2VRFA

Crystal structure of the human beta-2-syntrophin pdz domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'SMPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVNTVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-2-SYNTROPHIN
publication title Crystal Structure of the Human Beta-2-Syntrophin Pdz Domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2vrfA00
4OEPA 3DIWA 4L8NA 4IC6A 4YYXA 4AMHA 2QKVA 2BYGA 2OZFA 3MH4A 5H3JA 1IU0A 2HE2A 3PDZA 2REYA 2PZDA 1TP3A 2EJYA 2CS5A 1Z86A 2R4HA 2K1ZA 3GSLA 2M0VA 5HEDA 1WHDA 2JOAA 4GHNA 4N6XA 3NGHA 1NTEA 2I4SA 4EDJA 2EXGA 1R6JA 5F3XA 1V5LA 2Z17A 3O5NA 5E6PB 3TSWA 2MX6A 2EGNA 1UF1A 3TMHA 2OCSA 4P0CA 2H3MA 2JILA 4K76A 3ID3A 2W7RA 3GDUA 2VSVA 1UJDA 2V1WA 3K50A 4JOKA 2VZ5A 1N6EA 2P3WA 2DAZA 2JREA 4NMQA 1K32A 1B8QA 1X5NA 4NMTA 2AWWA 1U3BA 4E34A 5HFDA 4Q2QA 1OBYA 1TP5A 3KZEA 1WFGA 2G2LA 5E22A 2PNTA 2DJTA 4JOHA 4Q6SA 5HETA 5HEYA 2M3MA 3GCNA 1MC7A 1N6DA 2I0LA 2KQFA 4P2AB 3SUZA 2UZCA 4LMMA 1MFLA 3KZDA 3OU0A 3QE1A 5GLJA 4OEOA 5HF1A 1VA8A 1SOZA 2OSGA 1W9EA 3I4WA 3B76A 4K78A 3WKLA 1VB7A 1P1DA 2VWRA 3HPMA 2EDZA 4NMOA 2VRFA 2M0ZA 3CBXA 2L4SA 3KHFA 1Q7XA 3MH6A 2KA9A 3L4FD 4Q2NA 4NXPA 1WF8A 3CBZA 2FE5A 1LCYA 5B6LA 2M0UA 4MPAA 2YUYA 2QG1A 1KY9A 5HFCA 4G69A 1WJLA 2OS6A 5F67A 4Z8JA 2LUIA 3R68A 3TSZA 2KJDA 4NMVA 5A2PA 1FC6A 2CSJA 1M5ZA 1BE9A 1UM1A 1QAVA 1X45A 2VSPA 2V90A 1NF3C 2I04A 2EDVA 1RGRA 2DB5A 3SFJA 3RL8A 3TSVA 4JOGA 4HOPB 3K82A 3CBYA 2FN5A 1IHJA 3WKMA 2DLSA 3QDOA 4JOFA 1QLCA 2AWXA 3MH7A 4NXRA 2IWQA 2DMZA 2VPHA 4RI0A 1Y8TA 2KV8A 2ENOA 4WYTA 3GCOA 3DORA 2LC6A 2HE4A 4K6YA 1IU2A 3E17A 5FB8C 1VJ6A 1UITA 2D8IA 5I7ZA 2LOBA 5D13A 1UFXA 1UM7A 2ZPMA 1GM1A 4REYA 2KRGA 3EGGC 2QT5A 2KJPA 4NMRA 2EV8A 1OZIA 3PV2A 4Q2OA 2F0AA 1UEZA 2L97A 3SOEA 3PS4A 2EGKA 3K1RA 1MFGA 4KFWA 4H11A 1WI2A 2I6VA 2MHOA 2FCFA 3I18A 3ID1A 2D92A 1XZ9A 1X6DA 2EEJA 2KAWA 5GNDA 1WI4A 3QJMA 3SHWA 2LC7A 3STJA 4NXQA 3GJ9A 2I1NA 3I1EA 1UEPA 4Q2PA 5HF4A 4NMSA 4Q6HA 2K20A 1V6BA 3BPUA 1WG6A 4PQWA 3PDVA 3RLEA 2JWEA 1UJVA 1RZXA 2H2CA 4OAJA 2IWNA 2RCZA 3GDVA 2AWUA 2YUBA 5E11A 2QKUA 5E21A 2OGPA 2JINA 1WH1A 3QIKA 1X8SA 1N6FA 2F5YA 4JOJA 1YBOA 1VCWA 3HPKA 1GQ5A 3OTPA 2EEGA 1VAEA 1P1EA 5EZ0A 4O06A 2YTWA 1WF7A 3CS0A 4K75A 4KFVA 2GZVA 1PDRA 2KOJA 1WFVA 2R3YA 1ZOKA 2HGAA 2EDPA 4UU5A 2EEHA 2Q3GA 1G9OA 2KL1A 2FNEA 2ZPLA 2Z9IA 2KPLA 4NMPA 4YDPA 4JORA 2JIKA 3AXAA 4HOPA 2EAQA 3QJNA 3VQFA 3R69A 2EGOA 1V5QA 4FGMA 1FCFA 5HFBA 3SHUA 2KPKA 1I16A 1RGWA 4UU6A 1X5QA 2KJKA 5EYZA 5FHTA 1GQ4A 2Q9VA 1WIFA 3HVQC 2DLUA 4Z33A 1BFEA 2WL7A 2KYLA 1UEWA 1ZUBA 5HFFA 1OBXA 1UHPA 2DM8A 2PDZA 1W9OA 1FC9A 1QAUA 1D5GA 1RY4A 2KOHA 3GDSA 2G5MB 2KOMA 1N7FA 1N7EA 1V62A 3ZRTA 1Y7NA 2D90A 2O2TA 4JOEA 2OMJA 4F8KA 1U38A 4NNMA 1KWAA 2QKTA 4WYUA 3FY5A 3R0HA 4Q3HA 1I92A 4JL7A 3RL7A 4GVCA 2L4TA 1KEFA 5DTHA 2EEIA 5G1EA 3QGLA 1WHAA 2RRMA 2E7KA 4K72A 5E1YA 1W9QA 1SOTA 1N7TA 2X7ZA 3LNYA 2JXOA 3NFKA 1U39A 2DKRA 2PKTA 2OQSA 2YT7A 2EHRA 2PKUA 3NFLA 4E3BA 3CYYA 1Q3PA 2M0TA 2CSSA 3DJ3A 3CH8A 1UJUA 2PA1A 2KBSA 1OBZA 2IWOA 1L6OA 3LNXA 3EGHC 3DJ1A 1T2MA 2DC2A 2KG2A 4GVDA 2OPGA 3CC0A 3VQGA 2IWPA 2QBWA 5JXBA 3ID2A 1V1TA 2W4FA 5HDYA 2LA8A 5HFEA 1Z87A 5G1DA 2H2BA 2AINA 2M10A 1UEQA 5HJ1A 4E35A 1FC7A 4JOPA 1TE0A 3QO6A 2YT8A 3PV5A 2I0IA 3GGEA 3DJAA 1X5RA 2H3LA 4NNLA 3JXTA 3O46A 4R2ZA 1QAVB 1N99A 1TQ3A 1Q3OA 3ID4A 4XHVA 5HEBA 3PV4A 1U37A
chains in the Genus database with same CATH superfamily
4OEPA 3DIWA 4L8NA 4IC6A 4YYXA 4AMHA 2QKVA 2BYGA 2OZFA 3MH4A 5H3JA 1IU0A 2HE2A 3PDZA 2REYA 2PZDA 1TP3A 2EJYA 2CS5A 1Z86A 2R4HA 2K1ZA 3GSLA 2M0VA 5HEDA 1WHDA 2GEFA 2JOAA 4GHNA 4N6XA 3NGHA 1NTEA 4JJ3A 2I4SA 4EDJA 2EXGA 1R6JA 5F3XA 1V5LA 2Z17A 3O5NA 5E6PB 3TSWA 2MX6A 2EGNA 1UF1A 3TMHA 2OCSA 4P0CA 2H3MA 2JILA 4K76A 3ID3A 2W7RA 3GDUA 2VSVA 1UJDA 2V1WA 3K50A 4JOKA 2VZ5A 1N6EA 2P3WA 2DAZA 2JREA 4NMQA 1K32A 1B8QA 1X5NA 4NMTA 5B42A 2AWWA 1U3BA 5IL9A 4E34A 5HFDA 4Q2QA 1OBYA 1TP5A 3KZEA 1WFGA 2G2LA 5E22A 2PNTA 2DJTA 4JOHA 4Q6SA 5HETA 5HEYA 2M3MA 3GCNA 1MC7A 1N6DA 2I0LA 2KQFA 4P2AB 3SUZA 2UZCA 4LMMA 1MFLA 3KZDA 3OU0A 3QE1A 5GLJA 4OEOA 2JSNA 5HF1A 1VA8A 1SOZA 2OSGA 1W9EA 3I4WA 3B76A 4K78A 3WKLA 1VB7A 1P1DA 2VWRA 3HPMA 2EDZA 4NMOA 2VRFA 2M0ZA 3CBXA 2L4SA 3KHFA 1Q7XA 3MH6A 2KA9A 3L4FD 4Q2NA 4NXPA 1WF8A 3CBZA 2FE5A 1LCYA 5B6LA 2M0UA 4MPAA 2YUYA 2QG1A 1KY9A 5HFCA 4G69A 1WJLA 2OS6A 5F67A 4Z8JA 2LUIA 3R68A 3TSZA 2KJDA 4NMVA 5A2PA 1FC6A 2CSJA 1M5ZA 1BE9A 1UM1A 1QAVA 1X45A 2VSPA 2V90A 1NF3C 2I04A 2EDVA 1RGRA 2DB5A 3SFJA 3RL8A 3TSVA 4JOGA 4HOPB 3K82A 3CBYA 2FN5A 1IHJA 3WKMA 2DLSA 3QDOA 4JOFA 1QLCA 2AWXA 3MH7A 4NXRA 2IWQA 2DMZA 2VPHA 4RI0A 1Y8TA 2KV8A 2ENOA 4WYTA 3GCOA 3DORA 2LC6A 2HE4A 4K6YA 1IU2A 3E17A 5FB8C 1VJ6A 1UITA 1X9ZA 2D8IA 5I7ZA 2LOBA 5D13A 1UFXA 1UM7A 2ZPMA 1GM1A 4REYA 2KRGA 3EGGC 2QT5A 2KJPA 4NMRA 2EV8A 1OZIA 3PV2A 4Q2OA 2F0AA 1UEZA 2L97A 3SOEA 3PS4A 2EGKA 3K1RA 1MFGA 4KFWA 4H11A 1WI2A 2I6VA 2MHOA 2FCFA 3I18A 3ID1A 2D92A 1XZ9A 1X6DA 2EEJA 2KAWA 5GNDA 1WI4A 3QJMA 3SHWA 2LC7A 3STJA 4NXQA 3GJ9A 2I1NA 3I1EA 1UEPA 4Q2PA 5HF4A 4NMSA 4Q6HA 2K20A 1V6BA 3BPUA 1WG6A 4PQWA 3PDVA 3RLEA 2JWEA 1UJVA 1RZXA 2H2CA 4OAJA 2IWNA 2RCZA 3GDVA 2AWUA 2YUBA 5E11A 2QKUA 5E21A 2OGPA 2JINA 1WH1A 3GABA 3QIKA 1X8SA 1N6FA 2F5YA 4JOJA 1YBOA 1VCWA 3HPKA 1GQ5A 3OTPA 2EEGA 1VAEA 1P1EA 5EZ0A 4O06A 2YTWA 1WF7A 3KDKA 3CS0A 4K75A 4KFVA 2GZVA 1PDRA 2KOJA 1WFVA 2R3YA 1ZOKA 2HGAA 2EDPA 4UU5A 2EEHA 2Q3GA 1G9OA 2KL1A 2FNEA 2ZPLA 2Z9IA 2KPLA 4NMPA 4YDPA 4JORA 2JIKA 3AXAA 4HOPA 2EAQA 3QJNA 3VQFA 3R69A 2EGOA 1V5QA 4FGMA 1FCFA 5HFBA 3SHUA 2KPKA 1I16A 1RGWA 4UU6A 1X5QA 2KJKA 4JJ0A 5EYZA 5FHTA 1GQ4A 2Q9VA 1WIFA 3HVQC 3KDGA 2DLUA 4Z33A 1BFEA 2WL7A 2KYLA 1UEWA 1ZUBA 5HFFA 1OBXA 1UHPA 5ILBA 2DM8A 2PDZA 1W9OA 1FC9A 1QAUA 1D5GA 1RY4A 2KOHA 3GDSA 2G5MB 2KOMA 1N7FA 1N7EA 1V62A 3ZRTA 3NCVA 1Y7NA 2D90A 2O2TA 4JOEA 2OMJA 4F8KA 1U38A 4NNMA 1KWAA 2QKTA 4WYUA 3FY5A 3R0HA 4Q3HA 1I92A 4JL7A 3RL7A 4GVCA 2L4TA 1KEFA 5DTHA 2EEIA 5G1EA 3QGLA 1WHAA 2RRMA 2E7KA 4K72A 5E1YA 1W9QA 1SOTA 1N7TA 2X7ZA 3LNYA 2JXOA 3NFKA 1U39A 2DKRA 2PKTA 2OQSA 2YT7A 2EHRA 2PKUA 3NFLA 4E3BA 3CYYA 1Q3PA 2M0TA 2CSSA 3DJ3A 3CH8A 1UJUA 2PA1A 2KBSA 1OBZA 2IWOA 1L6OA 3LNXA 3EGHC 3DJ1A 1T2MA 2DC2A 2KG2A 4GVDA 2OPGA 3CC0A 3VQGA 2IWPA 2QBWA 5JXBA 3ID2A 1V1TA 2W4FA 5HDYA 2LA8A 5HFEA 1Z87A 5G1DA 2H2BA 2AINA 2M10A 1UEQA 5HJ1A 4E35A 1FC7A 4JOPA 1TE0A 3QO6A 4FLNA 2YT8A 3PV5A 2I0IA 3GGEA 3DJAA 1X5RA 2H3LA 4NNLA 3JXTA 3O46A 4R2ZA 1QAVB 1N99A 1TQ3A 1Q3OA 3ID4A 4XHVA 5HEBA 3PV4A 1U37A
chains in the Genus database with same CATH topology
4OEPA 3DIWA 4L8NA 4IC6A 4YYXA 4AMHA 2QKVA 2BYGA 2OZFA 3MH4A 5H3JA 1IU0A 2HE2A 3PDZA 2REYA 2PZDA 1TP3A 2EJYA 2CS5A 1Z86A 2R4HA 2K1ZA 3GSLA 2M0VA 5HEDA 1WHDA 2GEFA 2JOAA 4GHNA 4N6XA 3NGHA 1NTEA 4JJ3A 2I4SA 4EDJA 2EXGA 1R6JA 5F3XA 1V5LA 2Z17A 3O5NA 5E6PB 3TSWA 2MX6A 2EGNA 1UF1A 3TMHA 2OCSA 4P0CA 2H3MA 2JILA 4K76A 3ID3A 2W7RA 3GDUA 2VSVA 1UJDA 2V1WA 3K50A 4JOKA 2VZ5A 1N6EA 2P3WA 2DAZA 2JREA 4NMQA 1K32A 1B8QA 1X5NA 4NMTA 5B42A 2AWWA 1U3BA 5IL9A 4E34A 5HFDA 4Q2QA 1OBYA 1TP5A 3KZEA 1WFGA 2G2LA 5E22A 2PNTA 2DJTA 4JOHA 4Q6SA 5HETA 5HEYA 2M3MA 3GCNA 1MC7A 1N6DA 2I0LA 2KQFA 4P2AB 3SUZA 2UZCA 4LMMA 1MFLA 3KZDA 3OU0A 3QE1A 5GLJA 4OEOA 2JSNA 5HF1A 1VA8A 1SOZA 2OSGA 1W9EA 3I4WA 3B76A 4K78A 3WKLA 1VB7A 1P1DA 2VWRA 3HPMA 2EDZA 4NMOA 2VRFA 2M0ZA 3CBXA 2L4SA 3KHFA 1Q7XA 3MH6A 2KA9A 3L4FD 4Q2NA 4NXPA 1WF8A 3CBZA 2FE5A 1LCYA 5B6LA 2M0UA 4MPAA 2YUYA 2QG1A 1KY9A 5HFCA 4G69A 1WJLA 2OS6A 5F67A 4Z8JA 2LUIA 3R68A 3TSZA 2KJDA 4NMVA 5A2PA 1FC6A 2CSJA 1M5ZA 1BE9A 1UM1A 1QAVA 1X45A 2VSPA 2V90A 1NF3C 2I04A 2EDVA 1RGRA 2DB5A 3SFJA 3RL8A 3TSVA 4JOGA 4HOPB 3K82A 3CBYA 2FN5A 1IHJA 3WKMA 2DLSA 3QDOA 4JOFA 1QLCA 2AWXA 3MH7A 4NXRA 2IWQA 2DMZA 2VPHA 4RI0A 1Y8TA 2KV8A 2ENOA 4WYTA 3GCOA 3DORA 2LC6A 2HE4A 4K6YA 1IU2A 3E17A 5FB8C 1VJ6A 1UITA 1X9ZA 2D8IA 5I7ZA 2LOBA 5D13A 1UFXA 1UM7A 2ZPMA 1GM1A 4REYA 2KRGA 3EGGC 2QT5A 2KJPA 4NMRA 2EV8A 1OZIA 3PV2A 4Q2OA 2F0AA 1UEZA 2L97A 3SOEA 3PS4A 2EGKA 3K1RA 1MFGA 4KFWA 4H11A 1WI2A 2I6VA 2MHOA 2FCFA 3I18A 3ID1A 2D92A 1XZ9A 1X6DA 2EEJA 2KAWA 5GNDA 1WI4A 3QJMA 3SHWA 2LC7A 3STJA 4NXQA 3GJ9A 2I1NA 3I1EA 1UEPA 4Q2PA 5HF4A 4NMSA 4Q6HA 2K20A 1V6BA 3BPUA 1WG6A 4PQWA 3PDVA 3RLEA 2JWEA 1UJVA 1RZXA 2H2CA 4OAJA 2IWNA 2RCZA 3GDVA 2AWUA 2YUBA 5E11A 2QKUA 5E21A 2OGPA 2JINA 1WH1A 3GABA 3QIKA 1X8SA 1N6FA 2F5YA 4JOJA 1YBOA 1VCWA 3HPKA 1GQ5A 3OTPA 2EEGA 1VAEA 1P1EA 5EZ0A 4O06A 2YTWA 1WF7A 3KDKA 3CS0A 4K75A 4KFVA 2GZVA 1PDRA 2KOJA 1WFVA 2R3YA 1ZOKA 2HGAA 2EDPA 4UU5A 2EEHA 2Q3GA 1G9OA 2KL1A 2FNEA 2ZPLA 2Z9IA 2KPLA 4NMPA 4YDPA 4JORA 2JIKA 3AXAA 4HOPA 2EAQA 3QJNA 3VQFA 3R69A 2EGOA 1V5QA 4FGMA 1FCFA 5HFBA 3SHUA 2KPKA 1I16A 1RGWA 4UU6A 1X5QA 2KJKA 4JJ0A 5EYZA 5FHTA 1GQ4A 2Q9VA 1WIFA 3HVQC 3KDGA 2DLUA 4Z33A 1BFEA 2WL7A 2KYLA 1UEWA 1ZUBA 5HFFA 1OBXA 1UHPA 5ILBA 2DM8A 2PDZA 1W9OA 1FC9A 1QAUA 1D5GA 1RY4A 2KOHA 3GDSA 2G5MB 2KOMA 1N7FA 1N7EA 1V62A 3ZRTA 3NCVA 1Y7NA 2D90A 2O2TA 4JOEA 2OMJA 4F8KA 1U38A 4NNMA 1KWAA 2QKTA 4WYUA 3FY5A 3R0HA 4Q3HA 1I92A 4JL7A 3RL7A 4GVCA 2L4TA 1KEFA 5DTHA 2EEIA 5G1EA 3QGLA 1WHAA 2RRMA 2E7KA 4K72A 5E1YA 1W9QA 1SOTA 1N7TA 2X7ZA 3LNYA 2JXOA 3NFKA 1U39A 2DKRA 2PKTA 2OQSA 2YT7A 2EHRA 2PKUA 3NFLA 4E3BA 3CYYA 1Q3PA 2M0TA 2CSSA 3DJ3A 3CH8A 1UJUA 2PA1A 2KBSA 1OBZA 2IWOA 1L6OA 3LNXA 3EGHC 3DJ1A 1T2MA 2DC2A 2KG2A 4GVDA 2OPGA 3CC0A 3VQGA 2IWPA 2QBWA 5JXBA 3ID2A 1V1TA 2W4FA 5HDYA 2LA8A 5HFEA 1Z87A 5G1DA 2H2BA 2AINA 2M10A 1UEQA 5HJ1A 4E35A 1FC7A 4JOPA 1TE0A 3QO6A 4FLNA 2YT8A 3PV5A 2I0IA 3GGEA 3DJAA 1X5RA 2H3LA 4NNLA 3JXTA 3O46A 4R2ZA 1QAVB 1N99A 1TQ3A 1Q3OA 3ID4A 4XHVA 5HEBA 3PV4A 1U37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEP A;  3DIW A;  4L8N A;  4IC6 A;  4YYX A;  4AMH A;  2QKV A;  2BYG A;  2OZF A;  3MH4 A;  5H3J A;  1IU0 A;  2HE2 A;  3PDZ A;  2REY A;  2PZD A;  1TP3 A;  2EJY A;  2CS5 A;  1Z86 A;  2R4H A;  2K1Z A;  3GSL A;  2M0V A;  5HED A;  1WHD A;  2JOA A;  4GHN A;  4N6X A;  3NGH A;  1NTE A;  2I4S A;  4EDJ A;  2EXG A;  1R6J A;  5F3X A;  1V5L A;  2Z17 A;  3O5N A;  5E6P B;  3TSW A;  2MX6 A;  2EGN A;  1UF1 A;  3TMH A;  2OCS A;  4P0C A;  2H3M A;  2JIL A;  4K76 A;  3ID3 A;  2W7R A;  3GDU A;  2VSV A;  1UJD A;  2V1W A;  3K50 A;  4JOK A;  2VZ5 A;  1N6E A;  2P3W A;  2DAZ A;  2JRE A;  4NMQ A;  1K32 A;  1B8Q A;  1X5N A;  4NMT A;  2AWW A;  1U3B A;  4E34 A;  5HFD A;  4Q2Q A;  1OBY A;  1TP5 A;  3KZE A;  1WFG A;  2G2L A;  5E22 A;  2PNT A;  2DJT A;  4JOH A;  4Q6S A;  5HET A;  5HEY A;  2M3M A;  3GCN A;  1MC7 A;  1N6D A;  2I0L A;  2KQF A;  4P2A B;  3SUZ A;  2UZC A;  4LMM A;  1MFL A;  3KZD A;  3OU0 A;  3QE1 A;  5GLJ A;  4OEO A;  5HF1 A;  1VA8 A;  1SOZ A;  2OSG A;  1W9E A;  3I4W A;  3B76 A;  4K78 A;  3WKL A;  1VB7 A;  1P1D A;  2VWR A;  3HPM A;  2EDZ A;  4NMO A;  2VRF A;  2M0Z A;  3CBX A;  2L4S A;  3KHF A;  1Q7X A;  3MH6 A;  2KA9 A;  3L4F D;  4Q2N A;  4NXP A;  1WF8 A;  3CBZ A;  2FE5 A;  1LCY A;  5B6L A;  2M0U A;  4MPA A;  2YUY A;  2QG1 A;  1KY9 A;  5HFC A;  4G69 A;  1WJL A;  2OS6 A;  5F67 A;  4Z8J A;  2LUI A;  3R68 A;  3TSZ A;  2KJD A;  4NMV A;  5A2P A;  1FC6 A;  2CSJ A;  1M5Z A;  1BE9 A;  1UM1 A;  1QAV A;  1X45 A;  2VSP A;  2V90 A;  1NF3 C;  2I04 A;  2EDV A;  1RGR A;  2DB5 A;  3SFJ A;  3RL8 A;  3TSV A;  4JOG A;  4HOP B;  3K82 A;  3CBY A;  2FN5 A;  1IHJ A;  3WKM A;  2DLS A;  3QDO A;  4JOF A;  1QLC A;  2AWX A;  3MH7 A;  4NXR A;  2IWQ A;  2DMZ A;  2VPH A;  4RI0 A;  1Y8T A;  2KV8 A;  2ENO A;  4WYT A;  3GCO A;  3DOR A;  2LC6 A;  2HE4 A;  4K6Y A;  1IU2 A;  3E17 A;  5FB8 C;  1VJ6 A;  1UIT A;  2D8I A;  5I7Z A;  2LOB A;  5D13 A;  1UFX A;  1UM7 A;  2ZPM A;  1GM1 A;  4REY A;  2KRG A;  3EGG C;  2QT5 A;  2KJP A;  4NMR A;  2EV8 A;  1OZI A;  3PV2 A;  4Q2O A;  2F0A A;  1UEZ A;  2L97 A;  3SOE A;  3PS4 A;  2EGK A;  3K1R A;  1MFG A;  4KFW A;  4H11 A;  1WI2 A;  2I6V A;  2MHO A;  2FCF A;  3I18 A;  3ID1 A;  2D92 A;  1XZ9 A;  1X6D A;  2EEJ A;  2KAW A;  5GND A;  1WI4 A;  3QJM A;  3SHW A;  2LC7 A;  3STJ A;  4NXQ A;  3GJ9 A;  2I1N A;  3I1E A;  1UEP A;  4Q2P A;  5HF4 A;  4NMS A;  4Q6H A;  2K20 A;  1V6B A;  3BPU A;  1WG6 A;  4PQW A;  3PDV A;  3RLE A;  2JWE A;  1UJV A;  1RZX A;  2H2C A;  4OAJ A;  2IWN A;  2RCZ A;  3GDV A;  2AWU A;  2YUB A;  5E11 A;  2QKU A;  5E21 A;  2OGP A;  2JIN A;  1WH1 A;  3QIK A;  1X8S A;  1N6F A;  2F5Y A;  4JOJ A;  1YBO A;  1VCW A;  3HPK A;  1GQ5 A;  3OTP A;  2EEG A;  1VAE A;  1P1E A;  5EZ0 A;  4O06 A;  2YTW A;  1WF7 A;  3CS0 A;  4K75 A;  4KFV A;  2GZV A;  1PDR A;  2KOJ A;  1WFV A;  2R3Y A;  1ZOK A;  2HGA A;  2EDP A;  4UU5 A;  2EEH A;  2Q3G A;  1G9O A;  2KL1 A;  2FNE A;  2ZPL A;  2Z9I A;  2KPL A;  4NMP A;  4YDP A;  4JOR A;  2JIK A;  3AXA A;  4HOP A;  2EAQ A;  3QJN A;  3VQF A;  3R69 A;  2EGO A;  1V5Q A;  4FGM A;  1FCF A;  5HFB A;  3SHU A;  2KPK A;  1I16 A;  1RGW A;  4UU6 A;  1X5Q A;  2KJK A;  5EYZ A;  5FHT A;  1GQ4 A;  2Q9V A;  1WIF A;  3HVQ C;  2DLU A;  4Z33 A;  1BFE A;  2WL7 A;  2KYL A;  1UEW A;  1ZUB A;  5HFF A;  1OBX A;  1UHP A;  2DM8 A;  2PDZ A;  1W9O A;  1FC9 A;  1QAU A;  1D5G A;  1RY4 A;  2KOH A;  3GDS A;  2G5M B;  2KOM A;  1N7F A;  1N7E A;  1V62 A;  3ZRT A;  1Y7N A;  2D90 A;  2O2T A;  4JOE A;  2OMJ A;  4F8K A;  1U38 A;  4NNM A;  1KWA A;  2QKT A;  4WYU A;  3FY5 A;  3R0H A;  4Q3H A;  1I92 A;  4JL7 A;  3RL7 A;  4GVC A;  2L4T A;  1KEF A;  5DTH A;  2EEI A;  5G1E A;  3QGL A;  1WHA A;  2RRM A;  2E7K A;  4K72 A;  5E1Y A;  1W9Q A;  1SOT A;  1N7T A;  2X7Z A;  3LNY A;  2JXO A;  3NFK A;  1U39 A;  2DKR A;  2PKT A;  2OQS A;  2YT7 A;  2EHR A;  2PKU A;  3NFL A;  4E3B A;  3CYY A;  1Q3P A;  2M0T A;  2CSS A;  3DJ3 A;  3CH8 A;  1UJU A;  2PA1 A;  2KBS A;  1OBZ A;  2IWO A;  1L6O A;  3LNX A;  3EGH C;  3DJ1 A;  1T2M A;  2DC2 A;  2KG2 A;  4GVD A;  2OPG A;  3CC0 A;  3VQG A;  2IWP A;  2QBW A;  5JXB A;  3ID2 A;  1V1T A;  2W4F A;  5HDY A;  2LA8 A;  5HFE A;  1Z87 A;  5G1D A;  2H2B A;  2AIN A;  2M10 A;  1UEQ A;  5HJ1 A;  4E35 A;  1FC7 A;  4JOP A;  1TE0 A;  3QO6 A;  2YT8 A;  3PV5 A;  2I0I A;  3GGE A;  3DJA A;  1X5R A;  2H3L A;  4NNL A;  3JXT A;  3O46 A;  4R2Z A;  1QAV B;  1N99 A;  1TQ3 A;  1Q3O A;  3ID4 A;  4XHV A;  5HEB A;  3PV4 A;  1U37 A; 
#chains in the Genus database with same CATH topology
 4OEP A;  3DIW A;  4L8N A;  4IC6 A;  4YYX A;  4AMH A;  2QKV A;  2BYG A;  2OZF A;  3MH4 A;  5H3J A;  1IU0 A;  2HE2 A;  3PDZ A;  2REY A;  2PZD A;  1TP3 A;  2EJY A;  2CS5 A;  1Z86 A;  2R4H A;  2K1Z A;  3GSL A;  2M0V A;  5HED A;  1WHD A;  2GEF A;  2JOA A;  4GHN A;  4N6X A;  3NGH A;  1NTE A;  4JJ3 A;  2I4S A;  4EDJ A;  2EXG A;  1R6J A;  5F3X A;  1V5L A;  2Z17 A;  3O5N A;  5E6P B;  3TSW A;  2MX6 A;  2EGN A;  1UF1 A;  3TMH A;  2OCS A;  4P0C A;  2H3M A;  2JIL A;  4K76 A;  3ID3 A;  2W7R A;  3GDU A;  2VSV A;  1UJD A;  2V1W A;  3K50 A;  4JOK A;  2VZ5 A;  1N6E A;  2P3W A;  2DAZ A;  2JRE A;  4NMQ A;  1K32 A;  1B8Q A;  1X5N A;  4NMT A;  5B42 A;  2AWW A;  1U3B A;  5IL9 A;  4E34 A;  5HFD A;  4Q2Q A;  1OBY A;  1TP5 A;  3KZE A;  1WFG A;  2G2L A;  5E22 A;  2PNT A;  2DJT A;  4JOH A;  4Q6S A;  5HET A;  5HEY A;  2M3M A;  3GCN A;  1MC7 A;  1N6D A;  2I0L A;  2KQF A;  4P2A B;  3SUZ A;  2UZC A;  4LMM A;  1MFL A;  3KZD A;  3OU0 A;  3QE1 A;  5GLJ A;  4OEO A;  2JSN A;  5HF1 A;  1VA8 A;  1SOZ A;  2OSG A;  1W9E A;  3I4W A;  3B76 A;  4K78 A;  3WKL A;  1VB7 A;  1P1D A;  2VWR A;  3HPM A;  2EDZ A;  4NMO A;  2VRF A;  2M0Z A;  3CBX A;  2L4S A;  3KHF A;  1Q7X A;  3MH6 A;  2KA9 A;  3L4F D;  4Q2N A;  4NXP A;  1WF8 A;  3CBZ A;  2FE5 A;  1LCY A;  5B6L A;  2M0U A;  4MPA A;  2YUY A;  2QG1 A;  1KY9 A;  5HFC A;  4G69 A;  1WJL A;  2OS6 A;  5F67 A;  4Z8J A;  2LUI A;  3R68 A;  3TSZ A;  2KJD A;  4NMV A;  5A2P A;  1FC6 A;  2CSJ A;  1M5Z A;  1BE9 A;  1UM1 A;  1QAV A;  1X45 A;  2VSP A;  2V90 A;  1NF3 C;  2I04 A;  2EDV A;  1RGR A;  2DB5 A;  3SFJ A;  3RL8 A;  3TSV A;  4JOG A;  4HOP B;  3K82 A;  3CBY A;  2FN5 A;  1IHJ A;  3WKM A;  2DLS A;  3QDO A;  4JOF A;  1QLC A;  2AWX A;  3MH7 A;  4NXR A;  2IWQ A;  2DMZ A;  2VPH A;  4RI0 A;  1Y8T A;  2KV8 A;  2ENO A;  4WYT A;  3GCO A;  3DOR A;  2LC6 A;  2HE4 A;  4K6Y A;  1IU2 A;  3E17 A;  5FB8 C;  1VJ6 A;  1UIT A;  1X9Z A;  2D8I A;  5I7Z A;  2LOB A;  5D13 A;  1UFX A;  1UM7 A;  2ZPM A;  1GM1 A;  4REY A;  2KRG A;  3EGG C;  2QT5 A;  2KJP A;  4NMR A;  2EV8 A;  1OZI A;  3PV2 A;  4Q2O A;  2F0A A;  1UEZ A;  2L97 A;  3SOE A;  3PS4 A;  2EGK A;  3K1R A;  1MFG A;  4KFW A;  4H11 A;  1WI2 A;  2I6V A;  2MHO A;  2FCF A;  3I18 A;  3ID1 A;  2D92 A;  1XZ9 A;  1X6D A;  2EEJ A;  2KAW A;  5GND A;  1WI4 A;  3QJM A;  3SHW A;  2LC7 A;  3STJ A;  4NXQ A;  3GJ9 A;  2I1N A;  3I1E A;  1UEP A;  4Q2P A;  5HF4 A;  4NMS A;  4Q6H A;  2K20 A;  1V6B A;  3BPU A;  1WG6 A;  4PQW A;  3PDV A;  3RLE A;  2JWE A;  1UJV A;  1RZX A;  2H2C A;  4OAJ A;  2IWN A;  2RCZ A;  3GDV A;  2AWU A;  2YUB A;  5E11 A;  2QKU A;  5E21 A;  2OGP A;  2JIN A;  1WH1 A;  3GAB A;  3QIK A;  1X8S A;  1N6F A;  2F5Y A;  4JOJ A;  1YBO A;  1VCW A;  3HPK A;  1GQ5 A;  3OTP A;  2EEG A;  1VAE A;  1P1E A;  5EZ0 A;  4O06 A;  2YTW A;  1WF7 A;  3KDK A;  3CS0 A;  4K75 A;  4KFV A;  2GZV A;  1PDR A;  2KOJ A;  1WFV A;  2R3Y A;  1ZOK A;  2HGA A;  2EDP A;  4UU5 A;  2EEH A;  2Q3G A;  1G9O A;  2KL1 A;  2FNE A;  2ZPL A;  2Z9I A;  2KPL A;  4NMP A;  4YDP A;  4JOR A;  2JIK A;  3AXA A;  4HOP A;  2EAQ A;  3QJN A;  3VQF A;  3R69 A;  2EGO A;  1V5Q A;  4FGM A;  1FCF A;  5HFB A;  3SHU A;  2KPK A;  1I16 A;  1RGW A;  4UU6 A;  1X5Q A;  2KJK A;  4JJ0 A;  5EYZ A;  5FHT A;  1GQ4 A;  2Q9V A;  1WIF A;  3HVQ C;  3KDG A;  2DLU A;  4Z33 A;  1BFE A;  2WL7 A;  2KYL A;  1UEW A;  1ZUB A;  5HFF A;  1OBX A;  1UHP A;  5ILB A;  2DM8 A;  2PDZ A;  1W9O A;  1FC9 A;  1QAU A;  1D5G A;  1RY4 A;  2KOH A;  3GDS A;  2G5M B;  2KOM A;  1N7F A;  1N7E A;  1V62 A;  3ZRT A;  3NCV A;  1Y7N A;  2D90 A;  2O2T A;  4JOE A;  2OMJ A;  4F8K A;  1U38 A;  4NNM A;  1KWA A;  2QKT A;  4WYU A;  3FY5 A;  3R0H A;  4Q3H A;  1I92 A;  4JL7 A;  3RL7 A;  4GVC A;  2L4T A;  1KEF A;  5DTH A;  2EEI A;  5G1E A;  3QGL A;  1WHA A;  2RRM A;  2E7K A;  4K72 A;  5E1Y A;  1W9Q A;  1SOT A;  1N7T A;  2X7Z A;  3LNY A;  2JXO A;  3NFK A;  1U39 A;  2DKR A;  2PKT A;  2OQS A;  2YT7 A;  2EHR A;  2PKU A;  3NFL A;  4E3B A;  3CYY A;  1Q3P A;  2M0T A;  2CSS A;  3DJ3 A;  3CH8 A;  1UJU A;  2PA1 A;  2KBS A;  1OBZ A;  2IWO A;  1L6O A;  3LNX A;  3EGH C;  3DJ1 A;  1T2M A;  2DC2 A;  2KG2 A;  4GVD A;  2OPG A;  3CC0 A;  3VQG A;  2IWP A;  2QBW A;  5JXB A;  3ID2 A;  1V1T A;  2W4F A;  5HDY A;  2LA8 A;  5HFE A;  1Z87 A;  5G1D A;  2H2B A;  2AIN A;  2M10 A;  1UEQ A;  5HJ1 A;  4E35 A;  1FC7 A;  4JOP A;  1TE0 A;  3QO6 A;  4FLN A;  2YT8 A;  3PV5 A;  2I0I A;  3GGE A;  3DJA A;  1X5R A;  2H3L A;  4NNL A;  3JXT A;  3O46 A;  4R2Z A;  1QAV B;  1N99 A;  1TQ3 A;  1Q3O A;  3ID4 A;  4XHV A;  5HEB A;  3PV4 A;  1U37 A; 
#chains in the Genus database with same CATH homology
 4OEP A;  3DIW A;  4L8N A;  4IC6 A;  4YYX A;  4AMH A;  2QKV A;  2BYG A;  2OZF A;  3MH4 A;  5H3J A;  1IU0 A;  2HE2 A;  3PDZ A;  2REY A;  2PZD A;  1TP3 A;  2EJY A;  2CS5 A;  1Z86 A;  2R4H A;  2K1Z A;  3GSL A;  2M0V A;  5HED A;  1WHD A;  2GEF A;  2JOA A;  4GHN A;  4N6X A;  3NGH A;  1NTE A;  4JJ3 A;  2I4S A;  4EDJ A;  2EXG A;  1R6J A;  5F3X A;  1V5L A;  2Z17 A;  3O5N A;  5E6P B;  3TSW A;  2MX6 A;  2EGN A;  1UF1 A;  3TMH A;  2OCS A;  4P0C A;  2H3M A;  2JIL A;  4K76 A;  3ID3 A;  2W7R A;  3GDU A;  2VSV A;  1UJD A;  2V1W A;  3K50 A;  4JOK A;  2VZ5 A;  1N6E A;  2P3W A;  2DAZ A;  2JRE A;  4NMQ A;  1K32 A;  1B8Q A;  1X5N A;  4NMT A;  5B42 A;  2AWW A;  1U3B A;  5IL9 A;  4E34 A;  5HFD A;  4Q2Q A;  1OBY A;  1TP5 A;  3KZE A;  1WFG A;  2G2L A;  5E22 A;  2PNT A;  2DJT A;  4JOH A;  4Q6S A;  5HET A;  5HEY A;  2M3M A;  3GCN A;  1MC7 A;  1N6D A;  2I0L A;  2KQF A;  4P2A B;  3SUZ A;  2UZC A;  4LMM A;  1MFL A;  3KZD A;  3OU0 A;  3QE1 A;  5GLJ A;  4OEO A;  2JSN A;  5HF1 A;  1VA8 A;  1SOZ A;  2OSG A;  1W9E A;  3I4W A;  3B76 A;  4K78 A;  3WKL A;  1VB7 A;  1P1D A;  2VWR A;  3HPM A;  2EDZ A;  4NMO A;  2VRF A;  2M0Z A;  3CBX A;  2L4S A;  3KHF A;  1Q7X A;  3MH6 A;  2KA9 A;  3L4F D;  4Q2N A;  4NXP A;  1WF8 A;  3CBZ A;  2FE5 A;  1LCY A;  5B6L A;  2M0U A;  4MPA A;  2YUY A;  2QG1 A;  1KY9 A;  5HFC A;  4G69 A;  1WJL A;  2OS6 A;  5F67 A;  4Z8J A;  2LUI A;  3R68 A;  3TSZ A;  2KJD A;  4NMV A;  5A2P A;  1FC6 A;  2CSJ A;  1M5Z A;  1BE9 A;  1UM1 A;  1QAV A;  1X45 A;  2VSP A;  2V90 A;  1NF3 C;  2I04 A;  2EDV A;  1RGR A;  2DB5 A;  3SFJ A;  3RL8 A;  3TSV A;  4JOG A;  4HOP B;  3K82 A;  3CBY A;  2FN5 A;  1IHJ A;  3WKM A;  2DLS A;  3QDO A;  4JOF A;  1QLC A;  2AWX A;  3MH7 A;  4NXR A;  2IWQ A;  2DMZ A;  2VPH A;  4RI0 A;  1Y8T A;  2KV8 A;  2ENO A;  4WYT A;  3GCO A;  3DOR A;  2LC6 A;  2HE4 A;  4K6Y A;  1IU2 A;  3E17 A;  5FB8 C;  1VJ6 A;  1UIT A;  1X9Z A;  2D8I A;  5I7Z A;  2LOB A;  5D13 A;  1UFX A;  1UM7 A;  2ZPM A;  1GM1 A;  4REY A;  2KRG A;  3EGG C;  2QT5 A;  2KJP A;  4NMR A;  2EV8 A;  1OZI A;  3PV2 A;  4Q2O A;  2F0A A;  1UEZ A;  2L97 A;  3SOE A;  3PS4 A;  2EGK A;  3K1R A;  1MFG A;  4KFW A;  4H11 A;  1WI2 A;  2I6V A;  2MHO A;  2FCF A;  3I18 A;  3ID1 A;  2D92 A;  1XZ9 A;  1X6D A;  2EEJ A;  2KAW A;  5GND A;  1WI4 A;  3QJM A;  3SHW A;  2LC7 A;  3STJ A;  4NXQ A;  3GJ9 A;  2I1N A;  3I1E A;  1UEP A;  4Q2P A;  5HF4 A;  4NMS A;  4Q6H A;  2K20 A;  1V6B A;  3BPU A;  1WG6 A;  4PQW A;  3PDV A;  3RLE A;  2JWE A;  1UJV A;  1RZX A;  2H2C A;  4OAJ A;  2IWN A;  2RCZ A;  3GDV A;  2AWU A;  2YUB A;  5E11 A;  2QKU A;  5E21 A;  2OGP A;  2JIN A;  1WH1 A;  3GAB A;  3QIK A;  1X8S A;  1N6F A;  2F5Y A;  4JOJ A;  1YBO A;  1VCW A;  3HPK A;  1GQ5 A;  3OTP A;  2EEG A;  1VAE A;  1P1E A;  5EZ0 A;  4O06 A;  2YTW A;  1WF7 A;  3KDK A;  3CS0 A;  4K75 A;  4KFV A;  2GZV A;  1PDR A;  2KOJ A;  1WFV A;  2R3Y A;  1ZOK A;  2HGA A;  2EDP A;  4UU5 A;  2EEH A;  2Q3G A;  1G9O A;  2KL1 A;  2FNE A;  2ZPL A;  2Z9I A;  2KPL A;  4NMP A;  4YDP A;  4JOR A;  2JIK A;  3AXA A;  4HOP A;  2EAQ A;  3QJN A;  3VQF A;  3R69 A;  2EGO A;  1V5Q A;  4FGM A;  1FCF A;  5HFB A;  3SHU A;  2KPK A;  1I16 A;  1RGW A;  4UU6 A;  1X5Q A;  2KJK A;  4JJ0 A;  5EYZ A;  5FHT A;  1GQ4 A;  2Q9V A;  1WIF A;  3HVQ C;  3KDG A;  2DLU A;  4Z33 A;  1BFE A;  2WL7 A;  2KYL A;  1UEW A;  1ZUB A;  5HFF A;  1OBX A;  1UHP A;  5ILB A;  2DM8 A;  2PDZ A;  1W9O A;  1FC9 A;  1QAU A;  1D5G A;  1RY4 A;  2KOH A;  3GDS A;  2G5M B;  2KOM A;  1N7F A;  1N7E A;  1V62 A;  3ZRT A;  3NCV A;  1Y7N A;  2D90 A;  2O2T A;  4JOE A;  2OMJ A;  4F8K A;  1U38 A;  4NNM A;  1KWA A;  2QKT A;  4WYU A;  3FY5 A;  3R0H A;  4Q3H A;  1I92 A;  4JL7 A;  3RL7 A;  4GVC A;  2L4T A;  1KEF A;  5DTH A;  2EEI A;  5G1E A;  3QGL A;  1WHA A;  2RRM A;  2E7K A;  4K72 A;  5E1Y A;  1W9Q A;  1SOT A;  1N7T A;  2X7Z A;  3LNY A;  2JXO A;  3NFK A;  1U39 A;  2DKR A;  2PKT A;  2OQS A;  2YT7 A;  2EHR A;  2PKU A;  3NFL A;  4E3B A;  3CYY A;  1Q3P A;  2M0T A;  2CSS A;  3DJ3 A;  3CH8 A;  1UJU A;  2PA1 A;  2KBS A;  1OBZ A;  2IWO A;  1L6O A;  3LNX A;  3EGH C;  3DJ1 A;  1T2M A;  2DC2 A;  2KG2 A;  4GVD A;  2OPG A;  3CC0 A;  3VQG A;  2IWP A;  2QBW A;  5JXB A;  3ID2 A;  1V1T A;  2W4F A;  5HDY A;  2LA8 A;  5HFE A;  1Z87 A;  5G1D A;  2H2B A;  2AIN A;  2M10 A;  1UEQ A;  5HJ1 A;  4E35 A;  1FC7 A;  4JOP A;  1TE0 A;  3QO6 A;  4FLN A;  2YT8 A;  3PV5 A;  2I0I A;  3GGE A;  3DJA A;  1X5R A;  2H3L A;  4NNL A;  3JXT A;  3O46 A;  4R2Z A;  1QAV B;  1N99 A;  1TQ3 A;  1Q3O A;  3ID4 A;  4XHV A;  5HEB A;  3PV4 A;  1U37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...