3KZEA

Crystal structure of t-cell lymphoma invasion and metastasis-1 pdz in complex with ssrkeyya peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
93
structure length
93
Chain Sequence
AMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-lymphoma invasion and metastasis-inducing protein 1
publication title The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3kzeA00
2M0UA 2IWQA 3R68A 2OMJA 1X8SA 1QAUA 2L4SA 4Q2PA 1U3BA 4MPAA 2VWRA 3ID3A 4RI0A 4E35A 1WI4A 5DTHA 3R0HA 1UM7A 4REYA 4LMMA 2FCFA 4NMTA 4NXRA 3GSLA 3SOEA 2YUBA 2K20A 4L8NA 4Q6SA 5HFDA 1X5QA 1OBZA 2EAQA 1ZUBA 3CYYA 3SHWA 4YDPA 4KFVA 3SUZA 2CS5A 4HOPA 2KRGA 2EGOA 1GQ5A 1TQ3A 1Q3PA 1Y8TA 2DLSA 1WHAA 1V5LA 4FGMA 2KBSA 4OEOA 4E3BA 2P3WA 2H2BA 2JIKA 2W4FA 5G1EA 1RZXA 2KOJA 3O46A 3TMHA 1L6OA 4NMQA 1QAVB 3DJ1A 5HF1A 3GGEA 1RY4A 3ZRTA 3MH7A 5E11A 3QGLA 3CH8A 1W9OA 3CBXA 3CBZA 1FCFA 2QKVA 1P1DA 2OGPA 5FB8C 2M3MA 1UM1A 2Z17A 1B8QA 1WF8A 4NXQA 2GZVA 2I4SA 4E34A 1WI2A 4Q2OA 3DIWA 2EEHA 1MC7A 1OZIA 2EDZA 2LC6A 1D5GA 5E21A 3NGHA 5B6LA 2E7KA 3EGHC 2ZPLA 1TE0A 1UJUA 3GDSA 1X45A 1TP3A 5HEYA 2OQSA 3STJA 1RGRA 1NF3C 1OBYA 5F3XA 2AINA 2L97A 3KZDA 1R6JA 2LC7A 1IHJA 2RRMA 5H3JA 3HPMA 3MH6A 2IWPA 1QLCA 2W7RA 1U37A 2VSVA 4NMPA 1VB7A 4Q3HA 2PKTA 1MFLA 1WFGA 1LCYA 3CC0A 3KZEA 2EEGA 4Z33A 2X7ZA 1WJLA 3GDUA 1RGWA 2JOAA 2PA1A 3I4WA 4GVDA 2DM8A 2YUYA 2EEJA 2EXGA 4JL7A 4Q2QA 3VQFA 3ID2A 4JOGA 2Q9VA 2I04A 5EZ0A 2I0IA 5EYZA 2VZ5A 3PDZA 1K32A 1YBOA 2G2LA 2KV8A 2LUIA 5GNDA 1Y7NA 1W9QA 1UHPA 2KL1A 2I6VA 3SFJA 4Z8JA 1M5ZA 2DKRA 2BYGA 2KAWA 3HPKA 3B76A 3GCNA 2L4TA 1P1EA 1N6FA 3QJMA 2JILA 5D13A 2QBWA 1UF1A 4OEPA 2D90A 2KQFA 2DLUA 1Q7XA 2I1NA 3OTPA 2PDZA 4K78A 1V5QA 4N6XA 2IWOA 1WIFA 2EGNA 3TSZA 1T2MA 2HE4A 3NFLA 2FNEA 2QKUA 1N7EA 3QJNA 2OPGA 2F5YA 1X5NA 2OS6A 3K1RA 3MH4A 2HGAA 2VRFA 5HEDA 4F8KA 1UEQA 2KPKA 2MHOA 1UFXA 1TP5A 1U38A 1PDRA 2ENOA 3NFKA 1FC6A 4JOJA 5HFEA 2Q3GA 1WFVA 3E17A 3PDVA 4JOEA 2QT5A 1N7TA 2KJDA 1OBXA 2KG2A 1IU2A 3TSWA 2FN5A 1Z87A 2Z9IA 3EGGC 2H3MA 2OCSA 3TSVA 3QDOA 2QG1A 2D92A 1MFGA 3I1EA 3RL7A 4EDJA 1VA8A 5E1YA 2M0ZA 3QIKA 1N7FA 2DAZA 3WKMA 2EEIA 4NMVA 2LA8A 1N99A 2CSSA 3CBYA 2EDVA 1U39A 3RLEA 1N6EA 2CSJA 5A2PA 5HFFA 4K76A 4PQWA 3GDVA 1VJ6A 3FY5A 4NMSA 3BPUA 5FHTA 1ZOKA 1Z86A 2LOBA 4K72A 2FE5A 2EJYA 3CS0A 2DMZA 3K82A 1X5RA 4UU6A 3JXTA 3QE1A 2OSGA 3PV5A 4NNMA 2RCZA 4GVCA 5JXBA 2VPHA 5HF4A 3VQGA 1V6BA 2EGKA 3AXAA 2F0AA 4YYXA 2M0TA 4KFWA 4GHNA 2V1WA 2MX6A 2YTWA 2M10A 1I16A 1WF7A 2EDPA 2HE2A 1WHDA 2R4HA 3R69A 5HEBA 4JORA 2JINA 1SOZA 2IWNA 5HJ1A 4P2AB 1N6DA 3K50A 4OAJA 4JOHA 1UJDA 2KJPA 1BE9A 2JXOA 1KEFA 1V62A 4G69A 4NNLA 1KY9A 1WH1A 4R2ZA 3PS4A 2VSPA 4WYTA 4WYUA 2AWWA 1IU0A 2DC2A 3GJ9A 3ID1A 4JOPA 2AWXA 5HFCA 5HETA 1UEWA 3DJAA 2KJKA 2PKUA 2KPLA 2PNTA 3SHUA 1I92A 3ID4A 4NMOA 5I7ZA 1X6DA 5F67A 2ZPMA 1UJVA 4Q6HA 1UEZA 5G1DA 2PZDA 2M0VA 2YT8A 3QO6A 2QKTA 1UITA 4H11A 1KWAA 2DB5A 5E22A 1V1TA 5HFBA 1BFEA 4NMRA 2V90A 1XZ9A 3PV2A 2KOMA 2O2TA 2YT7A 3DORA 1FC9A 3DJ3A 3O5NA 3L4FD 1NTEA 2JWEA 4Q2NA 1FC7A 2EHRA 1SOTA 5HDYA 2EV8A 4JOFA 4P0CA 2DJTA 5GLJA 2WL7A 3OU0A 4K6YA 4IC6A 2H2CA 1VAEA 2D8IA 2H3LA 2JREA 3KHFA 2R3YA 4HOPB 4AMHA 4O06A 1GM1A 5E6PB 1G9OA 3LNYA 4XHVA 3RL8A 2K1ZA 2UZCA 2KA9A 3I18A 3GCOA 4JOKA 1UEPA 1QAVA 3PV4A 1GQ4A 2KYLA 4NXPA 2I0LA 4UU5A 2OZFA 2AWUA 2KOHA 1VCWA 2REYA 1W9EA 3WKLA 1Q3OA 1WG6A 3HVQC 3LNXA 4K75A 2G5MB
chains in the Genus database with same CATH superfamily
2M0UA 2IWQA 3R68A 2OMJA 1X8SA 1QAUA 2L4SA 4Q2PA 1U3BA 4MPAA 2VWRA 3ID3A 4RI0A 4E35A 1WI4A 5DTHA 3R0HA 1UM7A 4REYA 4LMMA 2FCFA 4NMTA 4NXRA 3GSLA 3SOEA 2YUBA 2K20A 4L8NA 4Q6SA 5HFDA 1X5QA 1OBZA 2EAQA 1ZUBA 3CYYA 3SHWA 4YDPA 4KFVA 3SUZA 2CS5A 4HOPA 2KRGA 2EGOA 1GQ5A 1TQ3A 1Q3PA 1Y8TA 2DLSA 1WHAA 1V5LA 4FGMA 2KBSA 4OEOA 4E3BA 2P3WA 2H2BA 2JIKA 2W4FA 5G1EA 1RZXA 2KOJA 3O46A 3TMHA 1L6OA 4NMQA 1QAVB 3DJ1A 5HF1A 3GGEA 1RY4A 2JSNA 3ZRTA 3MH7A 5E11A 3QGLA 3CH8A 1W9OA 3CBXA 3CBZA 1FCFA 2QKVA 1P1DA 2OGPA 5FB8C 2M3MA 1UM1A 2Z17A 1B8QA 1WF8A 4NXQA 2GZVA 2I4SA 4E34A 1WI2A 3GABA 4Q2OA 3DIWA 2EEHA 1MC7A 1OZIA 2EDZA 2LC6A 1D5GA 5E21A 3NGHA 5B6LA 2E7KA 3EGHC 2ZPLA 1TE0A 1UJUA 3GDSA 1X45A 1TP3A 5HEYA 2OQSA 3STJA 1RGRA 1NF3C 1OBYA 5F3XA 2AINA 2L97A 3KZDA 1R6JA 2LC7A 1IHJA 2RRMA 5H3JA 3HPMA 3MH6A 2IWPA 1QLCA 2W7RA 1U37A 2VSVA 4NMPA 1VB7A 4Q3HA 2PKTA 1MFLA 1WFGA 1LCYA 3CC0A 3KZEA 2EEGA 4Z33A 2X7ZA 5IL9A 1WJLA 3GDUA 1RGWA 2JOAA 2PA1A 3I4WA 4GVDA 2DM8A 2YUYA 2EEJA 3KDKA 2EXGA 4JL7A 4Q2QA 3VQFA 3ID2A 4JOGA 2Q9VA 2I04A 5EZ0A 2I0IA 5EYZA 2VZ5A 3PDZA 1K32A 1YBOA 2G2LA 2KV8A 2LUIA 5GNDA 1Y7NA 1W9QA 1UHPA 2KL1A 2I6VA 3SFJA 4Z8JA 1M5ZA 2DKRA 2BYGA 2KAWA 3HPKA 3B76A 3GCNA 2L4TA 1P1EA 1N6FA 3QJMA 2JILA 5D13A 2QBWA 1UF1A 4OEPA 2D90A 2KQFA 2DLUA 1Q7XA 2I1NA 3OTPA 2PDZA 5ILBA 4K78A 1V5QA 4N6XA 2IWOA 1WIFA 2EGNA 3TSZA 1T2MA 4JJ0A 2HE4A 3NFLA 2FNEA 2QKUA 1N7EA 3QJNA 2OPGA 4JJ3A 2F5YA 1X5NA 2OS6A 3K1RA 3MH4A 2HGAA 2VRFA 5HEDA 4F8KA 1UEQA 2KPKA 2MHOA 1UFXA 1TP5A 1U38A 1PDRA 2ENOA 3NFKA 1FC6A 4JOJA 4FLNA 5HFEA 2Q3GA 1WFVA 3E17A 3PDVA 4JOEA 2QT5A 1N7TA 2KJDA 1OBXA 2KG2A 1IU2A 3TSWA 2FN5A 1Z87A 2Z9IA 3EGGC 2H3MA 2OCSA 3TSVA 3QDOA 2QG1A 2D92A 1MFGA 3I1EA 3RL7A 4EDJA 1VA8A 5E1YA 2M0ZA 3QIKA 1N7FA 2DAZA 3WKMA 2EEIA 4NMVA 2LA8A 1N99A 2CSSA 3CBYA 2EDVA 1U39A 3RLEA 1N6EA 2CSJA 5A2PA 5HFFA 4K76A 4PQWA 3GDVA 1VJ6A 3FY5A 4NMSA 3BPUA 5FHTA 1ZOKA 1Z86A 2LOBA 4K72A 2FE5A 2EJYA 3CS0A 2DMZA 3K82A 1X5RA 4UU6A 3JXTA 3QE1A 2OSGA 3PV5A 4NNMA 2RCZA 4GVCA 5JXBA 2VPHA 5HF4A 3VQGA 1V6BA 2EGKA 3AXAA 2F0AA 4YYXA 2M0TA 4KFWA 4GHNA 2V1WA 2MX6A 2YTWA 2M10A 1I16A 1WF7A 2EDPA 2HE2A 1X9ZA 1WHDA 2R4HA 3R69A 5HEBA 4JORA 2JINA 1SOZA 2IWNA 5HJ1A 4P2AB 1N6DA 3K50A 4OAJA 4JOHA 1UJDA 2KJPA 1BE9A 3NCVA 2JXOA 1KEFA 1V62A 4G69A 4NNLA 1KY9A 1WH1A 4R2ZA 3PS4A 2VSPA 4WYTA 4WYUA 2AWWA 1IU0A 2DC2A 3GJ9A 3ID1A 4JOPA 2AWXA 5HFCA 5HETA 1UEWA 3DJAA 2KJKA 2PKUA 2KPLA 2PNTA 3SHUA 1I92A 3ID4A 4NMOA 5I7ZA 1X6DA 5F67A 2ZPMA 1UJVA 4Q6HA 1UEZA 5G1DA 2PZDA 2M0VA 2YT8A 3QO6A 2QKTA 1UITA 4H11A 1KWAA 2DB5A 5E22A 1V1TA 5HFBA 1BFEA 4NMRA 2V90A 1XZ9A 3PV2A 2KOMA 2O2TA 2YT7A 3DORA 1FC9A 3DJ3A 3O5NA 3L4FD 1NTEA 2JWEA 4Q2NA 1FC7A 2EHRA 1SOTA 5HDYA 2EV8A 4JOFA 4P0CA 2DJTA 5GLJA 2WL7A 3OU0A 4K6YA 4IC6A 2H2CA 1VAEA 2D8IA 2H3LA 2JREA 3KHFA 2R3YA 2GEFA 5B42A 4HOPB 4AMHA 4O06A 1GM1A 5E6PB 1G9OA 3LNYA 4XHVA 3RL8A 2K1ZA 3KDGA 2UZCA 2KA9A 3I18A 3GCOA 4JOKA 1UEPA 1QAVA 3PV4A 1GQ4A 2KYLA 4NXPA 2I0LA 4UU5A 2OZFA 2AWUA 2KOHA 1VCWA 2REYA 1W9EA 3WKLA 1Q3OA 1WG6A 3HVQC 3LNXA 4K75A 2G5MB
chains in the Genus database with same CATH topology
2M0UA 2IWQA 3R68A 2OMJA 1X8SA 1QAUA 2L4SA 4Q2PA 1U3BA 4MPAA 2VWRA 3ID3A 4RI0A 4E35A 1WI4A 5DTHA 3R0HA 1UM7A 4REYA 4LMMA 2FCFA 4NMTA 4NXRA 3GSLA 3SOEA 2YUBA 2K20A 4L8NA 4Q6SA 5HFDA 1X5QA 1OBZA 2EAQA 1ZUBA 3CYYA 3SHWA 4YDPA 4KFVA 3SUZA 2CS5A 4HOPA 2KRGA 2EGOA 1GQ5A 1TQ3A 1Q3PA 1Y8TA 2DLSA 1WHAA 1V5LA 4FGMA 2KBSA 4OEOA 4E3BA 2P3WA 2H2BA 2JIKA 2W4FA 5G1EA 1RZXA 2KOJA 3O46A 3TMHA 1L6OA 4NMQA 1QAVB 3DJ1A 5HF1A 3GGEA 1RY4A 2JSNA 3ZRTA 3MH7A 5E11A 3QGLA 3CH8A 1W9OA 3CBXA 3CBZA 1FCFA 2QKVA 1P1DA 2OGPA 5FB8C 2M3MA 1UM1A 2Z17A 1B8QA 1WF8A 4NXQA 2GZVA 2I4SA 4E34A 1WI2A 3GABA 4Q2OA 3DIWA 2EEHA 1MC7A 1OZIA 2EDZA 2LC6A 1D5GA 5E21A 3NGHA 5B6LA 2E7KA 3EGHC 2ZPLA 1TE0A 1UJUA 3GDSA 1X45A 1TP3A 5HEYA 2OQSA 3STJA 1RGRA 1NF3C 1OBYA 5F3XA 2AINA 2L97A 3KZDA 1R6JA 2LC7A 1IHJA 2RRMA 5H3JA 3HPMA 3MH6A 2IWPA 1QLCA 2W7RA 1U37A 2VSVA 4NMPA 1VB7A 4Q3HA 2PKTA 1MFLA 1WFGA 1LCYA 3CC0A 3KZEA 2EEGA 4Z33A 2X7ZA 5IL9A 1WJLA 3GDUA 1RGWA 2JOAA 2PA1A 3I4WA 4GVDA 2DM8A 2YUYA 2EEJA 3KDKA 2EXGA 4JL7A 4Q2QA 3VQFA 3ID2A 4JOGA 2Q9VA 2I04A 5EZ0A 2I0IA 5EYZA 2VZ5A 3PDZA 1K32A 1YBOA 2G2LA 2KV8A 2LUIA 5GNDA 1Y7NA 1W9QA 1UHPA 2KL1A 2I6VA 3SFJA 4Z8JA 1M5ZA 2DKRA 2BYGA 2KAWA 3HPKA 3B76A 3GCNA 2L4TA 1P1EA 1N6FA 3QJMA 2JILA 5D13A 2QBWA 1UF1A 4OEPA 2D90A 2KQFA 2DLUA 1Q7XA 2I1NA 3OTPA 2PDZA 5ILBA 4K78A 1V5QA 4N6XA 2IWOA 1WIFA 2EGNA 3TSZA 1T2MA 4JJ0A 2HE4A 3NFLA 2FNEA 2QKUA 1N7EA 3QJNA 2OPGA 4JJ3A 2F5YA 1X5NA 2OS6A 3K1RA 3MH4A 2HGAA 2VRFA 5HEDA 4F8KA 1UEQA 2KPKA 2MHOA 1UFXA 1TP5A 1U38A 1PDRA 2ENOA 3NFKA 1FC6A 4JOJA 4FLNA 5HFEA 2Q3GA 1WFVA 3E17A 3PDVA 4JOEA 2QT5A 1N7TA 2KJDA 1OBXA 2KG2A 1IU2A 3TSWA 2FN5A 1Z87A 2Z9IA 3EGGC 2H3MA 2OCSA 3TSVA 3QDOA 2QG1A 2D92A 1MFGA 3I1EA 3RL7A 4EDJA 1VA8A 5E1YA 2M0ZA 3QIKA 1N7FA 2DAZA 3WKMA 2EEIA 4NMVA 2LA8A 1N99A 2CSSA 3CBYA 2EDVA 1U39A 3RLEA 1N6EA 2CSJA 5A2PA 5HFFA 4K76A 4PQWA 3GDVA 1VJ6A 3FY5A 4NMSA 3BPUA 5FHTA 1ZOKA 1Z86A 2LOBA 4K72A 2FE5A 2EJYA 3CS0A 2DMZA 3K82A 1X5RA 4UU6A 3JXTA 3QE1A 2OSGA 3PV5A 4NNMA 2RCZA 4GVCA 5JXBA 2VPHA 5HF4A 3VQGA 1V6BA 2EGKA 3AXAA 2F0AA 4YYXA 2M0TA 4KFWA 4GHNA 2V1WA 2MX6A 2YTWA 2M10A 1I16A 1WF7A 2EDPA 2HE2A 1X9ZA 1WHDA 2R4HA 3R69A 5HEBA 4JORA 2JINA 1SOZA 2IWNA 5HJ1A 4P2AB 1N6DA 3K50A 4OAJA 4JOHA 1UJDA 2KJPA 1BE9A 3NCVA 2JXOA 1KEFA 1V62A 4G69A 4NNLA 1KY9A 1WH1A 4R2ZA 3PS4A 2VSPA 4WYTA 4WYUA 2AWWA 1IU0A 2DC2A 3GJ9A 3ID1A 4JOPA 2AWXA 5HFCA 5HETA 1UEWA 3DJAA 2KJKA 2PKUA 2KPLA 2PNTA 3SHUA 1I92A 3ID4A 4NMOA 5I7ZA 1X6DA 5F67A 2ZPMA 1UJVA 4Q6HA 1UEZA 5G1DA 2PZDA 2M0VA 2YT8A 3QO6A 2QKTA 1UITA 4H11A 1KWAA 2DB5A 5E22A 1V1TA 5HFBA 1BFEA 4NMRA 2V90A 1XZ9A 3PV2A 2KOMA 2O2TA 2YT7A 3DORA 1FC9A 3DJ3A 3O5NA 3L4FD 1NTEA 2JWEA 4Q2NA 1FC7A 2EHRA 1SOTA 5HDYA 2EV8A 4JOFA 4P0CA 2DJTA 5GLJA 2WL7A 3OU0A 4K6YA 4IC6A 2H2CA 1VAEA 2D8IA 2H3LA 2JREA 3KHFA 2R3YA 2GEFA 5B42A 4HOPB 4AMHA 4O06A 1GM1A 5E6PB 1G9OA 3LNYA 4XHVA 3RL8A 2K1ZA 3KDGA 2UZCA 2KA9A 3I18A 3GCOA 4JOKA 1UEPA 1QAVA 3PV4A 1GQ4A 2KYLA 4NXPA 2I0LA 4UU5A 2OZFA 2AWUA 2KOHA 1VCWA 2REYA 1W9EA 3WKLA 1Q3OA 1WG6A 3HVQC 3LNXA 4K75A 2G5MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0U A;  2IWQ A;  3R68 A;  2OMJ A;  1X8S A;  1QAU A;  2L4S A;  4Q2P A;  1U3B A;  4MPA A;  2VWR A;  3ID3 A;  4RI0 A;  4E35 A;  1WI4 A;  5DTH A;  3R0H A;  1UM7 A;  4REY A;  4LMM A;  2FCF A;  4NMT A;  4NXR A;  3GSL A;  3SOE A;  2YUB A;  2K20 A;  4L8N A;  4Q6S A;  5HFD A;  1X5Q A;  1OBZ A;  2EAQ A;  1ZUB A;  3CYY A;  3SHW A;  4YDP A;  4KFV A;  3SUZ A;  2CS5 A;  4HOP A;  2KRG A;  2EGO A;  1GQ5 A;  1TQ3 A;  1Q3P A;  1Y8T A;  2DLS A;  1WHA A;  1V5L A;  4FGM A;  2KBS A;  4OEO A;  4E3B A;  2P3W A;  2H2B A;  2JIK A;  2W4F A;  5G1E A;  1RZX A;  2KOJ A;  3O46 A;  3TMH A;  1L6O A;  4NMQ A;  1QAV B;  3DJ1 A;  5HF1 A;  3GGE A;  1RY4 A;  3ZRT A;  3MH7 A;  5E11 A;  3QGL A;  3CH8 A;  1W9O A;  3CBX A;  3CBZ A;  1FCF A;  2QKV A;  1P1D A;  2OGP A;  5FB8 C;  2M3M A;  1UM1 A;  2Z17 A;  1B8Q A;  1WF8 A;  4NXQ A;  2GZV A;  2I4S A;  4E34 A;  1WI2 A;  4Q2O A;  3DIW A;  2EEH A;  1MC7 A;  1OZI A;  2EDZ A;  2LC6 A;  1D5G A;  5E21 A;  3NGH A;  5B6L A;  2E7K A;  3EGH C;  2ZPL A;  1TE0 A;  1UJU A;  3GDS A;  1X45 A;  1TP3 A;  5HEY A;  2OQS A;  3STJ A;  1RGR A;  1NF3 C;  1OBY A;  5F3X A;  2AIN A;  2L97 A;  3KZD A;  1R6J A;  2LC7 A;  1IHJ A;  2RRM A;  5H3J A;  3HPM A;  3MH6 A;  2IWP A;  1QLC A;  2W7R A;  1U37 A;  2VSV A;  4NMP A;  1VB7 A;  4Q3H A;  2PKT A;  1MFL A;  1WFG A;  1LCY A;  3CC0 A;  3KZE A;  2EEG A;  4Z33 A;  2X7Z A;  1WJL A;  3GDU A;  1RGW A;  2JOA A;  2PA1 A;  3I4W A;  4GVD A;  2DM8 A;  2YUY A;  2EEJ A;  2EXG A;  4JL7 A;  4Q2Q A;  3VQF A;  3ID2 A;  4JOG A;  2Q9V A;  2I04 A;  5EZ0 A;  2I0I A;  5EYZ A;  2VZ5 A;  3PDZ A;  1K32 A;  1YBO A;  2G2L A;  2KV8 A;  2LUI A;  5GND A;  1Y7N A;  1W9Q A;  1UHP A;  2KL1 A;  2I6V A;  3SFJ A;  4Z8J A;  1M5Z A;  2DKR A;  2BYG A;  2KAW A;  3HPK A;  3B76 A;  3GCN A;  2L4T A;  1P1E A;  1N6F A;  3QJM A;  2JIL A;  5D13 A;  2QBW A;  1UF1 A;  4OEP A;  2D90 A;  2KQF A;  2DLU A;  1Q7X A;  2I1N A;  3OTP A;  2PDZ A;  4K78 A;  1V5Q A;  4N6X A;  2IWO A;  1WIF A;  2EGN A;  3TSZ A;  1T2M A;  2HE4 A;  3NFL A;  2FNE A;  2QKU A;  1N7E A;  3QJN A;  2OPG A;  2F5Y A;  1X5N A;  2OS6 A;  3K1R A;  3MH4 A;  2HGA A;  2VRF A;  5HED A;  4F8K A;  1UEQ A;  2KPK A;  2MHO A;  1UFX A;  1TP5 A;  1U38 A;  1PDR A;  2ENO A;  3NFK A;  1FC6 A;  4JOJ A;  5HFE A;  2Q3G A;  1WFV A;  3E17 A;  3PDV A;  4JOE A;  2QT5 A;  1N7T A;  2KJD A;  1OBX A;  2KG2 A;  1IU2 A;  3TSW A;  2FN5 A;  1Z87 A;  2Z9I A;  3EGG C;  2H3M A;  2OCS A;  3TSV A;  3QDO A;  2QG1 A;  2D92 A;  1MFG A;  3I1E A;  3RL7 A;  4EDJ A;  1VA8 A;  5E1Y A;  2M0Z A;  3QIK A;  1N7F A;  2DAZ A;  3WKM A;  2EEI A;  4NMV A;  2LA8 A;  1N99 A;  2CSS A;  3CBY A;  2EDV A;  1U39 A;  3RLE A;  1N6E A;  2CSJ A;  5A2P A;  5HFF A;  4K76 A;  4PQW A;  3GDV A;  1VJ6 A;  3FY5 A;  4NMS A;  3BPU A;  5FHT A;  1ZOK A;  1Z86 A;  2LOB A;  4K72 A;  2FE5 A;  2EJY A;  3CS0 A;  2DMZ A;  3K82 A;  1X5R A;  4UU6 A;  3JXT A;  3QE1 A;  2OSG A;  3PV5 A;  4NNM A;  2RCZ A;  4GVC A;  5JXB A;  2VPH A;  5HF4 A;  3VQG A;  1V6B A;  2EGK A;  3AXA A;  2F0A A;  4YYX A;  2M0T A;  4KFW A;  4GHN A;  2V1W A;  2MX6 A;  2YTW A;  2M10 A;  1I16 A;  1WF7 A;  2EDP A;  2HE2 A;  1WHD A;  2R4H A;  3R69 A;  5HEB A;  4JOR A;  2JIN A;  1SOZ A;  2IWN A;  5HJ1 A;  4P2A B;  1N6D A;  3K50 A;  4OAJ A;  4JOH A;  1UJD A;  2KJP A;  1BE9 A;  2JXO A;  1KEF A;  1V62 A;  4G69 A;  4NNL A;  1KY9 A;  1WH1 A;  4R2Z A;  3PS4 A;  2VSP A;  4WYT A;  4WYU A;  2AWW A;  1IU0 A;  2DC2 A;  3GJ9 A;  3ID1 A;  4JOP A;  2AWX A;  5HFC A;  5HET A;  1UEW A;  3DJA A;  2KJK A;  2PKU A;  2KPL A;  2PNT A;  3SHU A;  1I92 A;  3ID4 A;  4NMO A;  5I7Z A;  1X6D A;  5F67 A;  2ZPM A;  1UJV A;  4Q6H A;  1UEZ A;  5G1D A;  2PZD A;  2M0V A;  2YT8 A;  3QO6 A;  2QKT A;  1UIT A;  4H11 A;  1KWA A;  2DB5 A;  5E22 A;  1V1T A;  5HFB A;  1BFE A;  4NMR A;  2V90 A;  1XZ9 A;  3PV2 A;  2KOM A;  2O2T A;  2YT7 A;  3DOR A;  1FC9 A;  3DJ3 A;  3O5N A;  3L4F D;  1NTE A;  2JWE A;  4Q2N A;  1FC7 A;  2EHR A;  1SOT A;  5HDY A;  2EV8 A;  4JOF A;  4P0C A;  2DJT A;  5GLJ A;  2WL7 A;  3OU0 A;  4K6Y A;  4IC6 A;  2H2C A;  1VAE A;  2D8I A;  2H3L A;  2JRE A;  3KHF A;  2R3Y A;  4HOP B;  4AMH A;  4O06 A;  1GM1 A;  5E6P B;  1G9O A;  3LNY A;  4XHV A;  3RL8 A;  2K1Z A;  2UZC A;  2KA9 A;  3I18 A;  3GCO A;  4JOK A;  1UEP A;  1QAV A;  3PV4 A;  1GQ4 A;  2KYL A;  4NXP A;  2I0L A;  4UU5 A;  2OZF A;  2AWU A;  2KOH A;  1VCW A;  2REY A;  1W9E A;  3WKL A;  1Q3O A;  1WG6 A;  3HVQ C;  3LNX A;  4K75 A;  2G5M B; 
#chains in the Genus database with same CATH topology
 2M0U A;  2IWQ A;  3R68 A;  2OMJ A;  1X8S A;  1QAU A;  2L4S A;  4Q2P A;  1U3B A;  4MPA A;  2VWR A;  3ID3 A;  4RI0 A;  4E35 A;  1WI4 A;  5DTH A;  3R0H A;  1UM7 A;  4REY A;  4LMM A;  2FCF A;  4NMT A;  4NXR A;  3GSL A;  3SOE A;  2YUB A;  2K20 A;  4L8N A;  4Q6S A;  5HFD A;  1X5Q A;  1OBZ A;  2EAQ A;  1ZUB A;  3CYY A;  3SHW A;  4YDP A;  4KFV A;  3SUZ A;  2CS5 A;  4HOP A;  2KRG A;  2EGO A;  1GQ5 A;  1TQ3 A;  1Q3P A;  1Y8T A;  2DLS A;  1WHA A;  1V5L A;  4FGM A;  2KBS A;  4OEO A;  4E3B A;  2P3W A;  2H2B A;  2JIK A;  2W4F A;  5G1E A;  1RZX A;  2KOJ A;  3O46 A;  3TMH A;  1L6O A;  4NMQ A;  1QAV B;  3DJ1 A;  5HF1 A;  3GGE A;  1RY4 A;  2JSN A;  3ZRT A;  3MH7 A;  5E11 A;  3QGL A;  3CH8 A;  1W9O A;  3CBX A;  3CBZ A;  1FCF A;  2QKV A;  1P1D A;  2OGP A;  5FB8 C;  2M3M A;  1UM1 A;  2Z17 A;  1B8Q A;  1WF8 A;  4NXQ A;  2GZV A;  2I4S A;  4E34 A;  1WI2 A;  3GAB A;  4Q2O A;  3DIW A;  2EEH A;  1MC7 A;  1OZI A;  2EDZ A;  2LC6 A;  1D5G A;  5E21 A;  3NGH A;  5B6L A;  2E7K A;  3EGH C;  2ZPL A;  1TE0 A;  1UJU A;  3GDS A;  1X45 A;  1TP3 A;  5HEY A;  2OQS A;  3STJ A;  1RGR A;  1NF3 C;  1OBY A;  5F3X A;  2AIN A;  2L97 A;  3KZD A;  1R6J A;  2LC7 A;  1IHJ A;  2RRM A;  5H3J A;  3HPM A;  3MH6 A;  2IWP A;  1QLC A;  2W7R A;  1U37 A;  2VSV A;  4NMP A;  1VB7 A;  4Q3H A;  2PKT A;  1MFL A;  1WFG A;  1LCY A;  3CC0 A;  3KZE A;  2EEG A;  4Z33 A;  2X7Z A;  5IL9 A;  1WJL A;  3GDU A;  1RGW A;  2JOA A;  2PA1 A;  3I4W A;  4GVD A;  2DM8 A;  2YUY A;  2EEJ A;  3KDK A;  2EXG A;  4JL7 A;  4Q2Q A;  3VQF A;  3ID2 A;  4JOG A;  2Q9V A;  2I04 A;  5EZ0 A;  2I0I A;  5EYZ A;  2VZ5 A;  3PDZ A;  1K32 A;  1YBO A;  2G2L A;  2KV8 A;  2LUI A;  5GND A;  1Y7N A;  1W9Q A;  1UHP A;  2KL1 A;  2I6V A;  3SFJ A;  4Z8J A;  1M5Z A;  2DKR A;  2BYG A;  2KAW A;  3HPK A;  3B76 A;  3GCN A;  2L4T A;  1P1E A;  1N6F A;  3QJM A;  2JIL A;  5D13 A;  2QBW A;  1UF1 A;  4OEP A;  2D90 A;  2KQF A;  2DLU A;  1Q7X A;  2I1N A;  3OTP A;  2PDZ A;  5ILB A;  4K78 A;  1V5Q A;  4N6X A;  2IWO A;  1WIF A;  2EGN A;  3TSZ A;  1T2M A;  4JJ0 A;  2HE4 A;  3NFL A;  2FNE A;  2QKU A;  1N7E A;  3QJN A;  2OPG A;  4JJ3 A;  2F5Y A;  1X5N A;  2OS6 A;  3K1R A;  3MH4 A;  2HGA A;  2VRF A;  5HED A;  4F8K A;  1UEQ A;  2KPK A;  2MHO A;  1UFX A;  1TP5 A;  1U38 A;  1PDR A;  2ENO A;  3NFK A;  1FC6 A;  4JOJ A;  4FLN A;  5HFE A;  2Q3G A;  1WFV A;  3E17 A;  3PDV A;  4JOE A;  2QT5 A;  1N7T A;  2KJD A;  1OBX A;  2KG2 A;  1IU2 A;  3TSW A;  2FN5 A;  1Z87 A;  2Z9I A;  3EGG C;  2H3M A;  2OCS A;  3TSV A;  3QDO A;  2QG1 A;  2D92 A;  1MFG A;  3I1E A;  3RL7 A;  4EDJ A;  1VA8 A;  5E1Y A;  2M0Z A;  3QIK A;  1N7F A;  2DAZ A;  3WKM A;  2EEI A;  4NMV A;  2LA8 A;  1N99 A;  2CSS A;  3CBY A;  2EDV A;  1U39 A;  3RLE A;  1N6E A;  2CSJ A;  5A2P A;  5HFF A;  4K76 A;  4PQW A;  3GDV A;  1VJ6 A;  3FY5 A;  4NMS A;  3BPU A;  5FHT A;  1ZOK A;  1Z86 A;  2LOB A;  4K72 A;  2FE5 A;  2EJY A;  3CS0 A;  2DMZ A;  3K82 A;  1X5R A;  4UU6 A;  3JXT A;  3QE1 A;  2OSG A;  3PV5 A;  4NNM A;  2RCZ A;  4GVC A;  5JXB A;  2VPH A;  5HF4 A;  3VQG A;  1V6B A;  2EGK A;  3AXA A;  2F0A A;  4YYX A;  2M0T A;  4KFW A;  4GHN A;  2V1W A;  2MX6 A;  2YTW A;  2M10 A;  1I16 A;  1WF7 A;  2EDP A;  2HE2 A;  1X9Z A;  1WHD A;  2R4H A;  3R69 A;  5HEB A;  4JOR A;  2JIN A;  1SOZ A;  2IWN A;  5HJ1 A;  4P2A B;  1N6D A;  3K50 A;  4OAJ A;  4JOH A;  1UJD A;  2KJP A;  1BE9 A;  3NCV A;  2JXO A;  1KEF A;  1V62 A;  4G69 A;  4NNL A;  1KY9 A;  1WH1 A;  4R2Z A;  3PS4 A;  2VSP A;  4WYT A;  4WYU A;  2AWW A;  1IU0 A;  2DC2 A;  3GJ9 A;  3ID1 A;  4JOP A;  2AWX A;  5HFC A;  5HET A;  1UEW A;  3DJA A;  2KJK A;  2PKU A;  2KPL A;  2PNT A;  3SHU A;  1I92 A;  3ID4 A;  4NMO A;  5I7Z A;  1X6D A;  5F67 A;  2ZPM A;  1UJV A;  4Q6H A;  1UEZ A;  5G1D A;  2PZD A;  2M0V A;  2YT8 A;  3QO6 A;  2QKT A;  1UIT A;  4H11 A;  1KWA A;  2DB5 A;  5E22 A;  1V1T A;  5HFB A;  1BFE A;  4NMR A;  2V90 A;  1XZ9 A;  3PV2 A;  2KOM A;  2O2T A;  2YT7 A;  3DOR A;  1FC9 A;  3DJ3 A;  3O5N A;  3L4F D;  1NTE A;  2JWE A;  4Q2N A;  1FC7 A;  2EHR A;  1SOT A;  5HDY A;  2EV8 A;  4JOF A;  4P0C A;  2DJT A;  5GLJ A;  2WL7 A;  3OU0 A;  4K6Y A;  4IC6 A;  2H2C A;  1VAE A;  2D8I A;  2H3L A;  2JRE A;  3KHF A;  2R3Y A;  2GEF A;  5B42 A;  4HOP B;  4AMH A;  4O06 A;  1GM1 A;  5E6P B;  1G9O A;  3LNY A;  4XHV A;  3RL8 A;  2K1Z A;  3KDG A;  2UZC A;  2KA9 A;  3I18 A;  3GCO A;  4JOK A;  1UEP A;  1QAV A;  3PV4 A;  1GQ4 A;  2KYL A;  4NXP A;  2I0L A;  4UU5 A;  2OZF A;  2AWU A;  2KOH A;  1VCW A;  2REY A;  1W9E A;  3WKL A;  1Q3O A;  1WG6 A;  3HVQ C;  3LNX A;  4K75 A;  2G5M B; 
#chains in the Genus database with same CATH homology
 2M0U A;  2IWQ A;  3R68 A;  2OMJ A;  1X8S A;  1QAU A;  2L4S A;  4Q2P A;  1U3B A;  4MPA A;  2VWR A;  3ID3 A;  4RI0 A;  4E35 A;  1WI4 A;  5DTH A;  3R0H A;  1UM7 A;  4REY A;  4LMM A;  2FCF A;  4NMT A;  4NXR A;  3GSL A;  3SOE A;  2YUB A;  2K20 A;  4L8N A;  4Q6S A;  5HFD A;  1X5Q A;  1OBZ A;  2EAQ A;  1ZUB A;  3CYY A;  3SHW A;  4YDP A;  4KFV A;  3SUZ A;  2CS5 A;  4HOP A;  2KRG A;  2EGO A;  1GQ5 A;  1TQ3 A;  1Q3P A;  1Y8T A;  2DLS A;  1WHA A;  1V5L A;  4FGM A;  2KBS A;  4OEO A;  4E3B A;  2P3W A;  2H2B A;  2JIK A;  2W4F A;  5G1E A;  1RZX A;  2KOJ A;  3O46 A;  3TMH A;  1L6O A;  4NMQ A;  1QAV B;  3DJ1 A;  5HF1 A;  3GGE A;  1RY4 A;  2JSN A;  3ZRT A;  3MH7 A;  5E11 A;  3QGL A;  3CH8 A;  1W9O A;  3CBX A;  3CBZ A;  1FCF A;  2QKV A;  1P1D A;  2OGP A;  5FB8 C;  2M3M A;  1UM1 A;  2Z17 A;  1B8Q A;  1WF8 A;  4NXQ A;  2GZV A;  2I4S A;  4E34 A;  1WI2 A;  3GAB A;  4Q2O A;  3DIW A;  2EEH A;  1MC7 A;  1OZI A;  2EDZ A;  2LC6 A;  1D5G A;  5E21 A;  3NGH A;  5B6L A;  2E7K A;  3EGH C;  2ZPL A;  1TE0 A;  1UJU A;  3GDS A;  1X45 A;  1TP3 A;  5HEY A;  2OQS A;  3STJ A;  1RGR A;  1NF3 C;  1OBY A;  5F3X A;  2AIN A;  2L97 A;  3KZD A;  1R6J A;  2LC7 A;  1IHJ A;  2RRM A;  5H3J A;  3HPM A;  3MH6 A;  2IWP A;  1QLC A;  2W7R A;  1U37 A;  2VSV A;  4NMP A;  1VB7 A;  4Q3H A;  2PKT A;  1MFL A;  1WFG A;  1LCY A;  3CC0 A;  3KZE A;  2EEG A;  4Z33 A;  2X7Z A;  5IL9 A;  1WJL A;  3GDU A;  1RGW A;  2JOA A;  2PA1 A;  3I4W A;  4GVD A;  2DM8 A;  2YUY A;  2EEJ A;  3KDK A;  2EXG A;  4JL7 A;  4Q2Q A;  3VQF A;  3ID2 A;  4JOG A;  2Q9V A;  2I04 A;  5EZ0 A;  2I0I A;  5EYZ A;  2VZ5 A;  3PDZ A;  1K32 A;  1YBO A;  2G2L A;  2KV8 A;  2LUI A;  5GND A;  1Y7N A;  1W9Q A;  1UHP A;  2KL1 A;  2I6V A;  3SFJ A;  4Z8J A;  1M5Z A;  2DKR A;  2BYG A;  2KAW A;  3HPK A;  3B76 A;  3GCN A;  2L4T A;  1P1E A;  1N6F A;  3QJM A;  2JIL A;  5D13 A;  2QBW A;  1UF1 A;  4OEP A;  2D90 A;  2KQF A;  2DLU A;  1Q7X A;  2I1N A;  3OTP A;  2PDZ A;  5ILB A;  4K78 A;  1V5Q A;  4N6X A;  2IWO A;  1WIF A;  2EGN A;  3TSZ A;  1T2M A;  4JJ0 A;  2HE4 A;  3NFL A;  2FNE A;  2QKU A;  1N7E A;  3QJN A;  2OPG A;  4JJ3 A;  2F5Y A;  1X5N A;  2OS6 A;  3K1R A;  3MH4 A;  2HGA A;  2VRF A;  5HED A;  4F8K A;  1UEQ A;  2KPK A;  2MHO A;  1UFX A;  1TP5 A;  1U38 A;  1PDR A;  2ENO A;  3NFK A;  1FC6 A;  4JOJ A;  4FLN A;  5HFE A;  2Q3G A;  1WFV A;  3E17 A;  3PDV A;  4JOE A;  2QT5 A;  1N7T A;  2KJD A;  1OBX A;  2KG2 A;  1IU2 A;  3TSW A;  2FN5 A;  1Z87 A;  2Z9I A;  3EGG C;  2H3M A;  2OCS A;  3TSV A;  3QDO A;  2QG1 A;  2D92 A;  1MFG A;  3I1E A;  3RL7 A;  4EDJ A;  1VA8 A;  5E1Y A;  2M0Z A;  3QIK A;  1N7F A;  2DAZ A;  3WKM A;  2EEI A;  4NMV A;  2LA8 A;  1N99 A;  2CSS A;  3CBY A;  2EDV A;  1U39 A;  3RLE A;  1N6E A;  2CSJ A;  5A2P A;  5HFF A;  4K76 A;  4PQW A;  3GDV A;  1VJ6 A;  3FY5 A;  4NMS A;  3BPU A;  5FHT A;  1ZOK A;  1Z86 A;  2LOB A;  4K72 A;  2FE5 A;  2EJY A;  3CS0 A;  2DMZ A;  3K82 A;  1X5R A;  4UU6 A;  3JXT A;  3QE1 A;  2OSG A;  3PV5 A;  4NNM A;  2RCZ A;  4GVC A;  5JXB A;  2VPH A;  5HF4 A;  3VQG A;  1V6B A;  2EGK A;  3AXA A;  2F0A A;  4YYX A;  2M0T A;  4KFW A;  4GHN A;  2V1W A;  2MX6 A;  2YTW A;  2M10 A;  1I16 A;  1WF7 A;  2EDP A;  2HE2 A;  1X9Z A;  1WHD A;  2R4H A;  3R69 A;  5HEB A;  4JOR A;  2JIN A;  1SOZ A;  2IWN A;  5HJ1 A;  4P2A B;  1N6D A;  3K50 A;  4OAJ A;  4JOH A;  1UJD A;  2KJP A;  1BE9 A;  3NCV A;  2JXO A;  1KEF A;  1V62 A;  4G69 A;  4NNL A;  1KY9 A;  1WH1 A;  4R2Z A;  3PS4 A;  2VSP A;  4WYT A;  4WYU A;  2AWW A;  1IU0 A;  2DC2 A;  3GJ9 A;  3ID1 A;  4JOP A;  2AWX A;  5HFC A;  5HET A;  1UEW A;  3DJA A;  2KJK A;  2PKU A;  2KPL A;  2PNT A;  3SHU A;  1I92 A;  3ID4 A;  4NMO A;  5I7Z A;  1X6D A;  5F67 A;  2ZPM A;  1UJV A;  4Q6H A;  1UEZ A;  5G1D A;  2PZD A;  2M0V A;  2YT8 A;  3QO6 A;  2QKT A;  1UIT A;  4H11 A;  1KWA A;  2DB5 A;  5E22 A;  1V1T A;  5HFB A;  1BFE A;  4NMR A;  2V90 A;  1XZ9 A;  3PV2 A;  2KOM A;  2O2T A;  2YT7 A;  3DOR A;  1FC9 A;  3DJ3 A;  3O5N A;  3L4F D;  1NTE A;  2JWE A;  4Q2N A;  1FC7 A;  2EHR A;  1SOT A;  5HDY A;  2EV8 A;  4JOF A;  4P0C A;  2DJT A;  5GLJ A;  2WL7 A;  3OU0 A;  4K6Y A;  4IC6 A;  2H2C A;  1VAE A;  2D8I A;  2H3L A;  2JRE A;  3KHF A;  2R3Y A;  2GEF A;  5B42 A;  4HOP B;  4AMH A;  4O06 A;  1GM1 A;  5E6P B;  1G9O A;  3LNY A;  4XHV A;  3RL8 A;  2K1Z A;  3KDG A;  2UZC A;  2KA9 A;  3I18 A;  3GCO A;  4JOK A;  1UEP A;  1QAV A;  3PV4 A;  1GQ4 A;  2KYL A;  4NXP A;  2I0L A;  4UU5 A;  2OZF A;  2AWU A;  2KOH A;  1VCW A;  2REY A;  1W9E A;  3WKL A;  1Q3O A;  1WG6 A;  3HVQ C;  3LNX A;  4K75 A;  2G5M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...