11A 2GZVA 4WYTA 2KBSA 2YUBA 3QJNA 4KFWA 2JOAA 4F8KA 3GGEA 2AWUA 2DKRA 3GDVA 3JXTA 2KPLA 3DORA 2KOMA 2OGPA 1N7FA 2EEJA 5I7ZA 3TSZA 2PKUA 1U37A 3QIKA 2QG1A 1UEQA 1X6DA 2JINA 5FB8C 1N7EA 2EAQA 2CSSA 2LC6A 4Q2OA 1Q3OA 1U39A 2DB5A 2Z17A 2EDPA 3FY5A 2I0IA 1TE0A 1OBZA 2I04A 3SFJA 2EDZA 4GVDA 3MH7A 5EZ0A 2QKVA 3TSWA 2ZPLA 3MH4A 2OCSA 4NMTA 5HEDA 5HEBA 2V90A 1V5LA 4OEPA 3CS0A 2D90A 3RL7A 5E6PB 5B42A 2YT8A 2KJPA 2DAZA 4JJ3A 4Q2PA 2HGAA 3KDGA 1W9QA 2EEHA 2H3MA 2BYGA 3KDKA 3SHWA 2IWNA 1OZIA 4Q6HA 4JORA 2WL7A 1ZOKA 1R6JA 3R69A 1FC9A 1RGRA 2LC7A 2QT5A 3PV2A 1UJDA 1M5ZA 1PDRA 3PDZA 2EDVA 1D5GA 3KZDA 2KA9A 2DJTA 2L97A 2G2LA 2AWXA 2DMZA 3MH6A 2RCZA 1QAVB 3VQGA 3SUZA 2KRGA 1VJ6A 2REYA 1G9OA 1GQ5A 2M0TA 2JXOA 3GCOA 4JOFA 5HFBA 1VAEA 1VA8A 1P1EA 2KJKA 4N6XA 2PZDA 2IWQA 5HFCA 2EGOA 3LNXA 3E17A 3QE1A 4JOGA 1UM7A 2KPKA 4PQWA 5HDYA 4JOPA 1WHAA 4Z33A 1KEFA 2M0VA 3EGGC 2DM8A 3TSVA 2EEGA 3NFLA 3ID2A 5GLJA 2W4FA 4JJ0A 1WF8A 2PNTA 2QKUA 1V5QA 5D13A 3SOEA 2EJYA 5HF4A 3ID3A 5HFFA 2L4TA 1TP3A 3AXAA 3CYYA 2OQSA 1NTEA 2OMJA 4UU5A 3I4WA 4KFVA 2M10A 2M0ZA 4G69A 2EHRA 5HETA 3GSLA 2KJDA 4O06A 1ZUBA 2V1WA 2K20A 3QDOA 2FCFA 5F67A 2D8IA 1GM1A 3NGHA 1B8QA 4OEOA 1IU0A 1MFGA 3DJAA 1KY9A 3PV4A 4IC6A 2Q9VA 2EEIA 2Z9IA 5E1YA 1FC6A 2OS6A 5B6LA 1X5RA 1WI2A 5GNDA 1X8SA 3R0HA 3ZRTA 2VRFA 5EYZA 2AWWA 2DC2A 2F0AA 5HFDA 1RGWA 3GDUA 5F3XA 4NNLA 1W9OA 4K78A 1UEPA 3O5NA 1WHDA 2IWOA 3PDVA 2LOBA 1MFLA 3GCNA 1X5NA 1X45A 2IWPA 2JWEA 4NXPA 1UJUA 1BFEA 3VQFA 3BPUA 1Z87A 4JOHA 2M0UA 3K82A 1UITA 1WFGA 2OSGA 3SHUA 4HOPA 4JL7A 4AMHA 2HE4A 3STJA 4JOJA 3R68A 3NCVA 1T2MA 1GQ4A 4K72A 2O2TA 4NXRA 2R4HA 2ZPMA 1UJVA 4JOKA 4E35A 5E11A 1TP5A 1YBOA 3KHFA 2W7RA 5HEYA 3EGHC 3L4FD 4JOEA 2MX6A 5HF1A 1QAUA 2KG2A 3GABA 2KYLA 1SOZA 1V6BA 3B76A 2UZCA 5ILBA 5G1DA 2H2BA 2CS5A 4GHNA 2FNEA 4NNMA 2KAWA 3WKLA 2VZ5A 2LUIA 2YUYA 1Y7NA 4EDJA 5E21A 1I92A 4MPAA 3KZEA 4K76A 4HOPB 1XZ9A 5DTHA 2R3YA 1OBYA 1UEWA 4P0CA 1WIFA 4UU6A 1X9ZA 4R2ZA 2YT7A 1OBXA 4E3BA 2JSNA 3ID4A 1MC7A 3TMHA 4Q2NA 2KL1A 2E7KA 3HVQC 2FN5A 4NMVA 1IHJA 1Z86A 1WF7A 1IU2A 2YTWA 1I16A 3OTPA 4Q3HA 4NMPA 3DJ3A 1VCWA 1LCYA 1WFVA 5HJ1A 3PS4A 4RI0A 3CBXA 2VWRA 3GJ9A 1N7TA 3I1EA 4NMRA 5E22A 2D92A 3K50A 3HPMA 2L4SA 3CBYA 2H2CA 2CSJA 1UEZA 1RZXA 2P3WA 3K1RA 4NMOA 1FCFA 4P2AB 1SOTA 3WKMA 1UF1A 1U3BA 4Q6SA 1U38A 5G1EA 2VSVA 1KWAA 2JIKA 2LA8A 3CH8A 3HPKA 2DLUA 2KOJA 4FGMA 2OZFA 1N6DA 3LNYA 3PV5A 4K6YA 5HFEA 4REYA 3RL8A 3I18A 2Q3GA 1UHPA 1Q7XA 3RLEA 4Z8JA 2FE5A 1VB7A 5IL9A 1K32A 2GEFA 2M3MA 3OU0A 2KQFA 3QO6A 2JILA 2EGNA 3O46A 2KV8A 1NF3C 3DIWA 4OAJA 1V1TA 1QAVA 3ID1A 1UFXA 3NFKA 2I0LA 3QGLA 2MHOA 2I4SA 3CBZA 1QLCA 4XHVA 2QBWA 1X5QA 2VSPA 1WG6A 4NMQA 2KOHA 1BE9A 1N99A 4E34A 1WH1A 4K75A 1W9EA 2PA1A 2PDZA 4WYUA 2JREA 2QKTA 2DLSA 2F5YA 1L6OA 2AINA 5A2PA 1WJLA 3GDSA 4L8NA 1N6FA 2H3LA 5JXBA 2ENOA 4YYXA 4Q2QA 2VPHA 4NMSA 1RY4A
chains in the Genus database with same CATH topology
4FLNA 1Q3PA 2EGKA 3QJMA 4LMMA 2G5MB 2RRMA 1V62A 1TQ3A 2K1ZA 2EV8A 2I1NA 3CC0A 1FC7A 4NXQA 2OPGA 5FHTA 1P1DA 2I6VA 5H3JA 1WI4A 2PKTA 1N6EA 2X7ZA 2HE2A 1UM1A 2EXGA 4GVCA 1Y8TA 4YDPA 3DJ1A 4H11A 2GZVA 4WYTA 2KBSA 2YUBA 3QJNA 4KFWA 2JOAA 4F8KA 3GGEA 2AWUA 2DKRA 3GDVA 3JXTA 2KPLA 3DORA 2KOMA 2OGPA 1N7FA 2EEJA 5I7ZA 3TSZA 2PKUA 1U37A 3QIKA 2QG1A 1UEQA 1X6DA 2JINA 5FB8C 1N7EA 2EAQA 2CSSA 2LC6A 4Q2OA 1Q3OA 1U39A 2DB5A 2Z17A 2EDPA 3FY5A 2I0IA 1TE0A 1OBZA 2I04A 3SFJA 2EDZA 4GVDA 3MH7A 5EZ0A 2QKVA 3TSWA 2ZPLA 3MH4A 2OCSA 4NMTA 5HEDA 5HEBA 2V90A 1V5LA 4OEPA 3CS0A 2D90A 3RL7A 5E6PB 5B42A 2YT8A 2KJPA 2DAZA 4JJ3A 4Q2PA 2HGAA 3KDGA 1W9QA 2EEHA 2H3MA 2BYGA 3KDKA 3SHWA 2IWNA 1OZIA 4Q6HA 4JORA 2WL7A 1ZOKA 1R6JA 3R69A 1FC9A 1RGRA 2LC7A 2QT5A 3PV2A 1UJDA 1M5ZA 1PDRA 3PDZA 2EDVA 1D5GA 3KZDA 2KA9A 2DJTA 2L97A 2G2LA 2AWXA 2DMZA 3MH6A 2RCZA 1QAVB 3VQGA 3SUZA 2KRGA 1VJ6A 2REYA 1G9OA 1GQ5A 2M0TA 2JXOA 3GCOA 4JOFA 5HFBA 1VAEA 1VA8A 1P1EA 2KJKA 4N6XA 2PZDA 2IWQA 5HFCA 2EGOA 3LNXA 3E17A 3QE1A 4JOGA 1UM7A 2KPKA 4PQWA 5HDYA 4JOPA 1WHAA 4Z33A 1KEFA 2M0VA 3EGGC 2DM8A 3TSVA 2EEGA 3NFLA 3ID2A 5GLJA 2W4FA 4JJ0A 1WF8A 2PNTA 2QKUA 1V5QA 5D13A 3SOEA 2EJYA 5HF4A 3ID3A 5HFFA 2L4TA 1TP3A 3AXAA 3CYYA 2OQSA 1NTEA 2OMJA 4UU5A 3I4WA 4KFVA 2M10A 2M0ZA 4G69A 2EHRA 5HETA 3GSLA 2KJDA 4O06A 1ZUBA 2V1WA 2K20A 3QDOA 2FCFA 5F67A 2D8IA 1GM1A 3NGHA 1B8QA 4OEOA 1IU0A 1MFGA 3DJAA 1KY9A 3PV4A 4IC6A 2Q9VA 2EEIA 2Z9IA 5E1YA 1FC6A 2OS6A 5B6LA 1X5RA 1WI2A 5GNDA 1X8SA 3R0HA 3ZRTA 2VRFA 5EYZA 2AWWA 2DC2A 2F0AA 5HFDA 1RGWA 3GDUA 5F3XA 4NNLA 1W9OA 4K78A 1UEPA 3O5NA 1WHDA 2IWOA 3PDVA 2LOBA 1MFLA 3GCNA 1X5NA 1X45A 2IWPA 2JWEA 4NXPA 1UJUA 1BFEA 3VQFA 3BPUA 1Z87A 4JOHA 2M0UA 3K82A 1UITA 1WFGA 2OSGA 3SHUA 4HOPA 4JL7A 4AMHA 2HE4A 3STJA 4JOJA 3R68A 3NCVA 1T2MA 1GQ4A 4K72A 2O2TA 4NXRA 2R4HA 2ZPMA 1UJVA 4JOKA 4E35A 5E11A 1TP5A 1YBOA 3KHFA 2W7RA 5HEYA 3EGHC 3L4FD 4JOEA 2MX6A 5HF1A 1QAUA 2KG2A 3GABA 2KYLA 1SOZA 1V6BA 3B76A 2UZCA 5ILBA 5G1DA 2H2BA 2CS5A 4GHNA 2FNEA 4NNMA 2KAWA 3WKLA 2VZ5A 2LUIA 2YUYA 1Y7NA 4EDJA 5E21A 1I92A 4MPAA 3KZEA 4K76A 4HOPB 1XZ9A 5DTHA 2R3YA 1OBYA 1UEWA 4P0CA 1WIFA 4UU6A 1X9ZA 4R2ZA 2YT7A 1OBXA 4E3BA 2JSNA 3ID4A 1MC7A 3TMHA 4Q2NA 2KL1A 2E7KA 3HVQC 2FN5A 4NMVA 1IHJA 1Z86A 1WF7A 1IU2A 2YTWA 1I16A 3OTPA 4Q3HA 4NMPA 3DJ3A 1VCWA 1LCYA 1WFVA 5HJ1A 3PS4A 4RI0A 3CBXA 2VWRA 3GJ9A 1N7TA 3I1EA 4NMRA 5E22A 2D92A 3K50A 3HPMA 2L4SA 3CBYA 2H2CA 2CSJA 1UEZA 1RZXA 2P3WA 3K1RA 4NMOA 1FCFA 4P2AB 1SOTA 3WKMA 1UF1A 1U3BA 4Q6SA 1U38A 5G1EA 2VSVA 1KWAA 2JIKA 2LA8A 3CH8A 3HPKA 2DLUA 2KOJA 4FGMA 2OZFA 1N6DA 3LNYA 3PV5A 4K6YA 5HFEA 4REYA 3RL8A 3I18A 2Q3GA 1UHPA 1Q7XA 3RLEA 4Z8JA 2FE5A 1VB7A 5IL9A 1K32A 2GEFA 2M3MA 3OU0A 2KQFA 3QO6A 2JILA 2EGNA 3O46A 2KV8A 1NF3C 3DIWA 4OAJA 1V1TA 1QAVA 3ID1A 1UFXA 3NFKA 2I0LA 3QGLA 2MHOA 2I4SA 3CBZA 1QLCA 4XHVA 2QBWA 1X5QA 2VSPA 1WG6A 4NMQA 2KOHA 1BE9A 1N99A 4E34A 1WH1A 4K75A 1W9EA 2PA1A 2PDZA 4WYUA 2JREA 2QKTA 2DLSA 2F5YA 1L6OA 2AINA 5A2PA 1WJLA 3GDSA 4L8NA 1N6FA 2H3LA 5JXBA 2ENOA 4YYXA 4Q2QA 2VPHA 4NMSA 1RY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3P A;  2EGK A;  3QJM A;  4LMM A;  2G5M B;  2RRM A;  1V62 A;  1TQ3 A;  2K1Z A;  2EV8 A;  2I1N A;  3CC0 A;  1FC7 A;  4NXQ A;  2OPG A;  5FHT A;  1P1D A;  2I6V A;  5H3J A;  1WI4 A;  2PKT A;  1N6E A;  2X7Z A;  2HE2 A;  1UM1 A;  2EXG A;  4GVC A;  1Y8T A;  4YDP A;  3DJ1 A;  4H11 A;  2GZV A;  4WYT A;  2KBS A;  2YUB A;  3QJN A;  4KFW A;  2JOA A;  4F8K A;  3GGE A;  2AWU A;  2DKR A;  3GDV A;  3JXT A;  2KPL A;  3DOR A;  2KOM A;  2OGP A;  1N7F A;  2EEJ A;  5I7Z A;  3TSZ A;  2PKU A;  1U37 A;  3QIK A;  2QG1 A;  1UEQ A;  1X6D A;  2JIN A;  5FB8 C;  1N7E A;  2EAQ A;  2CSS A;  2LC6 A;  4Q2O A;  1Q3O A;  1U39 A;  2DB5 A;  2Z17 A;  2EDP A;  3FY5 A;  2I0I A;  1TE0 A;  1OBZ A;  2I04 A;  3SFJ A;  2EDZ A;  4GVD A;  3MH7 A;  5EZ0 A;  2QKV A;  3TSW A;  2ZPL A;  3MH4 A;  2OCS A;  4NMT A;  5HED A;  5HEB A;  2V90 A;  1V5L A;  4OEP A;  3CS0 A;  2D90 A;  3RL7 A;  5E6P B;  2YT8 A;  2KJP A;  2DAZ A;  4Q2P A;  2HGA A;  1W9Q A;  2EEH A;  2H3M A;  2BYG A;  3SHW A;  2IWN A;  1OZI A;  4Q6H A;  4JOR A;  2WL7 A;  1ZOK A;  1R6J A;  3R69 A;  1FC9 A;  1RGR A;  2LC7 A;  2QT5 A;  3PV2 A;  1UJD A;  1M5Z A;  1PDR A;  3PDZ A;  2EDV A;  1D5G A;  3KZD A;  2KA9 A;  2DJT A;  2L97 A;  2G2L A;  2AWX A;  2DMZ A;  3MH6 A;  2RCZ A;  1QAV B;  3VQG A;  3SUZ A;  2KRG A;  1VJ6 A;  2REY A;  1G9O A;  1GQ5 A;  2M0T A;  2JXO A;  3GCO A;  4JOF A;  5HFB A;  1VAE A;  1VA8 A;  1P1E A;  2KJK A;  4N6X A;  2PZD A;  2IWQ A;  5HFC A;  2EGO A;  3LNX A;  3E17 A;  3QE1 A;  4JOG A;  1UM7 A;  2KPK A;  4PQW A;  5HDY A;  4JOP A;  1WHA A;  4Z33 A;  1KEF A;  2M0V A;  3EGG C;  2DM8 A;  3TSV A;  2EEG A;  3NFL A;  3ID2 A;  5GLJ A;  2W4F A;  1WF8 A;  2PNT A;  2QKU A;  1V5Q A;  5D13 A;  3SOE A;  2EJY A;  5HF4 A;  3ID3 A;  5HFF A;  2L4T A;  1TP3 A;  3AXA A;  3CYY A;  2OQS A;  1NTE A;  2OMJ A;  4UU5 A;  3I4W A;  4KFV A;  2M10 A;  2M0Z A;  4G69 A;  2EHR A;  5HET A;  3GSL A;  2KJD A;  4O06 A;  1ZUB A;  2V1W A;  2K20 A;  3QDO A;  2FCF A;  5F67 A;  2D8I A;  1GM1 A;  3NGH A;  1B8Q A;  4OEO A;  1IU0 A;  1MFG A;  3DJA A;  1KY9 A;  3PV4 A;  4IC6 A;  2Q9V A;  2EEI A;  2Z9I A;  5E1Y A;  1FC6 A;  2OS6 A;  5B6L A;  1X5R A;  1WI2 A;  5GND A;  1X8S A;  3R0H A;  3ZRT A;  2VRF A;  5EYZ A;  2AWW A;  2DC2 A;  2F0A A;  5HFD A;  1RGW A;  3GDU A;  5F3X A;  4NNL A;  1W9O A;  4K78 A;  1UEP A;  3O5N A;  1WHD A;  2IWO A;  3PDV A;  2LOB A;  1MFL A;  3GCN A;  1X5N A;  1X45 A;  2IWP A;  2JWE A;  4NXP A;  1UJU A;  1BFE A;  3VQF A;  3BPU A;  1Z87 A;  4JOH A;  2M0U A;  3K82 A;  1UIT A;  1WFG A;  2OSG A;  3SHU A;  4HOP A;  4JL7 A;  4AMH A;  2HE4 A;  3STJ A;  4JOJ A;  3R68 A;  1T2M A;  1GQ4 A;  4K72 A;  2O2T A;  4NXR A;  2R4H A;  2ZPM A;  1UJV A;  4JOK A;  4E35 A;  5E11 A;  1TP5 A;  1YBO A;  3KHF A;  2W7R A;  5HEY A;  3EGH C;  3L4F D;  4JOE A;  2MX6 A;  5HF1 A;  1QAU A;  2KG2 A;  2KYL A;  1SOZ A;  1V6B A;  3B76 A;  2UZC A;  5G1D A;  2H2B A;  2CS5 A;  4GHN A;  2FNE A;  4NNM A;  2KAW A;  3WKL A;  2VZ5 A;  2LUI A;  2YUY A;  1Y7N A;  4EDJ A;  5E21 A;  1I92 A;  4MPA A;  3KZE A;  4K76 A;  4HOP B;  1XZ9 A;  5DTH A;  2R3Y A;  1OBY A;  1UEW A;  4P0C A;  1WIF A;  4UU6 A;  4R2Z A;  2YT7 A;  1OBX A;  4E3B A;  3ID4 A;  1MC7 A;  3TMH A;  4Q2N A;  2KL1 A;  2E7K A;  3HVQ C;  2FN5 A;  4NMV A;  1IHJ A;  1Z86 A;  1WF7 A;  1IU2 A;  2YTW A;  1I16 A;  3OTP A;  4Q3H A;  4NMP A;  3DJ3 A;  1VCW A;  1LCY A;  1WFV A;  5HJ1 A;  3PS4 A;  4RI0 A;  3CBX A;  2VWR A;  3GJ9 A;  1N7T A;  3I1E A;  4NMR A;  5E22 A;  2D92 A;  3K50 A;  3HPM A;  2L4S A;  3CBY A;  2H2C A;  2CSJ A;  1UEZ A;  1RZX A;  2P3W A;  3K1R A;  4NMO A;  1FCF A;  4P2A B;  1SOT A;  3WKM A;  1UF1 A;  1U3B A;  4Q6S A;  1U38 A;  5G1E A;  2VSV A;  1KWA A;  2JIK A;  2LA8 A;  3CH8 A;  3HPK A;  2DLU A;  2KOJ A;  4FGM A;  2OZF A;  1N6D A;  3LNY A;  3PV5 A;  4K6Y A;  5HFE A;  4REY A;  3RL8 A;  3I18 A;  2Q3G A;  1UHP A;  1Q7X A;  3RLE A;  4Z8J A;  2FE5 A;  1VB7 A;  1K32 A;  2M3M A;  3OU0 A;  2KQF A;  3QO6 A;  2JIL A;  2EGN A;  3O46 A;  2KV8 A;  1NF3 C;  3DIW A;  4OAJ A;  1V1T A;  1QAV A;  3ID1 A;  1UFX A;  3NFK A;  2I0L A;  3QGL A;  2MHO A;  2I4S A;  3CBZ A;  1QLC A;  4XHV A;  2QBW A;  1X5Q A;  2VSP A;  1WG6 A;  4NMQ A;  2KOH A;  1BE9 A;  1N99 A;  4E34 A;  1WH1 A;  4K75 A;  1W9E A;  2PA1 A;  2PDZ A;  4WYU A;  2JRE A;  2QKT A;  2DLS A;  2F5Y A;  1L6O A;  2AIN A;  5A2P A;  1WJL A;  3GDS A;  4L8N A;  1N6F A;  2H3L A;  5JXB A;  2ENO A;  4YYX A;  4Q2Q A;  2VPH A;  4NMS A;  1RY4 A; 
#chains in the Genus database with same CATH topology
 4FLN A;  1Q3P A;  2EGK A;  3QJM A;  4LMM A;  2G5M B;  2RRM A;  1V62 A;  1TQ3 A;  2K1Z A;  2EV8 A;  2I1N A;  3CC0 A;  1FC7 A;  4NXQ A;  2OPG A;  5FHT A;  1P1D A;  2I6V A;  5H3J A;  1WI4 A;  2PKT A;  1N6E A;  2X7Z A;  2HE2 A;  1UM1 A;  2EXG A;  4GVC A;  1Y8T A;  4YDP A;  3DJ1 A;  4H11 A;  2GZV A;  4WYT A;  2KBS A;  2YUB A;  3QJN A;  4KFW A;  2JOA A;  4F8K A;  3GGE A;  2AWU A;  2DKR A;  3GDV A;  3JXT A;  2KPL A;  3DOR A;  2KOM A;  2OGP A;  1N7F A;  2EEJ A;  5I7Z A;  3TSZ A;  2PKU A;  1U37 A;  3QIK A;  2QG1 A;  1UEQ A;  1X6D A;  2JIN A;  5FB8 C;  1N7E A;  2EAQ A;  2CSS A;  2LC6 A;  4Q2O A;  1Q3O A;  1U39 A;  2DB5 A;  2Z17 A;  2EDP A;  3FY5 A;  2I0I A;  1TE0 A;  1OBZ A;  2I04 A;  3SFJ A;  2EDZ A;  4GVD A;  3MH7 A;  5EZ0 A;  2QKV A;  3TSW A;  2ZPL A;  3MH4 A;  2OCS A;  4NMT A;  5HED A;  5HEB A;  2V90 A;  1V5L A;  4OEP A;  3CS0 A;  2D90 A;  3RL7 A;  5E6P B;  5B42 A;  2YT8 A;  2KJP A;  2DAZ A;  4JJ3 A;  4Q2P A;  2HGA A;  3KDG A;  1W9Q A;  2EEH A;  2H3M A;  2BYG A;  3KDK A;  3SHW A;  2IWN A;  1OZI A;  4Q6H A;  4JOR A;  2WL7 A;  1ZOK A;  1R6J A;  3R69 A;  1FC9 A;  1RGR A;  2LC7 A;  2QT5 A;  3PV2 A;  1UJD A;  1M5Z A;  1PDR A;  3PDZ A;  2EDV A;  1D5G A;  3KZD A;  2KA9 A;  2DJT A;  2L97 A;  2G2L A;  2AWX A;  2DMZ A;  3MH6 A;  2RCZ A;  1QAV B;  3VQG A;  3SUZ A;  2KRG A;  1VJ6 A;  2REY A;  1G9O A;  1GQ5 A;  2M0T A;  2JXO A;  3GCO A;  4JOF A;  5HFB A;  1VAE A;  1VA8 A;  1P1E A;  2KJK A;  4N6X A;  2PZD A;  2IWQ A;  5HFC A;  2EGO A;  3LNX A;  3E17 A;  3QE1 A;  4JOG A;  1UM7 A;  2KPK A;  4PQW A;  5HDY A;  4JOP A;  1WHA A;  4Z33 A;  1KEF A;  2M0V A;  3EGG C;  2DM8 A;  3TSV A;  2EEG A;  3NFL A;  3ID2 A;  5GLJ A;  2W4F A;  4JJ0 A;  1WF8 A;  2PNT A;  2QKU A;  1V5Q A;  5D13 A;  3SOE A;  2EJY A;  5HF4 A;  3ID3 A;  5HFF A;  2L4T A;  1TP3 A;  3AXA A;  3CYY A;  2OQS A;  1NTE A;  2OMJ A;  4UU5 A;  3I4W A;  4KFV A;  2M10 A;  2M0Z A;  4G69 A;  2EHR A;  5HET A;  3GSL A;  2KJD A;  4O06 A;  1ZUB A;  2V1W A;  2K20 A;  3QDO A;  2FCF A;  5F67 A;  2D8I A;  1GM1 A;  3NGH A;  1B8Q A;  4OEO A;  1IU0 A;  1MFG A;  3DJA A;  1KY9 A;  3PV4 A;  4IC6 A;  2Q9V A;  2EEI A;  2Z9I A;  5E1Y A;  1FC6 A;  2OS6 A;  5B6L A;  1X5R A;  1WI2 A;  5GND A;  1X8S A;  3R0H A;  3ZRT A;  2VRF A;  5EYZ A;  2AWW A;  2DC2 A;  2F0A A;  5HFD A;  1RGW A;  3GDU A;  5F3X A;  4NNL A;  1W9O A;  4K78 A;  1UEP A;  3O5N A;  1WHD A;  2IWO A;  3PDV A;  2LOB A;  1MFL A;  3GCN A;  1X5N A;  1X45 A;  2IWP A;  2JWE A;  4NXP A;  1UJU A;  1BFE A;  3VQF A;  3BPU A;  1Z87 A;  4JOH A;  2M0U A;  3K82 A;  1UIT A;  1WFG A;  2OSG A;  3SHU A;  4HOP A;  4JL7 A;  4AMH A;  2HE4 A;  3STJ A;  4JOJ A;  3R68 A;  3NCV A;  1T2M A;  1GQ4 A;  4K72 A;  2O2T A;  4NXR A;  2R4H A;  2ZPM A;  1UJV A;  4JOK A;  4E35 A;  5E11 A;  1TP5 A;  1YBO A;  3KHF A;  2W7R A;  5HEY A;  3EGH C;  3L4F D;  4JOE A;  2MX6 A;  5HF1 A;  1QAU A;  2KG2 A;  3GAB A;  2KYL A;  1SOZ A;  1V6B A;  3B76 A;  2UZC A;  5ILB A;  5G1D A;  2H2B A;  2CS5 A;  4GHN A;  2FNE A;  4NNM A;  2KAW A;  3WKL A;  2VZ5 A;  2LUI A;  2YUY A;  1Y7N A;  4EDJ A;  5E21 A;  1I92 A;  4MPA A;  3KZE A;  4K76 A;  4HOP B;  1XZ9 A;  5DTH A;  2R3Y A;  1OBY A;  1UEW A;  4P0C A;  1WIF A;  4UU6 A;  1X9Z A;  4R2Z A;  2YT7 A;  1OBX A;  4E3B A;  2JSN A;  3ID4 A;  1MC7 A;  3TMH A;  4Q2N A;  2KL1 A;  2E7K A;  3HVQ C;  2FN5 A;  4NMV A;  1IHJ A;  1Z86 A;  1WF7 A;  1IU2 A;  2YTW A;  1I16 A;  3OTP A;  4Q3H A;  4NMP A;  3DJ3 A;  1VCW A;  1LCY A;  1WFV A;  5HJ1 A;  3PS4 A;  4RI0 A;  3CBX A;  2VWR A;  3GJ9 A;  1N7T A;  3I1E A;  4NMR A;  5E22 A;  2D92 A;  3K50 A;  3HPM A;  2L4S A;  3CBY A;  2H2C A;  2CSJ A;  1UEZ A;  1RZX A;  2P3W A;  3K1R A;  4NMO A;  1FCF A;  4P2A B;  1SOT A;  3WKM A;  1UF1 A;  1U3B A;  4Q6S A;  1U38 A;  5G1E A;  2VSV A;  1KWA A;  2JIK A;  2LA8 A;  3CH8 A;  3HPK A;  2DLU A;  2KOJ A;  4FGM A;  2OZF A;  1N6D A;  3LNY A;  3PV5 A;  4K6Y A;  5HFE A;  4REY A;  3RL8 A;  3I18 A;  2Q3G A;  1UHP A;  1Q7X A;  3RLE A;  4Z8J A;  2FE5 A;  1VB7 A;  5IL9 A;  1K32 A;  2GEF A;  2M3M A;  3OU0 A;  2KQF A;  3QO6 A;  2JIL A;  2EGN A;  3O46 A;  2KV8 A;  1NF3 C;  3DIW A;  4OAJ A;  1V1T A;  1QAV A;  3ID1 A;  1UFX A;  3NFK A;  2I0L A;  3QGL A;  2MHO A;  2I4S A;  3CBZ A;  1QLC A;  4XHV A;  2QBW A;  1X5Q A;  2VSP A;  1WG6 A;  4NMQ A;  2KOH A;  1BE9 A;  1N99 A;  4E34 A;  1WH1 A;  4K75 A;  1W9E A;  2PA1 A;  2PDZ A;  4WYU A;  2JRE A;  2QKT A;  2DLS A;  2F5Y A;  1L6O A;  2AIN A;  5A2P A;  1WJL A;  3GDS A;  4L8N A;  1N6F A;  2H3L A;  5JXB A;  2ENO A;  4YYX A;  4Q2Q A;  2VPH A;  4NMS A;  1RY4 A; 
#chains in the Genus database with same CATH homology
 4FLN A;  1Q3P A;  2EGK A;  3QJM A;  4LMM A;  2G5M B;  2RRM A;  1V62 A;  1TQ3 A;  2K1Z A;  2EV8 A;  2I1N A;  3CC0 A;  1FC7 A;  4NXQ A;  2OPG A;  5FHT A;  1P1D A;  2I6V A;  5H3J A;  1WI4 A;  2PKT A;  1N6E A;  2X7Z A;  2HE2 A;  1UM1 A;  2EXG A;  4GVC A;  1Y8T A;  4YDP A;  3DJ1 A;  4H11 A;  2GZV A;  4WYT A;  2KBS A;  2YUB A;  3QJN A;  4KFW A;  2JOA A;  4F8K A;  3GGE A;  2AWU A;  2DKR A;  3GDV A;  3JXT A;  2KPL A;  3DOR A;  2KOM A;  2OGP A;  1N7F A;  2EEJ A;  5I7Z A;  3TSZ A;  2PKU A;  1U37 A;  3QIK A;  2QG1 A;  1UEQ A;  1X6D A;  2JIN A;  5FB8 C;  1N7E A;  2EAQ A;  2CSS A;  2LC6 A;  4Q2O A;  1Q3O A;  1U39 A;  2DB5 A;  2Z17 A;  2EDP A;  3FY5 A;  2I0I A;  1TE0 A;  1OBZ A;  2I04 A;  3SFJ A;  2EDZ A;  4GVD A;  3MH7 A;  5EZ0 A;  2QKV A;  3TSW A;  2ZPL A;  3MH4 A;  2OCS A;  4NMT A;  5HED A;  5HEB A;  2V90 A;  1V5L A;  4OEP A;  3CS0 A;  2D90 A;  3RL7 A;  5E6P B;  5B42 A;  2YT8 A;  2KJP A;  2DAZ A;  4JJ3 A;  4Q2P A;  2HGA A;  3KDG A;  1W9Q A;  2EEH A;  2H3M A;  2BYG A;  3KDK A;  3SHW A;  2IWN A;  1OZI A;  4Q6H A;  4JOR A;  2WL7 A;  1ZOK A;  1R6J A;  3R69 A;  1FC9 A;  1RGR A;  2LC7 A;  2QT5 A;  3PV2 A;  1UJD A;  1M5Z A;  1PDR A;  3PDZ A;  2EDV A;  1D5G A;  3KZD A;  2KA9 A;  2DJT A;  2L97 A;  2G2L A;  2AWX A;  2DMZ A;  3MH6 A;  2RCZ A;  1QAV B;  3VQG A;  3SUZ A;  2KRG A;  1VJ6 A;  2REY A;  1G9O A;  1GQ5 A;  2M0T A;  2JXO A;  3GCO A;  4JOF A;  5HFB A;  1VAE A;  1VA8 A;  1P1E A;  2KJK A;  4N6X A;  2PZD A;  2IWQ A;  5HFC A;  2EGO A;  3LNX A;  3E17 A;  3QE1 A;  4JOG A;  1UM7 A;  2KPK A;  4PQW A;  5HDY A;  4JOP A;  1WHA A;  4Z33 A;  1KEF A;  2M0V A;  3EGG C;  2DM8 A;  3TSV A;  2EEG A;  3NFL A;  3ID2 A;  5GLJ A;  2W4F A;  4JJ0 A;  1WF8 A;  2PNT A;  2QKU A;  1V5Q A;  5D13 A;  3SOE A;  2EJY A;  5HF4 A;  3ID3 A;  5HFF A;  2L4T A;  1TP3 A;  3AXA A;  3CYY A;  2OQS A;  1NTE A;  2OMJ A;  4UU5 A;  3I4W A;  4KFV A;  2M10 A;  2M0Z A;  4G69 A;  2EHR A;  5HET A;  3GSL A;  2KJD A;  4O06 A;  1ZUB A;  2V1W A;  2K20 A;  3QDO A;  2FCF A;  5F67 A;  2D8I A;  1GM1 A;  3NGH A;  1B8Q A;  4OEO A;  1IU0 A;  1MFG A;  3DJA A;  1KY9 A;  3PV4 A;  4IC6 A;  2Q9V A;  2EEI A;  2Z9I A;  5E1Y A;  1FC6 A;  2OS6 A;  5B6L A;  1X5R A;  1WI2 A;  5GND A;  1X8S A;  3R0H A;  3ZRT A;  2VRF A;  5EYZ A;  2AWW A;  2DC2 A;  2F0A A;  5HFD A;  1RGW A;  3GDU A;  5F3X A;  4NNL A;  1W9O A;  4K78 A;  1UEP A;  3O5N A;  1WHD A;  2IWO A;  3PDV A;  2LOB A;  1MFL A;  3GCN A;  1X5N A;  1X45 A;  2IWP A;  2JWE A;  4NXP A;  1UJU A;  1BFE A;  3VQF A;  3BPU A;  1Z87 A;  4JOH A;  2M0U A;  3K82 A;  1UIT A;  1WFG A;  2OSG A;  3SHU A;  4HOP A;  4JL7 A;  4AMH A;  2HE4 A;  3STJ A;  4JOJ A;  3R68 A;  3NCV A;  1T2M A;  1GQ4 A;  4K72 A;  2O2T A;  4NXR A;  2R4H A;  2ZPM A;  1UJV A;  4JOK A;  4E35 A;  5E11 A;  1TP5 A;  1YBO A;  3KHF A;  2W7R A;  5HEY A;  3EGH C;  3L4F D;  4JOE A;  2MX6 A;  5HF1 A;  1QAU A;  2KG2 A;  3GAB A;  2KYL A;  1SOZ A;  1V6B A;  3B76 A;  2UZC A;  5ILB A;  5G1D A;  2H2B A;  2CS5 A;  4GHN A;  2FNE A;  4NNM A;  2KAW A;  3WKL A;  2VZ5 A;  2LUI A;  2YUY A;  1Y7N A;  4EDJ A;  5E21 A;  1I92 A;  4MPA A;  3KZE A;  4K76 A;  4HOP B;  1XZ9 A;  5DTH A;  2R3Y A;  1OBY A;  1UEW A;  4P0C A;  1WIF A;  4UU6 A;  1X9Z A;  4R2Z A;  2YT7 A;  1OBX A;  4E3B A;  2JSN A;  3ID4 A;  1MC7 A;  3TMH A;  4Q2N A;  2KL1 A;  2E7K A;  3HVQ C;  2FN5 A;  4NMV A;  1IHJ A;  1Z86 A;  1WF7 A;  1IU2 A;  2YTW A;  1I16 A;  3OTP A;  4Q3H A;  4NMP A;  3DJ3 A;  1VCW A;  1LCY A;  1WFV A;  5HJ1 A;  3PS4 A;  4RI0 A;  3CBX A;  2VWR A;  3GJ9 A;  1N7T A;  3I1E A;  4NMR A;  5E22 A;  2D92 A;  3K50 A;  3HPM A;  2L4S A;  3CBY A;  2H2C A;  2CSJ A;  1UEZ A;  1RZX A;  2P3W A;  3K1R A;  4NMO A;  1FCF A;  4P2A B;  1SOT A;  3WKM A;  1UF1 A;  1U3B A;  4Q6S A;  1U38 A;  5G1E A;  2VSV A;  1KWA A;  2JIK A;  2LA8 A;  3CH8 A;  3HPK A;  2DLU A;  2KOJ A;  4FGM A;  2OZF A;  1N6D A;  3LNY A;  3PV5 A;  4K6Y A;  5HFE A;  4REY A;  3RL8 A;  3I18 A;  2Q3G A;  1UHP A;  1Q7X A;  3RLE A;  4Z8J A;  2FE5 A;  1VB7 A;  5IL9 A;  1K32 A;  2GEF A;  2M3M A;  3OU0 A;  2KQF A;  3QO6 A;  2JIL A;  2EGN A;  3O46 A;  2KV8 A;  1NF3 C;  3DIW A;  4OAJ A;  1V1T A;  1QAV A;  3ID1 A;  1UFX A;  3NFK A;  2I0L A;  3QGL A;  2MHO A;  2I4S A;  3CBZ A;  1QLC A;  4XHV A;  2QBW A;  1X5Q A;  2VSP A;  1WG6 A;  4NMQ A;  2KOH A;  1BE9 A;  1N99 A;  4E34 A;  1WH1 A;  4K75 A;  1W9E A;  2PA1 A;  2PDZ A;  4WYU A;  2JRE A;  2QKT A;  2DLS A;  2F5Y A;  1L6O A;  2AIN A;  5A2P A;  1WJL A;  3GDS A;  4L8N A;  1N6F A;  2H3L A;  5JXB A;  2ENO A;  4YYX A;  4Q2Q A;  2VPH A;  4NMS A;  1RY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...