3QGLA

Crystal structure of pdz domain of sorting nexin 27 (snx27) in complex with the eseskv peptide corresponding to the c-terminal tail of girk3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
SPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin-27
publication title Mechanism underlying selective regulation of G protein-gated inwardly rectifying potassium channels by the psychostimulant-sensitive sorting nexin 27.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 20
structure length 96
sequence length 96
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3qglA00
1MFLA 2OSGA 2JREA 2DAZA 1I92A 1X5RA 2G2LA 2V1WA 3HPMA 1WF8A 1WI2A 1X6DA 3QIKA 2LC6A 2Q3GA 4JOFA 2M10A 2OZFA 4NXPA 4Z8JA 1OBZA 3PV4A 4JOKA 3L4FD 4Q2OA 1VCWA 1WFGA 4N6XA 1B8QA 5HEYA 2DLSA 4K75A 2V90A 2EEGA 4HOPB 4XHVA 2PA1A 2KJDA 2D90A 2KOMA 4Q2QA 5HFCA 3STJA 2OS6A 2KBSA 2VSPA 1N6FA 1K32A 3OTPA 5HETA 5F3XA 3HPKA 3ID3A 1WI4A 2D92A 4OAJA 3QDOA 1RGWA 2M0UA 3MH4A 2EDZA 2PZDA 5E22A 1N6EA 2EJYA 2RRMA 2OCSA 2L4SA 1Q3OA 1ZUBA 3DORA 3I18A 1R6JA 3KZEA 4P0CA 5F67A 5HDYA 2PKUA 3VQGA 5HF1A 5G1EA 2PDZA 3K1RA 2KRGA 4MPAA 2DKRA 4WYTA 1ZOKA 5HFEA 3PDZA 2DB5A 1V5QA 2KYLA 3I1EA 1TP5A 2Z9IA 2AWUA 1X8SA 1WHAA 2EAQA 3TSZA 3QGLA 1N7TA 1X45A 3SHWA 1BE9A 1KEFA 1FC6A 3ZRTA 1W9OA 4JOJA 4OEOA 3GDUA 1NF3C 1Y8TA 1V62A 2ZPMA 3CBXA 3KZDA 2GZVA 3QJNA 1FC7A 5E11A 5A2PA 3E17A 2M0VA 3LNXA 4EDJA 2IWNA 3CYYA 2OGPA 5EYZA 3DJAA 4YYXA 3QJMA 3PDVA 5G1DA 3CH8A 4Z33A 3R0HA 3TSWA 5HEDA 1U39A 4E34A 3O46A 1VJ6A 2JIKA 2W7RA 4OEPA 1N7FA 4K72A 1QAVA 1G9OA 2EEJA 1Z86A 1UF1A 3NFLA 2L97A 2M0TA 4UU6A 2I4SA 2JWEA 2ENOA 1RGRA 1Y7NA 1OBYA 2VWRA 2IWPA 2R3YA 4UU5A 1P1DA 2I1NA 3JXTA 2KOJA 4F8KA 4Q2NA 1D5GA 5E1YA 4KFWA 3PV2A 3R69A 2LOBA 2I6VA 2PNTA 2DC2A 3ID2A 2UZCA 3HVQC 3DJ3A 2KOHA 1UHPA 4NMOA 4L8NA 1FCFA 5D13A 1SOTA 3GDVA 4P2AB 2JINA 2FE5A 2IWQA 1OZIA 1IU2A 2FN5A 5B6LA 5FB8C 2FCFA 2X7ZA 4NMRA 1U38A 1IHJA 1TE0A 2DLUA 2EHRA 2OPGA 3GDSA 1T2MA 2ZPLA 3CS0A 2FNEA 2HE4A 2EGKA 1WJLA 4NMQA 2I0LA 2M0ZA 3LNYA 4GVCA 1U37A 2QBWA 3WKMA 2R4HA 2MX6A 1QLCA 4NMTA 4NMSA 3CC0A 3KHFA 1W9EA 4JOHA 4NXRA 2QKTA 2CSJA 4NXQA 1V6BA 2QKUA 3GJ9A 5HFFA 4R2ZA 2JILA 2W4FA 4G69A 1YBOA 3K82A 3RLEA 4KFVA 2KJKA 2QKVA 4O06A 4LMMA 1UJVA 3RL8A 2DMZA 2F5YA 3RL7A 2M3MA 3FY5A 1MFGA 1W9QA 2H2BA 2KV8A 3R68A 2QG1A 1SOZA 2AWWA 5GLJA 2YUYA 3CBYA 3TMHA 1GM1A 2I04A 2VPHA 4Q3HA 2AINA 1WF7A 5E21A 2WL7A 3ID4A 2JXOA 1FC9A 4WYUA 5HEBA 2IWOA 2RCZA 2EEIA 1BFEA 5JXBA 2VRFA 1UEZA 2YT8A 1WHDA 4K78A 1P1EA 3SOEA 2K20A 2E7KA 2P3WA 2YUBA 3I4WA 1UEWA 3ID1A 2KA9A 2CSSA 2KJPA 3DIWA 2BYGA 1LCYA 4JOGA 2EDVA 4GHNA 1Q7XA 2HGAA 1X5QA 2PKTA 4JOPA 1N6DA 3NGHA 1N99A 1OBXA 1RY4A 1V5LA 2EGNA 3SFJA 3K50A 4YDPA 2KG2A 2KQFA 1KY9A 2KPKA 4NMPA 4Q6HA 2Z17A 1KWAA 1UEPA 3DJ1A 1MC7A 2MHOA 1N7EA 2VSVA 5HJ1A 4AMHA 1UITA 2O2TA 3EGHC 3TSVA 2LC7A 3GCNA 2HE2A 1U3BA 1PDRA 3PS4A 2Q9VA 5HFDA 1QAUA 3SHUA 1QAVB 3GGEA 3GSLA 4Q6SA 3NFKA 1GQ4A 4JOEA 2YT7A 2EEHA 1UM1A 1RZXA 4JL7A 5GNDA 1VAEA 2D8IA 1UEQA 3O5NA 2QT5A 1GQ5A 3B76A 1NTEA 1M5ZA 1UJDA 4JORA 5FHTA 1Q3PA 2H3LA 2KL1A 2OQSA 3MH6A 1XZ9A 4NMVA 3VQFA 1WH1A 1X5NA 1UM7A 1IU0A 2KAWA 3QO6A 3EGGC 1TP3A 2L4TA 4IC6A 1UJUA 5HF4A 2EDPA 3QE1A 4FGMA 1L6OA 4GVDA 2F0AA 2H3MA 2OMJA 4REYA 3PV5A 4E3BA 2VZ5A 5DTHA 2G5MB 4NNMA 2CS5A 3OU0A 1UFXA 2LA8A 5E6PB 4HOPA 1VB7A 2JOAA 3CBZA 3MH7A 2REYA 4RI0A 4Q2PA 2K1ZA 4NNLA 4E35A 3AXAA 2LUIA 1I16A 5HFBA 5EZ0A 4PQWA 2EXGA 3SUZA 4K76A 1WG6A 1VA8A 2H2CA 2YTWA 3BPUA 2DM8A 2KPLA 3WKLA 1WFVA 5H3JA 3GCOA 2AWXA 1WIFA 4H11A 2EGOA 2DJTA 4K6YA 2EV8A 1V1TA 1TQ3A 5I7ZA 1Z87A 2I0IA
chains in the Genus database with same CATH superfamily
1MFLA 2GEFA 2JREA 2OSGA 2DAZA 1I92A 1X5RA 2G2LA 2V1WA 3HPMA 1WF8A 1WI2A 1X6DA 3QIKA 2LC6A 2Q3GA 4JOFA 2M10A 2OZFA 4NXPA 4Z8JA 1OBZA 3PV4A 4JOKA 3L4FD 4Q2OA 1VCWA 1WFGA 4N6XA 1B8QA 5HEYA 2DLSA 4FLNA 4K75A 2V90A 2EEGA 4HOPB 4XHVA 2PA1A 2KJDA 2D90A 5IL9A 2KOMA 4Q2QA 5HFCA 3STJA 2OS6A 2KBSA 2VSPA 1N6FA 1K32A 3OTPA 5HETA 5F3XA 3HPKA 3ID3A 1WI4A 2D92A 4OAJA 3QDOA 1RGWA 2M0UA 3MH4A 2EDZA 2PZDA 5E22A 1N6EA 2EJYA 2RRMA 2OCSA 5ILBA 2L4SA 1Q3OA 1ZUBA 3DORA 3I18A 1R6JA 3KZEA 4P0CA 5F67A 5HDYA 2PKUA 3VQGA 5HF1A 5G1EA 2PDZA 3K1RA 2KRGA 4MPAA 2DKRA 4WYTA 1ZOKA 5HFEA 3PDZA 2DB5A 1V5QA 2KYLA 3I1EA 1TP5A 2Z9IA 2AWUA 1X8SA 1WHAA 2EAQA 3TSZA 3QGLA 1N7TA 1X45A 3SHWA 1BE9A 1KEFA 1FC6A 3ZRTA 1W9OA 4JOJA 4OEOA 3GDUA 1NF3C 1Y8TA 1V62A 2ZPMA 3CBXA 3KZDA 2GZVA 3QJNA 1FC7A 5E11A 5A2PA 3E17A 2M0VA 3LNXA 4EDJA 2IWNA 3CYYA 2OGPA 5EYZA 3DJAA 4YYXA 3QJMA 3PDVA 5G1DA 3KDKA 3CH8A 4Z33A 3R0HA 3TSWA 5HEDA 1U39A 4E34A 3O46A 1VJ6A 2JIKA 2W7RA 4OEPA 1N7FA 4K72A 1QAVA 1G9OA 2EEJA 1Z86A 1UF1A 3NFLA 2L97A 2M0TA 4UU6A 2I4SA 2JWEA 2ENOA 1RGRA 1Y7NA 1OBYA 2VWRA 2IWPA 2R3YA 4UU5A 1P1DA 2I1NA 5B42A 3JXTA 2KOJA 4F8KA 4Q2NA 1D5GA 5E1YA 4KFWA 3PV2A 3R69A 2LOBA 2I6VA 2PNTA 2DC2A 3ID2A 2UZCA 3HVQC 3DJ3A 2KOHA 1UHPA 4NMOA 4L8NA 1FCFA 5D13A 1SOTA 3GDVA 4P2AB 2JINA 2FE5A 2IWQA 1OZIA 1IU2A 2FN5A 5B6LA 5FB8C 2FCFA 2X7ZA 4NMRA 1U38A 1IHJA 1TE0A 2DLUA 2EHRA 2OPGA 3GDSA 1T2MA 2ZPLA 3CS0A 2FNEA 2HE4A 2EGKA 1WJLA 4NMQA 2I0LA 2M0ZA 3LNYA 4GVCA 1U37A 2QBWA 3WKMA 2R4HA 2MX6A 1QLCA 4NMTA 4NMSA 3CC0A 3KHFA 1W9EA 4JOHA 4NXRA 2QKTA 2CSJA 4NXQA 1V6BA 2QKUA 3GJ9A 5HFFA 4JJ3A 4R2ZA 2JSNA 2JILA 2W4FA 4G69A 1YBOA 3K82A 3RLEA 4KFVA 2KJKA 2QKVA 4O06A 4LMMA 1UJVA 3RL8A 2DMZA 2F5YA 3RL7A 2M3MA 3FY5A 1MFGA 1W9QA 2H2BA 2KV8A 3R68A 2QG1A 1SOZA 2AWWA 5GLJA 2YUYA 3CBYA 3TMHA 1GM1A 2I04A 2VPHA 4Q3HA 2AINA 1WF7A 5E21A 2WL7A 3ID4A 2JXOA 1FC9A 4JJ0A 4WYUA 5HEBA 2IWOA 2RCZA 2EEIA 1BFEA 5JXBA 2VRFA 1UEZA 2YT8A 3KDGA 1WHDA 4K78A 1P1EA 3SOEA 2K20A 2E7KA 2P3WA 2YUBA 3I4WA 1UEWA 3ID1A 2KA9A 2CSSA 2KJPA 3DIWA 2BYGA 1LCYA 4JOGA 2EDVA 4GHNA 1Q7XA 2HGAA 1X5QA 2PKTA 4JOPA 1N6DA 3NGHA 1N99A 1OBXA 1RY4A 1V5LA 2EGNA 3SFJA 3K50A 4YDPA 2KG2A 2KQFA 1KY9A 2KPKA 4NMPA 4Q6HA 2Z17A 1KWAA 1UEPA 3DJ1A 1MC7A 2MHOA 1N7EA 2VSVA 5HJ1A 4AMHA 1UITA 2O2TA 3EGHC 3TSVA 2LC7A 3GCNA 1X9ZA 2HE2A 1U3BA 1PDRA 3PS4A 2Q9VA 5HFDA 1QAUA 3SHUA 1QAVB 3GGEA 3GSLA 4Q6SA 3NFKA 1GQ4A 4JOEA 2YT7A 2EEHA 1UM1A 1RZXA 4JL7A 5GNDA 1VAEA 2D8IA 1UEQA 3O5NA 2QT5A 1GQ5A 3B76A 1NTEA 1M5ZA 1UJDA 4JORA 5FHTA 1Q3PA 2H3LA 2KL1A 2OQSA 3MH6A 1XZ9A 4NMVA 3VQFA 1WH1A 1X5NA 1UM7A 1IU0A 2KAWA 3QO6A 3EGGC 1TP3A 2L4TA 4IC6A 1UJUA 5HF4A 2EDPA 3QE1A 4FGMA 1L6OA 4GVDA 2F0AA 2H3MA 2OMJA 4REYA 3PV5A 4E3BA 2VZ5A 5DTHA 2G5MB 4NNMA 2CS5A 3OU0A 1UFXA 2LA8A 5E6PB 4HOPA 1VB7A 2JOAA 3CBZA 3MH7A 2REYA 4RI0A 4Q2PA 2K1ZA 4NNLA 4E35A 3AXAA 2LUIA 1I16A 5HFBA 5EZ0A 4PQWA 2EXGA 3SUZA 4K76A 1WG6A 1VA8A 2H2CA 2YTWA 3BPUA 2DM8A 3NCVA 3GABA 2KPLA 3WKLA 1WFVA 5H3JA 3GCOA 2AWXA 1WIFA 4H11A 2EGOA 2DJTA 4K6YA 2EV8A 1V1TA 1TQ3A 5I7ZA 1Z87A 2I0IA
chains in the Genus database with same CATH topology
1MFLA 2GEFA 2JREA 2OSGA 2DAZA 1I92A 1X5RA 2G2LA 2V1WA 3HPMA 1WF8A 1WI2A 1X6DA 3QIKA 2LC6A 2Q3GA 4JOFA 2M10A 2OZFA 4NXPA 4Z8JA 1OBZA 3PV4A 4JOKA 3L4FD 4Q2OA 1VCWA 1WFGA 4N6XA 1B8QA 5HEYA 2DLSA 4FLNA 4K75A 2V90A 2EEGA 4HOPB 4XHVA 2PA1A 2KJDA 2D90A 5IL9A 2KOMA 4Q2QA 5HFCA 3STJA 2OS6A 2KBSA 2VSPA 1N6FA 1K32A 3OTPA 5HETA 5F3XA 3HPKA 3ID3A 1WI4A 2D92A 4OAJA 3QDOA 1RGWA 2M0UA 3MH4A 2EDZA 2PZDA 5E22A 1N6EA 2EJYA 2RRMA 2OCSA 5ILBA 2L4SA 1Q3OA 1ZUBA 3DORA 3I18A 1R6JA 3KZEA 4P0CA 5F67A 5HDYA 2PKUA 3VQGA 5HF1A 5G1EA 2PDZA 3K1RA 2KRGA 4MPAA 2DKRA 4WYTA 1ZOKA 5HFEA 3PDZA 2DB5A 1V5QA 2KYLA 3I1EA 1TP5A 2Z9IA 2AWUA 1X8SA 1WHAA 2EAQA 3TSZA 3QGLA 1N7TA 1X45A 3SHWA 1BE9A 1KEFA 1FC6A 3ZRTA 1W9OA 4JOJA 4OEOA 3GDUA 1NF3C 1Y8TA 1V62A 2ZPMA 3CBXA 3KZDA 2GZVA 3QJNA 1FC7A 5E11A 5A2PA 3E17A 2M0VA 3LNXA 4EDJA 2IWNA 3CYYA 2OGPA 5EYZA 3DJAA 4YYXA 3QJMA 3PDVA 5G1DA 3KDKA 3CH8A 4Z33A 3R0HA 3TSWA 5HEDA 1U39A 4E34A 3O46A 1VJ6A 2JIKA 2W7RA 4OEPA 1N7FA 4K72A 1QAVA 1G9OA 2EEJA 1Z86A 1UF1A 3NFLA 2L97A 2M0TA 4UU6A 2I4SA 2JWEA 2ENOA 1RGRA 1Y7NA 1OBYA 2VWRA 2IWPA 2R3YA 4UU5A 1P1DA 2I1NA 5B42A 3JXTA 2KOJA 4F8KA 4Q2NA 1D5GA 5E1YA 4KFWA 3PV2A 3R69A 2LOBA 2I6VA 2PNTA 2DC2A 3ID2A 2UZCA 3HVQC 3DJ3A 2KOHA 1UHPA 4NMOA 4L8NA 1FCFA 5D13A 1SOTA 3GDVA 4P2AB 2JINA 2FE5A 2IWQA 1OZIA 1IU2A 2FN5A 5B6LA 5FB8C 2FCFA 2X7ZA 4NMRA 1U38A 1IHJA 1TE0A 2DLUA 2EHRA 2OPGA 3GDSA 1T2MA 2ZPLA 3CS0A 2FNEA 2HE4A 2EGKA 1WJLA 4NMQA 2I0LA 2M0ZA 3LNYA 4GVCA 1U37A 2QBWA 3WKMA 2R4HA 2MX6A 1QLCA 4NMTA 4NMSA 3CC0A 3KHFA 1W9EA 4JOHA 4NXRA 2QKTA 2CSJA 4NXQA 1V6BA 2QKUA 3GJ9A 5HFFA 4JJ3A 4R2ZA 2JSNA 2JILA 2W4FA 4G69A 1YBOA 3K82A 3RLEA 4KFVA 2KJKA 2QKVA 4O06A 4LMMA 1UJVA 3RL8A 2DMZA 2F5YA 3RL7A 2M3MA 3FY5A 1MFGA 1W9QA 2H2BA 2KV8A 3R68A 2QG1A 1SOZA 2AWWA 5GLJA 2YUYA 3CBYA 3TMHA 1GM1A 2I04A 2VPHA 4Q3HA 2AINA 1WF7A 5E21A 2WL7A 3ID4A 2JXOA 1FC9A 4JJ0A 4WYUA 5HEBA 2IWOA 2RCZA 2EEIA 1BFEA 5JXBA 2VRFA 1UEZA 2YT8A 3KDGA 1WHDA 4K78A 1P1EA 3SOEA 2K20A 2E7KA 2P3WA 2YUBA 3I4WA 1UEWA 3ID1A 2KA9A 2CSSA 2KJPA 3DIWA 2BYGA 1LCYA 4JOGA 2EDVA 4GHNA 1Q7XA 2HGAA 1X5QA 2PKTA 4JOPA 1N6DA 3NGHA 1N99A 1OBXA 1RY4A 1V5LA 2EGNA 3SFJA 3K50A 4YDPA 2KG2A 2KQFA 1KY9A 2KPKA 4NMPA 4Q6HA 2Z17A 1KWAA 1UEPA 3DJ1A 1MC7A 2MHOA 1N7EA 2VSVA 5HJ1A 4AMHA 1UITA 2O2TA 3EGHC 3TSVA 2LC7A 3GCNA 1X9ZA 2HE2A 1U3BA 1PDRA 3PS4A 2Q9VA 5HFDA 1QAUA 3SHUA 1QAVB 3GGEA 3GSLA 4Q6SA 3NFKA 1GQ4A 4JOEA 2YT7A 2EEHA 1UM1A 1RZXA 4JL7A 5GNDA 1VAEA 2D8IA 1UEQA 3O5NA 2QT5A 1GQ5A 3B76A 1NTEA 1M5ZA 1UJDA 4JORA 5FHTA 1Q3PA 2H3LA 2KL1A 2OQSA 3MH6A 1XZ9A 4NMVA 3VQFA 1WH1A 1X5NA 1UM7A 1IU0A 2KAWA 3QO6A 3EGGC 1TP3A 2L4TA 4IC6A 1UJUA 5HF4A 2EDPA 3QE1A 4FGMA 1L6OA 4GVDA 2F0AA 2H3MA 2OMJA 4REYA 3PV5A 4E3BA 2VZ5A 5DTHA 2G5MB 4NNMA 2CS5A 3OU0A 1UFXA 2LA8A 5E6PB 4HOPA 1VB7A 2JOAA 3CBZA 3MH7A 2REYA 4RI0A 4Q2PA 2K1ZA 4NNLA 4E35A 3AXAA 2LUIA 1I16A 5HFBA 5EZ0A 4PQWA 2EXGA 3SUZA 4K76A 1WG6A 1VA8A 2H2CA 2YTWA 3BPUA 2DM8A 3NCVA 3GABA 2KPLA 3WKLA 1WFVA 5H3JA 3GCOA 2AWXA 1WIFA 4H11A 2EGOA 2DJTA 4K6YA 2EV8A 1V1TA 1TQ3A 5I7ZA 1Z87A 2I0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MFL A;  2OSG A;  2JRE A;  2DAZ A;  1I92 A;  1X5R A;  2G2L A;  2V1W A;  3HPM A;  1WF8 A;  1WI2 A;  1X6D A;  3QIK A;  2LC6 A;  2Q3G A;  4JOF A;  2M10 A;  2OZF A;  4NXP A;  4Z8J A;  1OBZ A;  3PV4 A;  4JOK A;  3L4F D;  4Q2O A;  1VCW A;  1WFG A;  4N6X A;  1B8Q A;  5HEY A;  2DLS A;  4K75 A;  2V90 A;  2EEG A;  4HOP B;  4XHV A;  2PA1 A;  2KJD A;  2D90 A;  2KOM A;  4Q2Q A;  5HFC A;  3STJ A;  2OS6 A;  2KBS A;  2VSP A;  1N6F A;  1K32 A;  3OTP A;  5HET A;  5F3X A;  3HPK A;  3ID3 A;  1WI4 A;  2D92 A;  4OAJ A;  3QDO A;  1RGW A;  2M0U A;  3MH4 A;  2EDZ A;  2PZD A;  5E22 A;  1N6E A;  2EJY A;  2RRM A;  2OCS A;  2L4S A;  1Q3O A;  1ZUB A;  3DOR A;  3I18 A;  1R6J A;  3KZE A;  4P0C A;  5F67 A;  5HDY A;  2PKU A;  3VQG A;  5HF1 A;  5G1E A;  2PDZ A;  3K1R A;  2KRG A;  4MPA A;  2DKR A;  4WYT A;  1ZOK A;  5HFE A;  3PDZ A;  2DB5 A;  1V5Q A;  2KYL A;  3I1E A;  1TP5 A;  2Z9I A;  2AWU A;  1X8S A;  1WHA A;  2EAQ A;  3TSZ A;  3QGL A;  1N7T A;  1X45 A;  3SHW A;  1BE9 A;  1KEF A;  1FC6 A;  3ZRT A;  1W9O A;  4JOJ A;  4OEO A;  3GDU A;  1NF3 C;  1Y8T A;  1V62 A;  2ZPM A;  3CBX A;  3KZD A;  2GZV A;  3QJN A;  1FC7 A;  5E11 A;  5A2P A;  3E17 A;  2M0V A;  3LNX A;  4EDJ A;  2IWN A;  3CYY A;  2OGP A;  5EYZ A;  3DJA A;  4YYX A;  3QJM A;  3PDV A;  5G1D A;  3CH8 A;  4Z33 A;  3R0H A;  3TSW A;  5HED A;  1U39 A;  4E34 A;  3O46 A;  1VJ6 A;  2JIK A;  2W7R A;  4OEP A;  1N7F A;  4K72 A;  1QAV A;  1G9O A;  2EEJ A;  1Z86 A;  1UF1 A;  3NFL A;  2L97 A;  2M0T A;  4UU6 A;  2I4S A;  2JWE A;  2ENO A;  1RGR A;  1Y7N A;  1OBY A;  2VWR A;  2IWP A;  2R3Y A;  4UU5 A;  1P1D A;  2I1N A;  3JXT A;  2KOJ A;  4F8K A;  4Q2N A;  1D5G A;  5E1Y A;  4KFW A;  3PV2 A;  3R69 A;  2LOB A;  2I6V A;  2PNT A;  2DC2 A;  3ID2 A;  2UZC A;  3HVQ C;  3DJ3 A;  2KOH A;  1UHP A;  4NMO A;  4L8N A;  1FCF A;  5D13 A;  1SOT A;  3GDV A;  4P2A B;  2JIN A;  2FE5 A;  2IWQ A;  1OZI A;  1IU2 A;  2FN5 A;  5B6L A;  5FB8 C;  2FCF A;  2X7Z A;  4NMR A;  1U38 A;  1IHJ A;  1TE0 A;  2DLU A;  2EHR A;  2OPG A;  3GDS A;  1T2M A;  2ZPL A;  3CS0 A;  2FNE A;  2HE4 A;  2EGK A;  1WJL A;  4NMQ A;  2I0L A;  2M0Z A;  3LNY A;  4GVC A;  1U37 A;  2QBW A;  3WKM A;  2R4H A;  2MX6 A;  1QLC A;  4NMT A;  4NMS A;  3CC0 A;  3KHF A;  1W9E A;  4JOH A;  4NXR A;  2QKT A;  2CSJ A;  4NXQ A;  1V6B A;  2QKU A;  3GJ9 A;  5HFF A;  4R2Z A;  2JIL A;  2W4F A;  4G69 A;  1YBO A;  3K82 A;  3RLE A;  4KFV A;  2KJK A;  2QKV A;  4O06 A;  4LMM A;  1UJV A;  3RL8 A;  2DMZ A;  2F5Y A;  3RL7 A;  2M3M A;  3FY5 A;  1MFG A;  1W9Q A;  2H2B A;  2KV8 A;  3R68 A;  2QG1 A;  1SOZ A;  2AWW A;  5GLJ A;  2YUY A;  3CBY A;  3TMH A;  1GM1 A;  2I04 A;  2VPH A;  4Q3H A;  2AIN A;  1WF7 A;  5E21 A;  2WL7 A;  3ID4 A;  2JXO A;  1FC9 A;  4WYU A;  5HEB A;  2IWO A;  2RCZ A;  2EEI A;  1BFE A;  5JXB A;  2VRF A;  1UEZ A;  2YT8 A;  1WHD A;  4K78 A;  1P1E A;  3SOE A;  2K20 A;  2E7K A;  2P3W A;  2YUB A;  3I4W A;  1UEW A;  3ID1 A;  2KA9 A;  2CSS A;  2KJP A;  3DIW A;  2BYG A;  1LCY A;  4JOG A;  2EDV A;  4GHN A;  1Q7X A;  2HGA A;  1X5Q A;  2PKT A;  4JOP A;  1N6D A;  3NGH A;  1N99 A;  1OBX A;  1RY4 A;  1V5L A;  2EGN A;  3SFJ A;  3K50 A;  4YDP A;  2KG2 A;  2KQF A;  1KY9 A;  2KPK A;  4NMP A;  4Q6H A;  2Z17 A;  1KWA A;  1UEP A;  3DJ1 A;  1MC7 A;  2MHO A;  1N7E A;  2VSV A;  5HJ1 A;  4AMH A;  1UIT A;  2O2T A;  3EGH C;  3TSV A;  2LC7 A;  3GCN A;  2HE2 A;  1U3B A;  1PDR A;  3PS4 A;  2Q9V A;  5HFD A;  1QAU A;  3SHU A;  1QAV B;  3GGE A;  3GSL A;  4Q6S A;  3NFK A;  1GQ4 A;  4JOE A;  2YT7 A;  2EEH A;  1UM1 A;  1RZX A;  4JL7 A;  5GND A;  1VAE A;  2D8I A;  1UEQ A;  3O5N A;  2QT5 A;  1GQ5 A;  3B76 A;  1NTE A;  1M5Z A;  1UJD A;  4JOR A;  5FHT A;  1Q3P A;  2H3L A;  2KL1 A;  2OQS A;  3MH6 A;  1XZ9 A;  4NMV A;  3VQF A;  1WH1 A;  1X5N A;  1UM7 A;  1IU0 A;  2KAW A;  3QO6 A;  3EGG C;  1TP3 A;  2L4T A;  4IC6 A;  1UJU A;  5HF4 A;  2EDP A;  3QE1 A;  4FGM A;  1L6O A;  4GVD A;  2F0A A;  2H3M A;  2OMJ A;  4REY A;  3PV5 A;  4E3B A;  2VZ5 A;  5DTH A;  2G5M B;  4NNM A;  2CS5 A;  3OU0 A;  1UFX A;  2LA8 A;  5E6P B;  4HOP A;  1VB7 A;  2JOA A;  3CBZ A;  3MH7 A;  2REY A;  4RI0 A;  4Q2P A;  2K1Z A;  4NNL A;  4E35 A;  3AXA A;  2LUI A;  1I16 A;  5HFB A;  5EZ0 A;  4PQW A;  2EXG A;  3SUZ A;  4K76 A;  1WG6 A;  1VA8 A;  2H2C A;  2YTW A;  3BPU A;  2DM8 A;  2KPL A;  3WKL A;  1WFV A;  5H3J A;  3GCO A;  2AWX A;  1WIF A;  4H11 A;  2EGO A;  2DJT A;  4K6Y A;  2EV8 A;  1V1T A;  1TQ3 A;  5I7Z A;  1Z87 A;  2I0I A; 
#chains in the Genus database with same CATH topology
 1MFL A;  2GEF A;  2JRE A;  2OSG A;  2DAZ A;  1I92 A;  1X5R A;  2G2L A;  2V1W A;  3HPM A;  1WF8 A;  1WI2 A;  1X6D A;  3QIK A;  2LC6 A;  2Q3G A;  4JOF A;  2M10 A;  2OZF A;  4NXP A;  4Z8J A;  1OBZ A;  3PV4 A;  4JOK A;  3L4F D;  4Q2O A;  1VCW A;  1WFG A;  4N6X A;  1B8Q A;  5HEY A;  2DLS A;  4FLN A;  4K75 A;  2V90 A;  2EEG A;  4HOP B;  4XHV A;  2PA1 A;  2KJD A;  2D90 A;  5IL9 A;  2KOM A;  4Q2Q A;  5HFC A;  3STJ A;  2OS6 A;  2KBS A;  2VSP A;  1N6F A;  1K32 A;  3OTP A;  5HET A;  5F3X A;  3HPK A;  3ID3 A;  1WI4 A;  2D92 A;  4OAJ A;  3QDO A;  1RGW A;  2M0U A;  3MH4 A;  2EDZ A;  2PZD A;  5E22 A;  1N6E A;  2EJY A;  2RRM A;  2OCS A;  5ILB A;  2L4S A;  1Q3O A;  1ZUB A;  3DOR A;  3I18 A;  1R6J A;  3KZE A;  4P0C A;  5F67 A;  5HDY A;  2PKU A;  3VQG A;  5HF1 A;  5G1E A;  2PDZ A;  3K1R A;  2KRG A;  4MPA A;  2DKR A;  4WYT A;  1ZOK A;  5HFE A;  3PDZ A;  2DB5 A;  1V5Q A;  2KYL A;  3I1E A;  1TP5 A;  2Z9I A;  2AWU A;  1X8S A;  1WHA A;  2EAQ A;  3TSZ A;  3QGL A;  1N7T A;  1X45 A;  3SHW A;  1BE9 A;  1KEF A;  1FC6 A;  3ZRT A;  1W9O A;  4JOJ A;  4OEO A;  3GDU A;  1NF3 C;  1Y8T A;  1V62 A;  2ZPM A;  3CBX A;  3KZD A;  2GZV A;  3QJN A;  1FC7 A;  5E11 A;  5A2P A;  3E17 A;  2M0V A;  3LNX A;  4EDJ A;  2IWN A;  3CYY A;  2OGP A;  5EYZ A;  3DJA A;  4YYX A;  3QJM A;  3PDV A;  5G1D A;  3KDK A;  3CH8 A;  4Z33 A;  3R0H A;  3TSW A;  5HED A;  1U39 A;  4E34 A;  3O46 A;  1VJ6 A;  2JIK A;  2W7R A;  4OEP A;  1N7F A;  4K72 A;  1QAV A;  1G9O A;  2EEJ A;  1Z86 A;  1UF1 A;  3NFL A;  2L97 A;  2M0T A;  4UU6 A;  2I4S A;  2JWE A;  2ENO A;  1RGR A;  1Y7N A;  1OBY A;  2VWR A;  2IWP A;  2R3Y A;  4UU5 A;  1P1D A;  2I1N A;  5B42 A;  3JXT A;  2KOJ A;  4F8K A;  4Q2N A;  1D5G A;  5E1Y A;  4KFW A;  3PV2 A;  3R69 A;  2LOB A;  2I6V A;  2PNT A;  2DC2 A;  3ID2 A;  2UZC A;  3HVQ C;  3DJ3 A;  2KOH A;  1UHP A;  4NMO A;  4L8N A;  1FCF A;  5D13 A;  1SOT A;  3GDV A;  4P2A B;  2JIN A;  2FE5 A;  2IWQ A;  1OZI A;  1IU2 A;  2FN5 A;  5B6L A;  5FB8 C;  2FCF A;  2X7Z A;  4NMR A;  1U38 A;  1IHJ A;  1TE0 A;  2DLU A;  2EHR A;  2OPG A;  3GDS A;  1T2M A;  2ZPL A;  3CS0 A;  2FNE A;  2HE4 A;  2EGK A;  1WJL A;  4NMQ A;  2I0L A;  2M0Z A;  3LNY A;  4GVC A;  1U37 A;  2QBW A;  3WKM A;  2R4H A;  2MX6 A;  1QLC A;  4NMT A;  4NMS A;  3CC0 A;  3KHF A;  1W9E A;  4JOH A;  4NXR A;  2QKT A;  2CSJ A;  4NXQ A;  1V6B A;  2QKU A;  3GJ9 A;  5HFF A;  4JJ3 A;  4R2Z A;  2JSN A;  2JIL A;  2W4F A;  4G69 A;  1YBO A;  3K82 A;  3RLE A;  4KFV A;  2KJK A;  2QKV A;  4O06 A;  4LMM A;  1UJV A;  3RL8 A;  2DMZ A;  2F5Y A;  3RL7 A;  2M3M A;  3FY5 A;  1MFG A;  1W9Q A;  2H2B A;  2KV8 A;  3R68 A;  2QG1 A;  1SOZ A;  2AWW A;  5GLJ A;  2YUY A;  3CBY A;  3TMH A;  1GM1 A;  2I04 A;  2VPH A;  4Q3H A;  2AIN A;  1WF7 A;  5E21 A;  2WL7 A;  3ID4 A;  2JXO A;  1FC9 A;  4JJ0 A;  4WYU A;  5HEB A;  2IWO A;  2RCZ A;  2EEI A;  1BFE A;  5JXB A;  2VRF A;  1UEZ A;  2YT8 A;  3KDG A;  1WHD A;  4K78 A;  1P1E A;  3SOE A;  2K20 A;  2E7K A;  2P3W A;  2YUB A;  3I4W A;  1UEW A;  3ID1 A;  2KA9 A;  2CSS A;  2KJP A;  3DIW A;  2BYG A;  1LCY A;  4JOG A;  2EDV A;  4GHN A;  1Q7X A;  2HGA A;  1X5Q A;  2PKT A;  4JOP A;  1N6D A;  3NGH A;  1N99 A;  1OBX A;  1RY4 A;  1V5L A;  2EGN A;  3SFJ A;  3K50 A;  4YDP A;  2KG2 A;  2KQF A;  1KY9 A;  2KPK A;  4NMP A;  4Q6H A;  2Z17 A;  1KWA A;  1UEP A;  3DJ1 A;  1MC7 A;  2MHO A;  1N7E A;  2VSV A;  5HJ1 A;  4AMH A;  1UIT A;  2O2T A;  3EGH C;  3TSV A;  2LC7 A;  3GCN A;  1X9Z A;  2HE2 A;  1U3B A;  1PDR A;  3PS4 A;  2Q9V A;  5HFD A;  1QAU A;  3SHU A;  1QAV B;  3GGE A;  3GSL A;  4Q6S A;  3NFK A;  1GQ4 A;  4JOE A;  2YT7 A;  2EEH A;  1UM1 A;  1RZX A;  4JL7 A;  5GND A;  1VAE A;  2D8I A;  1UEQ A;  3O5N A;  2QT5 A;  1GQ5 A;  3B76 A;  1NTE A;  1M5Z A;  1UJD A;  4JOR A;  5FHT A;  1Q3P A;  2H3L A;  2KL1 A;  2OQS A;  3MH6 A;  1XZ9 A;  4NMV A;  3VQF A;  1WH1 A;  1X5N A;  1UM7 A;  1IU0 A;  2KAW A;  3QO6 A;  3EGG C;  1TP3 A;  2L4T A;  4IC6 A;  1UJU A;  5HF4 A;  2EDP A;  3QE1 A;  4FGM A;  1L6O A;  4GVD A;  2F0A A;  2H3M A;  2OMJ A;  4REY A;  3PV5 A;  4E3B A;  2VZ5 A;  5DTH A;  2G5M B;  4NNM A;  2CS5 A;  3OU0 A;  1UFX A;  2LA8 A;  5E6P B;  4HOP A;  1VB7 A;  2JOA A;  3CBZ A;  3MH7 A;  2REY A;  4RI0 A;  4Q2P A;  2K1Z A;  4NNL A;  4E35 A;  3AXA A;  2LUI A;  1I16 A;  5HFB A;  5EZ0 A;  4PQW A;  2EXG A;  3SUZ A;  4K76 A;  1WG6 A;  1VA8 A;  2H2C A;  2YTW A;  3BPU A;  2DM8 A;  3NCV A;  3GAB A;  2KPL A;  3WKL A;  1WFV A;  5H3J A;  3GCO A;  2AWX A;  1WIF A;  4H11 A;  2EGO A;  2DJT A;  4K6Y A;  2EV8 A;  1V1T A;  1TQ3 A;  5I7Z A;  1Z87 A;  2I0I A; 
#chains in the Genus database with same CATH homology
 1MFL A;  2GEF A;  2JRE A;  2OSG A;  2DAZ A;  1I92 A;  1X5R A;  2G2L A;  2V1W A;  3HPM A;  1WF8 A;  1WI2 A;  1X6D A;  3QIK A;  2LC6 A;  2Q3G A;  4JOF A;  2M10 A;  2OZF A;  4NXP A;  4Z8J A;  1OBZ A;  3PV4 A;  4JOK A;  3L4F D;  4Q2O A;  1VCW A;  1WFG A;  4N6X A;  1B8Q A;  5HEY A;  2DLS A;  4FLN A;  4K75 A;  2V90 A;  2EEG A;  4HOP B;  4XHV A;  2PA1 A;  2KJD A;  2D90 A;  5IL9 A;  2KOM A;  4Q2Q A;  5HFC A;  3STJ A;  2OS6 A;  2KBS A;  2VSP A;  1N6F A;  1K32 A;  3OTP A;  5HET A;  5F3X A;  3HPK A;  3ID3 A;  1WI4 A;  2D92 A;  4OAJ A;  3QDO A;  1RGW A;  2M0U A;  3MH4 A;  2EDZ A;  2PZD A;  5E22 A;  1N6E A;  2EJY A;  2RRM A;  2OCS A;  5ILB A;  2L4S A;  1Q3O A;  1ZUB A;  3DOR A;  3I18 A;  1R6J A;  3KZE A;  4P0C A;  5F67 A;  5HDY A;  2PKU A;  3VQG A;  5HF1 A;  5G1E A;  2PDZ A;  3K1R A;  2KRG A;  4MPA A;  2DKR A;  4WYT A;  1ZOK A;  5HFE A;  3PDZ A;  2DB5 A;  1V5Q A;  2KYL A;  3I1E A;  1TP5 A;  2Z9I A;  2AWU A;  1X8S A;  1WHA A;  2EAQ A;  3TSZ A;  3QGL A;  1N7T A;  1X45 A;  3SHW A;  1BE9 A;  1KEF A;  1FC6 A;  3ZRT A;  1W9O A;  4JOJ A;  4OEO A;  3GDU A;  1NF3 C;  1Y8T A;  1V62 A;  2ZPM A;  3CBX A;  3KZD A;  2GZV A;  3QJN A;  1FC7 A;  5E11 A;  5A2P A;  3E17 A;  2M0V A;  3LNX A;  4EDJ A;  2IWN A;  3CYY A;  2OGP A;  5EYZ A;  3DJA A;  4YYX A;  3QJM A;  3PDV A;  5G1D A;  3KDK A;  3CH8 A;  4Z33 A;  3R0H A;  3TSW A;  5HED A;  1U39 A;  4E34 A;  3O46 A;  1VJ6 A;  2JIK A;  2W7R A;  4OEP A;  1N7F A;  4K72 A;  1QAV A;  1G9O A;  2EEJ A;  1Z86 A;  1UF1 A;  3NFL A;  2L97 A;  2M0T A;  4UU6 A;  2I4S A;  2JWE A;  2ENO A;  1RGR A;  1Y7N A;  1OBY A;  2VWR A;  2IWP A;  2R3Y A;  4UU5 A;  1P1D A;  2I1N A;  5B42 A;  3JXT A;  2KOJ A;  4F8K A;  4Q2N A;  1D5G A;  5E1Y A;  4KFW A;  3PV2 A;  3R69 A;  2LOB A;  2I6V A;  2PNT A;  2DC2 A;  3ID2 A;  2UZC A;  3HVQ C;  3DJ3 A;  2KOH A;  1UHP A;  4NMO A;  4L8N A;  1FCF A;  5D13 A;  1SOT A;  3GDV A;  4P2A B;  2JIN A;  2FE5 A;  2IWQ A;  1OZI A;  1IU2 A;  2FN5 A;  5B6L A;  5FB8 C;  2FCF A;  2X7Z A;  4NMR A;  1U38 A;  1IHJ A;  1TE0 A;  2DLU A;  2EHR A;  2OPG A;  3GDS A;  1T2M A;  2ZPL A;  3CS0 A;  2FNE A;  2HE4 A;  2EGK A;  1WJL A;  4NMQ A;  2I0L A;  2M0Z A;  3LNY A;  4GVC A;  1U37 A;  2QBW A;  3WKM A;  2R4H A;  2MX6 A;  1QLC A;  4NMT A;  4NMS A;  3CC0 A;  3KHF A;  1W9E A;  4JOH A;  4NXR A;  2QKT A;  2CSJ A;  4NXQ A;  1V6B A;  2QKU A;  3GJ9 A;  5HFF A;  4JJ3 A;  4R2Z A;  2JSN A;  2JIL A;  2W4F A;  4G69 A;  1YBO A;  3K82 A;  3RLE A;  4KFV A;  2KJK A;  2QKV A;  4O06 A;  4LMM A;  1UJV A;  3RL8 A;  2DMZ A;  2F5Y A;  3RL7 A;  2M3M A;  3FY5 A;  1MFG A;  1W9Q A;  2H2B A;  2KV8 A;  3R68 A;  2QG1 A;  1SOZ A;  2AWW A;  5GLJ A;  2YUY A;  3CBY A;  3TMH A;  1GM1 A;  2I04 A;  2VPH A;  4Q3H A;  2AIN A;  1WF7 A;  5E21 A;  2WL7 A;  3ID4 A;  2JXO A;  1FC9 A;  4JJ0 A;  4WYU A;  5HEB A;  2IWO A;  2RCZ A;  2EEI A;  1BFE A;  5JXB A;  2VRF A;  1UEZ A;  2YT8 A;  3KDG A;  1WHD A;  4K78 A;  1P1E A;  3SOE A;  2K20 A;  2E7K A;  2P3W A;  2YUB A;  3I4W A;  1UEW A;  3ID1 A;  2KA9 A;  2CSS A;  2KJP A;  3DIW A;  2BYG A;  1LCY A;  4JOG A;  2EDV A;  4GHN A;  1Q7X A;  2HGA A;  1X5Q A;  2PKT A;  4JOP A;  1N6D A;  3NGH A;  1N99 A;  1OBX A;  1RY4 A;  1V5L A;  2EGN A;  3SFJ A;  3K50 A;  4YDP A;  2KG2 A;  2KQF A;  1KY9 A;  2KPK A;  4NMP A;  4Q6H A;  2Z17 A;  1KWA A;  1UEP A;  3DJ1 A;  1MC7 A;  2MHO A;  1N7E A;  2VSV A;  5HJ1 A;  4AMH A;  1UIT A;  2O2T A;  3EGH C;  3TSV A;  2LC7 A;  3GCN A;  1X9Z A;  2HE2 A;  1U3B A;  1PDR A;  3PS4 A;  2Q9V A;  5HFD A;  1QAU A;  3SHU A;  1QAV B;  3GGE A;  3GSL A;  4Q6S A;  3NFK A;  1GQ4 A;  4JOE A;  2YT7 A;  2EEH A;  1UM1 A;  1RZX A;  4JL7 A;  5GND A;  1VAE A;  2D8I A;  1UEQ A;  3O5N A;  2QT5 A;  1GQ5 A;  3B76 A;  1NTE A;  1M5Z A;  1UJD A;  4JOR A;  5FHT A;  1Q3P A;  2H3L A;  2KL1 A;  2OQS A;  3MH6 A;  1XZ9 A;  4NMV A;  3VQF A;  1WH1 A;  1X5N A;  1UM7 A;  1IU0 A;  2KAW A;  3QO6 A;  3EGG C;  1TP3 A;  2L4T A;  4IC6 A;  1UJU A;  5HF4 A;  2EDP A;  3QE1 A;  4FGM A;  1L6O A;  4GVD A;  2F0A A;  2H3M A;  2OMJ A;  4REY A;  3PV5 A;  4E3B A;  2VZ5 A;  5DTH A;  2G5M B;  4NNM A;  2CS5 A;  3OU0 A;  1UFX A;  2LA8 A;  5E6P B;  4HOP A;  1VB7 A;  2JOA A;  3CBZ A;  3MH7 A;  2REY A;  4RI0 A;  4Q2P A;  2K1Z A;  4NNL A;  4E35 A;  3AXA A;  2LUI A;  1I16 A;  5HFB A;  5EZ0 A;  4PQW A;  2EXG A;  3SUZ A;  4K76 A;  1WG6 A;  1VA8 A;  2H2C A;  2YTW A;  3BPU A;  2DM8 A;  3NCV A;  3GAB A;  2KPL A;  3WKL A;  1WFV A;  5H3J A;  3GCO A;  2AWX A;  1WIF A;  4H11 A;  2EGO A;  2DJT A;  4K6Y A;  2EV8 A;  1V1T A;  1TQ3 A;  5I7Z A;  1Z87 A;  2I0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...