2EHRA

Solution structure of the sixth pdz domain of human inad-like protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
117
structure length
117
Chain Sequence
GSSGSSGPNFSHWGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASHSEAVEAIKNAGNPVVFIVQSLSSTPRVIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords InaD-like protein
publication title Solution structure of the sixth PDZ domain of human InaD-like protein
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 13
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2ehrA00
4Q2OA 1WFGA 4Q2PA 2I04A 2I0IA 4GVDA 2W4FA 3RL7A 4AMHA 2KOMA 1PDRA 1X8SA 5H3JA 2PA1A 2K20A 1OBYA 3ID3A 4NXRA 1MFGA 2L97A 1T2MA 3JXTA 2OCSA 4YYXA 3K1RA 1V1TA 1N7EA 4N6XA 2VSVA 4JOEA 4K6YA 2Q3GA 4IC6A 2AWUA 4JOPA 1BE9A 1Y8TA 5HF1A 2PZDA 4E34A 2EGNA 1IHJA 2LC7A 3MH7A 1UEPA 3OU0A 1WIFA 1UJVA 1WI4A 4Z33A 2KPLA 2ENOA 3GGEA 2DC2A 2KL1A 3DIWA 4NNMA 4XHVA 5A2PA 4YDPA 3MH6A 1VAEA 1N6FA 5EZ0A 3RLEA 4O06A 2CSSA 2H3LA 1X5RA 4HOPB 1RGWA 5HEBA 1Z86A 1OBXA 2PKUA 2IWQA 2KOHA 1SOZA 4NMVA 2BYGA 3LNYA 3PDZA 1SOTA 5E6PB 3DJ3A 2KJPA 3KZEA 3O5NA 2EXGA 3QJMA 3E17A 3SUZA 1MFLA 4Q2NA 1LCYA 2REYA 3GSLA 4JOJA 1N99A 3QIKA 1WFVA 2YTWA 2I1NA 5E1YA 1UEZA 1V5LA 3SHUA 3AXAA 2HGAA 3VQFA 3CC0A 5HEDA 5HFEA 3TSVA 2H2BA 5EYZA 1WG6A 4NMRA 1XZ9A 2HE4A 3HVQC 3R69A 3GDUA 2LUIA 3PV5A 1U37A 1OZIA 2KOJA 2M0UA 3DJ1A 3NFKA 5I7ZA 3GCNA 3ID1A 2V1WA 3FY5A 4P0CA 4LMMA 1GQ4A 2KAWA 1Z87A 2KA9A 2R3YA 4KFWA 4NXQA 1UITA 1L6OA 2OPGA 2IWPA 1OBZA 2JWEA 4Z8JA 3MH4A 1V6BA 2AWWA 2UZCA 2DLSA 1UM1A 3TSWA 2I0LA 1VJ6A 3WKLA 2VWRA 1Y7NA 4EDJA 4JL7A 4UU5A 1UEWA 3K82A 2EDZA 4JOHA 5HEYA 4H11A 2K1ZA 2AINA 2EEGA 2GZVA 3QGLA 5D13A 3GCOA 5F3XA 2JXOA 4NMQA 1NF3C 2JIKA 1RGRA 1V62A 2WL7A 4L8NA 3TMHA 1UHPA 1KY9A 1U39A 1GQ5A 2YT7A 4E3BA 2H3MA 2YT8A 1VA8A 2VZ5A 1IU2A 5HFDA 5E22A 3PS4A 2KBSA 3CS0A 2F5YA 3STJA 2FNEA 1QAVB 2OSGA 2OGPA 2RCZA 2LA8A 2JILA 2MHOA 2KRGA 2FN5A 2KPKA 5G1DA 1TQ3A 2LC6A 4JORA 1UEQA 1X6DA 2VPHA 3B76A 2EDPA 4HOPA 2KJKA 4NMTA 2D90A 2QG1A 3SHWA 3ID4A 1X5NA 2DJTA 3CH8A 5GNDA 4MPAA 4Q6SA 1R6JA 2L4SA 4Q3HA 5DTHA 4OEOA 2RRMA 5HF4A 3WKMA 5FB8C 3ZRTA 1KEFA 1IU0A 2EHRA 4JOKA 3CBZA 2Z9IA 1Q3PA 3GDVA 3TSZA 1B8QA 2IWNA 4K75A 2DMZA 1W9EA 2I6VA 1P1DA 2O2TA 2KG2A 1RY4A 3R0HA 3HPMA 4REYA 1G9OA 2JREA 2AWXA 2DM8A 2W7RA 2M0ZA 5HDYA 1YBOA 2M0VA 2OMJA 2E7KA 2VSPA 4R2ZA 4K78A 2EGOA 3KZDA 5E21A 1WJLA 2EV8A 1N6DA 1FC9A 1N6EA 1KWAA 3LNXA 2P3WA 1UFXA 2R4HA 3BPUA 4PQWA 5F67A 1ZOKA 4RI0A 1VCWA 1ZUBA 2DLUA 2Q9VA 3PV2A 2QBWA 2DAZA 1M5ZA 1Q7XA 1FCFA 3DORA 2CSJA 1GM1A 2KQFA 1UJUA 2EJYA 1MC7A 3ID2A 2YUYA 3SFJA 2EEJA 4GHNA 4WYTA 2PKTA 1I16A 1WI2A 2EDVA 2JINA 1N7FA 3I1EA 4JOFA 2OQSA 1N7TA 1UF1A 2IWOA 2HE2A 2VRFA 3DJAA 2EEIA 3EGGC 1U3BA 2DB5A 3SOEA 3L4FD 3QJNA 4NNLA 4GVCA 4NMPA 1WHDA 4WYUA 4Q6HA 4P2AB 2CS5A 5HFBA 5FHTA 3QE1A 5HFFA 2PNTA 1VB7A 3I4WA 1X5QA 2YUBA 1UM7A 3CBXA 2L4TA 4UU6A 2JOAA 2M3MA 1WF8A 1UJDA 2QKTA 2X7ZA 2M10A 2G5MB 3KHFA 2OZFA 4NXPA 3QO6A 1Q3OA 3PDVA 2EEHA 4G69A 3GDSA 2G2LA 3CBYA 4JOGA 2MX6A 2D8IA 2OS6A 3NGHA 2D92A 2PDZA 2QKUA 2EAQA 1QAVA 4OEPA 5E11A 2KYLA 4FGMA 5B6LA 2V90A 5HJ1A 2KV8A 2QKVA 1TP5A 3R68A 1WF7A 3QDOA 1K32A 4E35A 2F0AA 2Z17A 5GLJA 3EGHC 2ZPMA 3PV4A 1TE0A 1D5GA 5G1EA 4NMSA 2KJDA 2LOBA 5HFCA 4NMOA 2DKRA 3NFLA 4K76A 4Q2QA 1NTEA 1RZXA 1U38A 1TP3A 2FCFA 3K50A 1I92A 2M0TA 2QT5A 2H2CA 1W9OA 1QLCA 3O46A 3VQGA 1FC6A 2EGKA 1V5QA 3HPKA 1X45A 3OTPA 1FC7A 1QAUA 2I4SA 3CYYA 4OAJA 4F8KA 3RL8A 1BFEA 1P1EA 3GJ9A 2FE5A 5HETA 2ZPLA 4KFVA 5JXBA 1WH1A 1W9QA 3I18A 1WHAA 4K72A
chains in the Genus database with same CATH superfamily
4Q2OA 1WFGA 4Q2PA 5B42A 2I04A 2JSNA 2I0IA 4GVDA 2W4FA 3RL7A 4AMHA 2KOMA 1PDRA 1X8SA 5H3JA 2PA1A 2K20A 1OBYA 3ID3A 4NXRA 1MFGA 2L97A 1T2MA 3JXTA 2OCSA 4YYXA 3K1RA 2GEFA 4JJ0A 1V1TA 1N7EA 4N6XA 2VSVA 4JOEA 4K6YA 2Q3GA 4IC6A 2AWUA 4JOPA 1BE9A 1Y8TA 5HF1A 2PZDA 4E34A 4JJ3A 2EGNA 1IHJA 2LC7A 3MH7A 1UEPA 3OU0A 1WIFA 1UJVA 1WI4A 4Z33A 2KPLA 2ENOA 3GGEA 2DC2A 2KL1A 3DIWA 4NNMA 4XHVA 5A2PA 4YDPA 3MH6A 1VAEA 1N6FA 5EZ0A 3RLEA 4O06A 2CSSA 2H3LA 1X5RA 4HOPB 1RGWA 5HEBA 1Z86A 1OBXA 2PKUA 2IWQA 2KOHA 1SOZA 4NMVA 2BYGA 3LNYA 3PDZA 1SOTA 5E6PB 3DJ3A 2KJPA 3KZEA 3O5NA 2EXGA 3QJMA 3E17A 3SUZA 1MFLA 4Q2NA 1LCYA 2REYA 3GSLA 4JOJA 1N99A 3QIKA 1WFVA 2YTWA 2I1NA 5E1YA 1UEZA 1V5LA 3SHUA 3AXAA 2HGAA 3VQFA 3CC0A 5HEDA 5HFEA 3TSVA 2H2BA 5EYZA 1WG6A 4NMRA 1XZ9A 2HE4A 3HVQC 3R69A 3GDUA 2LUIA 3KDGA 3PV5A 1U37A 1OZIA 2KOJA 2M0UA 3DJ1A 3NFKA 5I7ZA 3GCNA 3ID1A 2V1WA 3FY5A 4P0CA 4LMMA 1GQ4A 2KAWA 1Z87A 2KA9A 2R3YA 4KFWA 4NXQA 1UITA 1L6OA 2OPGA 2IWPA 1OBZA 2JWEA 4Z8JA 3MH4A 1V6BA 2AWWA 2UZCA 2DLSA 1UM1A 3TSWA 2I0LA 1VJ6A 3WKLA 2VWRA 1Y7NA 3GABA 4EDJA 4JL7A 4UU5A 1UEWA 3K82A 2EDZA 4JOHA 5HEYA 4H11A 2K1ZA 2AINA 2EEGA 2GZVA 3QGLA 5D13A 3GCOA 5F3XA 2JXOA 4NMQA 1NF3C 2JIKA 1RGRA 1V62A 1X9ZA 2WL7A 4L8NA 3TMHA 1UHPA 1KY9A 1U39A 1GQ5A 3KDKA 2YT7A 4E3BA 2H3MA 2YT8A 1VA8A 2VZ5A 1IU2A 5HFDA 5ILBA 5E22A 3PS4A 2KBSA 3CS0A 2F5YA 3STJA 2FNEA 1QAVB 2OSGA 2OGPA 2RCZA 2LA8A 2JILA 2MHOA 2KRGA 2FN5A 2KPKA 5G1DA 1TQ3A 2LC6A 4JORA 1UEQA 1X6DA 2VPHA 3B76A 2EDPA 4HOPA 2KJKA 4NMTA 2D90A 2QG1A 3SHWA 3ID4A 1X5NA 2DJTA 3CH8A 5IL9A 5GNDA 4MPAA 4Q6SA 1R6JA 2L4SA 4Q3HA 5DTHA 4OEOA 2RRMA 5HF4A 3WKMA 5FB8C 3ZRTA 1KEFA 1IU0A 2EHRA 4JOKA 3CBZA 2Z9IA 3NCVA 1Q3PA 3GDVA 3TSZA 1B8QA 2IWNA 4K75A 2DMZA 1W9EA 2I6VA 1P1DA 2O2TA 2KG2A 1RY4A 3R0HA 4FLNA 3HPMA 4REYA 1G9OA 2JREA 2AWXA 2DM8A 2W7RA 2M0ZA 5HDYA 1YBOA 2M0VA 2OMJA 2E7KA 2VSPA 4R2ZA 4K78A 2EGOA 3KZDA 5E21A 1WJLA 2EV8A 1N6DA 1FC9A 1N6EA 1KWAA 3LNXA 2P3WA 1UFXA 2R4HA 3BPUA 4PQWA 5F67A 1ZOKA 4RI0A 1VCWA 1ZUBA 2DLUA 2Q9VA 3PV2A 2QBWA 2DAZA 1M5ZA 1Q7XA 1FCFA 3DORA 2CSJA 1GM1A 2KQFA 1UJUA 2EJYA 1MC7A 3ID2A 2YUYA 3SFJA 2EEJA 4GHNA 4WYTA 2PKTA 1I16A 1WI2A 2EDVA 2JINA 1N7FA 3I1EA 4JOFA 2OQSA 1N7TA 1UF1A 2IWOA 2HE2A 2VRFA 3DJAA 2EEIA 3EGGC 1U3BA 2DB5A 3SOEA 3L4FD 3QJNA 4NNLA 4GVCA 4NMPA 1WHDA 4WYUA 4Q6HA 4P2AB 2CS5A 5HFBA 5FHTA 3QE1A 5HFFA 2PNTA 1VB7A 3I4WA 1X5QA 2YUBA 1UM7A 3CBXA 2L4TA 4UU6A 2JOAA 2M3MA 1WF8A 1UJDA 2QKTA 2X7ZA 2M10A 2G5MB 3KHFA 2OZFA 4NXPA 3QO6A 1Q3OA 3PDVA 2EEHA 4G69A 3GDSA 2G2LA 3CBYA 4JOGA 2MX6A 2D8IA 2OS6A 3NGHA 2D92A 2PDZA 2QKUA 2EAQA 1QAVA 4OEPA 5E11A 2KYLA 4FGMA 5B6LA 2V90A 5HJ1A 2KV8A 2QKVA 1TP5A 3R68A 1WF7A 3QDOA 1K32A 4E35A 2F0AA 2Z17A 5GLJA 3EGHC 2ZPMA 3PV4A 1TE0A 1D5GA 5G1EA 4NMSA 2KJDA 2LOBA 5HFCA 4NMOA 2DKRA 3NFLA 4K76A 4Q2QA 1NTEA 1RZXA 1U38A 1TP3A 2FCFA 3K50A 1I92A 2M0TA 2QT5A 2H2CA 1W9OA 1QLCA 3O46A 3VQGA 1FC6A 2EGKA 1V5QA 3HPKA 1X45A 3OTPA 1FC7A 1QAUA 2I4SA 3CYYA 4OAJA 4F8KA 3RL8A 1BFEA 1P1EA 3GJ9A 2FE5A 5HETA 2ZPLA 4KFVA 5JXBA 1WH1A 1W9QA 3I18A 1WHAA 4K72A
chains in the Genus database with same CATH topology
4Q2OA 1WFGA 4Q2PA 5B42A 2I04A 2JSNA 2I0IA 4GVDA 2W4FA 3RL7A 4AMHA 2KOMA 1PDRA 1X8SA 5H3JA 2PA1A 2K20A 1OBYA 3ID3A 4NXRA 1MFGA 2L97A 1T2MA 3JXTA 2OCSA 4YYXA 3K1RA 2GEFA 4JJ0A 1V1TA 1N7EA 4N6XA 2VSVA 4JOEA 4K6YA 2Q3GA 4IC6A 2AWUA 4JOPA 1BE9A 1Y8TA 5HF1A 2PZDA 4E34A 4JJ3A 2EGNA 1IHJA 2LC7A 3MH7A 1UEPA 3OU0A 1WIFA 1UJVA 1WI4A 4Z33A 2KPLA 2ENOA 3GGEA 2DC2A 2KL1A 3DIWA 4NNMA 4XHVA 5A2PA 4YDPA 3MH6A 1VAEA 1N6FA 5EZ0A 3RLEA 4O06A 2CSSA 2H3LA 1X5RA 4HOPB 1RGWA 5HEBA 1Z86A 1OBXA 2PKUA 2IWQA 2KOHA 1SOZA 4NMVA 2BYGA 3LNYA 3PDZA 1SOTA 5E6PB 3DJ3A 2KJPA 3KZEA 3O5NA 2EXGA 3QJMA 3E17A 3SUZA 1MFLA 4Q2NA 1LCYA 2REYA 3GSLA 4JOJA 1N99A 3QIKA 1WFVA 2YTWA 2I1NA 5E1YA 1UEZA 1V5LA 3SHUA 3AXAA 2HGAA 3VQFA 3CC0A 5HEDA 5HFEA 3TSVA 2H2BA 5EYZA 1WG6A 4NMRA 1XZ9A 2HE4A 3HVQC 3R69A 3GDUA 2LUIA 3KDGA 3PV5A 1U37A 1OZIA 2KOJA 2M0UA 3DJ1A 3NFKA 5I7ZA 3GCNA 3ID1A 2V1WA 3FY5A 4P0CA 4LMMA 1GQ4A 2KAWA 1Z87A 2KA9A 2R3YA 4KFWA 4NXQA 1UITA 1L6OA 2OPGA 2IWPA 1OBZA 2JWEA 4Z8JA 3MH4A 1V6BA 2AWWA 2UZCA 2DLSA 1UM1A 3TSWA 2I0LA 1VJ6A 3WKLA 2VWRA 1Y7NA 3GABA 4EDJA 4JL7A 4UU5A 1UEWA 3K82A 2EDZA 4JOHA 5HEYA 4H11A 2K1ZA 2AINA 2EEGA 2GZVA 3QGLA 5D13A 3GCOA 5F3XA 2JXOA 4NMQA 1NF3C 2JIKA 1RGRA 1V62A 1X9ZA 2WL7A 4L8NA 3TMHA 1UHPA 1KY9A 1U39A 1GQ5A 3KDKA 2YT7A 4E3BA 2H3MA 2YT8A 1VA8A 2VZ5A 1IU2A 5HFDA 5ILBA 5E22A 3PS4A 2KBSA 3CS0A 2F5YA 3STJA 2FNEA 1QAVB 2OSGA 2OGPA 2RCZA 2LA8A 2JILA 2MHOA 2KRGA 2FN5A 2KPKA 5G1DA 1TQ3A 2LC6A 4JORA 1UEQA 1X6DA 2VPHA 3B76A 2EDPA 4HOPA 2KJKA 4NMTA 2D90A 2QG1A 3SHWA 3ID4A 1X5NA 2DJTA 3CH8A 5IL9A 5GNDA 4MPAA 4Q6SA 1R6JA 2L4SA 4Q3HA 5DTHA 4OEOA 2RRMA 5HF4A 3WKMA 5FB8C 3ZRTA 1KEFA 1IU0A 2EHRA 4JOKA 3CBZA 2Z9IA 3NCVA 1Q3PA 3GDVA 3TSZA 1B8QA 2IWNA 4K75A 2DMZA 1W9EA 2I6VA 1P1DA 2O2TA 2KG2A 1RY4A 3R0HA 4FLNA 3HPMA 4REYA 1G9OA 2JREA 2AWXA 2DM8A 2W7RA 2M0ZA 5HDYA 1YBOA 2M0VA 2OMJA 2E7KA 2VSPA 4R2ZA 4K78A 2EGOA 3KZDA 5E21A 1WJLA 2EV8A 1N6DA 1FC9A 1N6EA 1KWAA 3LNXA 2P3WA 1UFXA 2R4HA 3BPUA 4PQWA 5F67A 1ZOKA 4RI0A 1VCWA 1ZUBA 2DLUA 2Q9VA 3PV2A 2QBWA 2DAZA 1M5ZA 1Q7XA 1FCFA 3DORA 2CSJA 1GM1A 2KQFA 1UJUA 2EJYA 1MC7A 3ID2A 2YUYA 3SFJA 2EEJA 4GHNA 4WYTA 2PKTA 1I16A 1WI2A 2EDVA 2JINA 1N7FA 3I1EA 4JOFA 2OQSA 1N7TA 1UF1A 2IWOA 2HE2A 2VRFA 3DJAA 2EEIA 3EGGC 1U3BA 2DB5A 3SOEA 3L4FD 3QJNA 4NNLA 4GVCA 4NMPA 1WHDA 4WYUA 4Q6HA 4P2AB 2CS5A 5HFBA 5FHTA 3QE1A 5HFFA 2PNTA 1VB7A 3I4WA 1X5QA 2YUBA 1UM7A 3CBXA 2L4TA 4UU6A 2JOAA 2M3MA 1WF8A 1UJDA 2QKTA 2X7ZA 2M10A 2G5MB 3KHFA 2OZFA 4NXPA 3QO6A 1Q3OA 3PDVA 2EEHA 4G69A 3GDSA 2G2LA 3CBYA 4JOGA 2MX6A 2D8IA 2OS6A 3NGHA 2D92A 2PDZA 2QKUA 2EAQA 1QAVA 4OEPA 5E11A 2KYLA 4FGMA 5B6LA 2V90A 5HJ1A 2KV8A 2QKVA 1TP5A 3R68A 1WF7A 3QDOA 1K32A 4E35A 2F0AA 2Z17A 5GLJA 3EGHC 2ZPMA 3PV4A 1TE0A 1D5GA 5G1EA 4NMSA 2KJDA 2LOBA 5HFCA 4NMOA 2DKRA 3NFLA 4K76A 4Q2QA 1NTEA 1RZXA 1U38A 1TP3A 2FCFA 3K50A 1I92A 2M0TA 2QT5A 2H2CA 1W9OA 1QLCA 3O46A 3VQGA 1FC6A 2EGKA 1V5QA 3HPKA 1X45A 3OTPA 1FC7A 1QAUA 2I4SA 3CYYA 4OAJA 4F8KA 3RL8A 1BFEA 1P1EA 3GJ9A 2FE5A 5HETA 2ZPLA 4KFVA 5JXBA 1WH1A 1W9QA 3I18A 1WHAA 4K72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2O A;  1WFG A;  4Q2P A;  2I04 A;  2I0I A;  4GVD A;  2W4F A;  3RL7 A;  4AMH A;  2KOM A;  1PDR A;  1X8S A;  5H3J A;  2PA1 A;  2K20 A;  1OBY A;  3ID3 A;  4NXR A;  1MFG A;  2L97 A;  1T2M A;  3JXT A;  2OCS A;  4YYX A;  3K1R A;  1V1T A;  1N7E A;  4N6X A;  2VSV A;  4JOE A;  4K6Y A;  2Q3G A;  4IC6 A;  2AWU A;  4JOP A;  1BE9 A;  1Y8T A;  5HF1 A;  2PZD A;  4E34 A;  2EGN A;  1IHJ A;  2LC7 A;  3MH7 A;  1UEP A;  3OU0 A;  1WIF A;  1UJV A;  1WI4 A;  4Z33 A;  2KPL A;  2ENO A;  3GGE A;  2DC2 A;  2KL1 A;  3DIW A;  4NNM A;  4XHV A;  5A2P A;  4YDP A;  3MH6 A;  1VAE A;  1N6F A;  5EZ0 A;  3RLE A;  4O06 A;  2CSS A;  2H3L A;  1X5R A;  4HOP B;  1RGW A;  5HEB A;  1Z86 A;  1OBX A;  2PKU A;  2IWQ A;  2KOH A;  1SOZ A;  4NMV A;  2BYG A;  3LNY A;  3PDZ A;  1SOT A;  5E6P B;  3DJ3 A;  2KJP A;  3KZE A;  3O5N A;  2EXG A;  3QJM A;  3E17 A;  3SUZ A;  1MFL A;  4Q2N A;  1LCY A;  2REY A;  3GSL A;  4JOJ A;  1N99 A;  3QIK A;  1WFV A;  2YTW A;  2I1N A;  5E1Y A;  1UEZ A;  1V5L A;  3SHU A;  3AXA A;  2HGA A;  3VQF A;  3CC0 A;  5HED A;  5HFE A;  3TSV A;  2H2B A;  5EYZ A;  1WG6 A;  4NMR A;  1XZ9 A;  2HE4 A;  3HVQ C;  3R69 A;  3GDU A;  2LUI A;  3PV5 A;  1U37 A;  1OZI A;  2KOJ A;  2M0U A;  3DJ1 A;  3NFK A;  5I7Z A;  3GCN A;  3ID1 A;  2V1W A;  3FY5 A;  4P0C A;  4LMM A;  1GQ4 A;  2KAW A;  1Z87 A;  2KA9 A;  2R3Y A;  4KFW A;  4NXQ A;  1UIT A;  1L6O A;  2OPG A;  2IWP A;  1OBZ A;  2JWE A;  4Z8J A;  3MH4 A;  1V6B A;  2AWW A;  2UZC A;  2DLS A;  1UM1 A;  3TSW A;  2I0L A;  1VJ6 A;  3WKL A;  2VWR A;  1Y7N A;  4EDJ A;  4JL7 A;  4UU5 A;  1UEW A;  3K82 A;  2EDZ A;  4JOH A;  5HEY A;  4H11 A;  2K1Z A;  2AIN A;  2EEG A;  2GZV A;  3QGL A;  5D13 A;  3GCO A;  5F3X A;  2JXO A;  4NMQ A;  1NF3 C;  2JIK A;  1RGR A;  1V62 A;  2WL7 A;  4L8N A;  3TMH A;  1UHP A;  1KY9 A;  1U39 A;  1GQ5 A;  2YT7 A;  4E3B A;  2H3M A;  2YT8 A;  1VA8 A;  2VZ5 A;  1IU2 A;  5HFD A;  5E22 A;  3PS4 A;  2KBS A;  3CS0 A;  2F5Y A;  3STJ A;  2FNE A;  1QAV B;  2OSG A;  2OGP A;  2RCZ A;  2LA8 A;  2JIL A;  2MHO A;  2KRG A;  2FN5 A;  2KPK A;  5G1D A;  1TQ3 A;  2LC6 A;  4JOR A;  1UEQ A;  1X6D A;  2VPH A;  3B76 A;  2EDP A;  4HOP A;  2KJK A;  4NMT A;  2D90 A;  2QG1 A;  3SHW A;  3ID4 A;  1X5N A;  2DJT A;  3CH8 A;  5GND A;  4MPA A;  4Q6S A;  1R6J A;  2L4S A;  4Q3H A;  5DTH A;  4OEO A;  2RRM A;  5HF4 A;  3WKM A;  5FB8 C;  3ZRT A;  1KEF A;  1IU0 A;  2EHR A;  4JOK A;  3CBZ A;  2Z9I A;  1Q3P A;  3GDV A;  3TSZ A;  1B8Q A;  2IWN A;  4K75 A;  2DMZ A;  1W9E A;  2I6V A;  1P1D A;  2O2T A;  2KG2 A;  1RY4 A;  3R0H A;  3HPM A;  4REY A;  1G9O A;  2JRE A;  2AWX A;  2DM8 A;  2W7R A;  2M0Z A;  5HDY A;  1YBO A;  2M0V A;  2OMJ A;  2E7K A;  2VSP A;  4R2Z A;  4K78 A;  2EGO A;  3KZD A;  5E21 A;  1WJL A;  2EV8 A;  1N6D A;  1FC9 A;  1N6E A;  1KWA A;  3LNX A;  2P3W A;  1UFX A;  2R4H A;  3BPU A;  4PQW A;  5F67 A;  1ZOK A;  4RI0 A;  1VCW A;  1ZUB A;  2DLU A;  2Q9V A;  3PV2 A;  2QBW A;  2DAZ A;  1M5Z A;  1Q7X A;  1FCF A;  3DOR A;  2CSJ A;  1GM1 A;  2KQF A;  1UJU A;  2EJY A;  1MC7 A;  3ID2 A;  2YUY A;  3SFJ A;  2EEJ A;  4GHN A;  4WYT A;  2PKT A;  1I16 A;  1WI2 A;  2EDV A;  2JIN A;  1N7F A;  3I1E A;  4JOF A;  2OQS A;  1N7T A;  1UF1 A;  2IWO A;  2HE2 A;  2VRF A;  3DJA A;  2EEI A;  3EGG C;  1U3B A;  2DB5 A;  3SOE A;  3L4F D;  3QJN A;  4NNL A;  4GVC A;  4NMP A;  1WHD A;  4WYU A;  4Q6H A;  4P2A B;  2CS5 A;  5HFB A;  5FHT A;  3QE1 A;  5HFF A;  2PNT A;  1VB7 A;  3I4W A;  1X5Q A;  2YUB A;  1UM7 A;  3CBX A;  2L4T A;  4UU6 A;  2JOA A;  2M3M A;  1WF8 A;  1UJD A;  2QKT A;  2X7Z A;  2M10 A;  2G5M B;  3KHF A;  2OZF A;  4NXP A;  3QO6 A;  1Q3O A;  3PDV A;  2EEH A;  4G69 A;  3GDS A;  2G2L A;  3CBY A;  4JOG A;  2MX6 A;  2D8I A;  2OS6 A;  3NGH A;  2D92 A;  2PDZ A;  2QKU A;  2EAQ A;  1QAV A;  4OEP A;  5E11 A;  2KYL A;  4FGM A;  5B6L A;  2V90 A;  5HJ1 A;  2KV8 A;  2QKV A;  1TP5 A;  3R68 A;  1WF7 A;  3QDO A;  1K32 A;  4E35 A;  2F0A A;  2Z17 A;  5GLJ A;  3EGH C;  2ZPM A;  3PV4 A;  1TE0 A;  1D5G A;  5G1E A;  4NMS A;  2KJD A;  2LOB A;  5HFC A;  4NMO A;  2DKR A;  3NFL A;  4K76 A;  4Q2Q A;  1NTE A;  1RZX A;  1U38 A;  1TP3 A;  2FCF A;  3K50 A;  1I92 A;  2M0T A;  2QT5 A;  2H2C A;  1W9O A;  1QLC A;  3O46 A;  3VQG A;  1FC6 A;  2EGK A;  1V5Q A;  3HPK A;  1X45 A;  3OTP A;  1FC7 A;  1QAU A;  2I4S A;  3CYY A;  4OAJ A;  4F8K A;  3RL8 A;  1BFE A;  1P1E A;  3GJ9 A;  2FE5 A;  5HET A;  2ZPL A;  4KFV A;  5JXB A;  1WH1 A;  1W9Q A;  3I18 A;  1WHA A;  4K72 A; 
#chains in the Genus database with same CATH topology
 4Q2O A;  1WFG A;  4Q2P A;  5B42 A;  2I04 A;  2JSN A;  2I0I A;  4GVD A;  2W4F A;  3RL7 A;  4AMH A;  2KOM A;  1PDR A;  1X8S A;  5H3J A;  2PA1 A;  2K20 A;  1OBY A;  3ID3 A;  4NXR A;  1MFG A;  2L97 A;  1T2M A;  3JXT A;  2OCS A;  4YYX A;  3K1R A;  2GEF A;  4JJ0 A;  1V1T A;  1N7E A;  4N6X A;  2VSV A;  4JOE A;  4K6Y A;  2Q3G A;  4IC6 A;  2AWU A;  4JOP A;  1BE9 A;  1Y8T A;  5HF1 A;  2PZD A;  4E34 A;  4JJ3 A;  2EGN A;  1IHJ A;  2LC7 A;  3MH7 A;  1UEP A;  3OU0 A;  1WIF A;  1UJV A;  1WI4 A;  4Z33 A;  2KPL A;  2ENO A;  3GGE A;  2DC2 A;  2KL1 A;  3DIW A;  4NNM A;  4XHV A;  5A2P A;  4YDP A;  3MH6 A;  1VAE A;  1N6F A;  5EZ0 A;  3RLE A;  4O06 A;  2CSS A;  2H3L A;  1X5R A;  4HOP B;  1RGW A;  5HEB A;  1Z86 A;  1OBX A;  2PKU A;  2IWQ A;  2KOH A;  1SOZ A;  4NMV A;  2BYG A;  3LNY A;  3PDZ A;  1SOT A;  5E6P B;  3DJ3 A;  2KJP A;  3KZE A;  3O5N A;  2EXG A;  3QJM A;  3E17 A;  3SUZ A;  1MFL A;  4Q2N A;  1LCY A;  2REY A;  3GSL A;  4JOJ A;  1N99 A;  3QIK A;  1WFV A;  2YTW A;  2I1N A;  5E1Y A;  1UEZ A;  1V5L A;  3SHU A;  3AXA A;  2HGA A;  3VQF A;  3CC0 A;  5HED A;  5HFE A;  3TSV A;  2H2B A;  5EYZ A;  1WG6 A;  4NMR A;  1XZ9 A;  2HE4 A;  3HVQ C;  3R69 A;  3GDU A;  2LUI A;  3KDG A;  3PV5 A;  1U37 A;  1OZI A;  2KOJ A;  2M0U A;  3DJ1 A;  3NFK A;  5I7Z A;  3GCN A;  3ID1 A;  2V1W A;  3FY5 A;  4P0C A;  4LMM A;  1GQ4 A;  2KAW A;  1Z87 A;  2KA9 A;  2R3Y A;  4KFW A;  4NXQ A;  1UIT A;  1L6O A;  2OPG A;  2IWP A;  1OBZ A;  2JWE A;  4Z8J A;  3MH4 A;  1V6B A;  2AWW A;  2UZC A;  2DLS A;  1UM1 A;  3TSW A;  2I0L A;  1VJ6 A;  3WKL A;  2VWR A;  1Y7N A;  3GAB A;  4EDJ A;  4JL7 A;  4UU5 A;  1UEW A;  3K82 A;  2EDZ A;  4JOH A;  5HEY A;  4H11 A;  2K1Z A;  2AIN A;  2EEG A;  2GZV A;  3QGL A;  5D13 A;  3GCO A;  5F3X A;  2JXO A;  4NMQ A;  1NF3 C;  2JIK A;  1RGR A;  1V62 A;  1X9Z A;  2WL7 A;  4L8N A;  3TMH A;  1UHP A;  1KY9 A;  1U39 A;  1GQ5 A;  3KDK A;  2YT7 A;  4E3B A;  2H3M A;  2YT8 A;  1VA8 A;  2VZ5 A;  1IU2 A;  5HFD A;  5ILB A;  5E22 A;  3PS4 A;  2KBS A;  3CS0 A;  2F5Y A;  3STJ A;  2FNE A;  1QAV B;  2OSG A;  2OGP A;  2RCZ A;  2LA8 A;  2JIL A;  2MHO A;  2KRG A;  2FN5 A;  2KPK A;  5G1D A;  1TQ3 A;  2LC6 A;  4JOR A;  1UEQ A;  1X6D A;  2VPH A;  3B76 A;  2EDP A;  4HOP A;  2KJK A;  4NMT A;  2D90 A;  2QG1 A;  3SHW A;  3ID4 A;  1X5N A;  2DJT A;  3CH8 A;  5IL9 A;  5GND A;  4MPA A;  4Q6S A;  1R6J A;  2L4S A;  4Q3H A;  5DTH A;  4OEO A;  2RRM A;  5HF4 A;  3WKM A;  5FB8 C;  3ZRT A;  1KEF A;  1IU0 A;  2EHR A;  4JOK A;  3CBZ A;  2Z9I A;  3NCV A;  1Q3P A;  3GDV A;  3TSZ A;  1B8Q A;  2IWN A;  4K75 A;  2DMZ A;  1W9E A;  2I6V A;  1P1D A;  2O2T A;  2KG2 A;  1RY4 A;  3R0H A;  4FLN A;  3HPM A;  4REY A;  1G9O A;  2JRE A;  2AWX A;  2DM8 A;  2W7R A;  2M0Z A;  5HDY A;  1YBO A;  2M0V A;  2OMJ A;  2E7K A;  2VSP A;  4R2Z A;  4K78 A;  2EGO A;  3KZD A;  5E21 A;  1WJL A;  2EV8 A;  1N6D A;  1FC9 A;  1N6E A;  1KWA A;  3LNX A;  2P3W A;  1UFX A;  2R4H A;  3BPU A;  4PQW A;  5F67 A;  1ZOK A;  4RI0 A;  1VCW A;  1ZUB A;  2DLU A;  2Q9V A;  3PV2 A;  2QBW A;  2DAZ A;  1M5Z A;  1Q7X A;  1FCF A;  3DOR A;  2CSJ A;  1GM1 A;  2KQF A;  1UJU A;  2EJY A;  1MC7 A;  3ID2 A;  2YUY A;  3SFJ A;  2EEJ A;  4GHN A;  4WYT A;  2PKT A;  1I16 A;  1WI2 A;  2EDV A;  2JIN A;  1N7F A;  3I1E A;  4JOF A;  2OQS A;  1N7T A;  1UF1 A;  2IWO A;  2HE2 A;  2VRF A;  3DJA A;  2EEI A;  3EGG C;  1U3B A;  2DB5 A;  3SOE A;  3L4F D;  3QJN A;  4NNL A;  4GVC A;  4NMP A;  1WHD A;  4WYU A;  4Q6H A;  4P2A B;  2CS5 A;  5HFB A;  5FHT A;  3QE1 A;  5HFF A;  2PNT A;  1VB7 A;  3I4W A;  1X5Q A;  2YUB A;  1UM7 A;  3CBX A;  2L4T A;  4UU6 A;  2JOA A;  2M3M A;  1WF8 A;  1UJD A;  2QKT A;  2X7Z A;  2M10 A;  2G5M B;  3KHF A;  2OZF A;  4NXP A;  3QO6 A;  1Q3O A;  3PDV A;  2EEH A;  4G69 A;  3GDS A;  2G2L A;  3CBY A;  4JOG A;  2MX6 A;  2D8I A;  2OS6 A;  3NGH A;  2D92 A;  2PDZ A;  2QKU A;  2EAQ A;  1QAV A;  4OEP A;  5E11 A;  2KYL A;  4FGM A;  5B6L A;  2V90 A;  5HJ1 A;  2KV8 A;  2QKV A;  1TP5 A;  3R68 A;  1WF7 A;  3QDO A;  1K32 A;  4E35 A;  2F0A A;  2Z17 A;  5GLJ A;  3EGH C;  2ZPM A;  3PV4 A;  1TE0 A;  1D5G A;  5G1E A;  4NMS A;  2KJD A;  2LOB A;  5HFC A;  4NMO A;  2DKR A;  3NFL A;  4K76 A;  4Q2Q A;  1NTE A;  1RZX A;  1U38 A;  1TP3 A;  2FCF A;  3K50 A;  1I92 A;  2M0T A;  2QT5 A;  2H2C A;  1W9O A;  1QLC A;  3O46 A;  3VQG A;  1FC6 A;  2EGK A;  1V5Q A;  3HPK A;  1X45 A;  3OTP A;  1FC7 A;  1QAU A;  2I4S A;  3CYY A;  4OAJ A;  4F8K A;  3RL8 A;  1BFE A;  1P1E A;  3GJ9 A;  2FE5 A;  5HET A;  2ZPL A;  4KFV A;  5JXB A;  1WH1 A;  1W9Q A;  3I18 A;  1WHA A;  4K72 A; 
#chains in the Genus database with same CATH homology
 4Q2O A;  1WFG A;  4Q2P A;  5B42 A;  2I04 A;  2JSN A;  2I0I A;  4GVD A;  2W4F A;  3RL7 A;  4AMH A;  2KOM A;  1PDR A;  1X8S A;  5H3J A;  2PA1 A;  2K20 A;  1OBY A;  3ID3 A;  4NXR A;  1MFG A;  2L97 A;  1T2M A;  3JXT A;  2OCS A;  4YYX A;  3K1R A;  2GEF A;  4JJ0 A;  1V1T A;  1N7E A;  4N6X A;  2VSV A;  4JOE A;  4K6Y A;  2Q3G A;  4IC6 A;  2AWU A;  4JOP A;  1BE9 A;  1Y8T A;  5HF1 A;  2PZD A;  4E34 A;  4JJ3 A;  2EGN A;  1IHJ A;  2LC7 A;  3MH7 A;  1UEP A;  3OU0 A;  1WIF A;  1UJV A;  1WI4 A;  4Z33 A;  2KPL A;  2ENO A;  3GGE A;  2DC2 A;  2KL1 A;  3DIW A;  4NNM A;  4XHV A;  5A2P A;  4YDP A;  3MH6 A;  1VAE A;  1N6F A;  5EZ0 A;  3RLE A;  4O06 A;  2CSS A;  2H3L A;  1X5R A;  4HOP B;  1RGW A;  5HEB A;  1Z86 A;  1OBX A;  2PKU A;  2IWQ A;  2KOH A;  1SOZ A;  4NMV A;  2BYG A;  3LNY A;  3PDZ A;  1SOT A;  5E6P B;  3DJ3 A;  2KJP A;  3KZE A;  3O5N A;  2EXG A;  3QJM A;  3E17 A;  3SUZ A;  1MFL A;  4Q2N A;  1LCY A;  2REY A;  3GSL A;  4JOJ A;  1N99 A;  3QIK A;  1WFV A;  2YTW A;  2I1N A;  5E1Y A;  1UEZ A;  1V5L A;  3SHU A;  3AXA A;  2HGA A;  3VQF A;  3CC0 A;  5HED A;  5HFE A;  3TSV A;  2H2B A;  5EYZ A;  1WG6 A;  4NMR A;  1XZ9 A;  2HE4 A;  3HVQ C;  3R69 A;  3GDU A;  2LUI A;  3KDG A;  3PV5 A;  1U37 A;  1OZI A;  2KOJ A;  2M0U A;  3DJ1 A;  3NFK A;  5I7Z A;  3GCN A;  3ID1 A;  2V1W A;  3FY5 A;  4P0C A;  4LMM A;  1GQ4 A;  2KAW A;  1Z87 A;  2KA9 A;  2R3Y A;  4KFW A;  4NXQ A;  1UIT A;  1L6O A;  2OPG A;  2IWP A;  1OBZ A;  2JWE A;  4Z8J A;  3MH4 A;  1V6B A;  2AWW A;  2UZC A;  2DLS A;  1UM1 A;  3TSW A;  2I0L A;  1VJ6 A;  3WKL A;  2VWR A;  1Y7N A;  3GAB A;  4EDJ A;  4JL7 A;  4UU5 A;  1UEW A;  3K82 A;  2EDZ A;  4JOH A;  5HEY A;  4H11 A;  2K1Z A;  2AIN A;  2EEG A;  2GZV A;  3QGL A;  5D13 A;  3GCO A;  5F3X A;  2JXO A;  4NMQ A;  1NF3 C;  2JIK A;  1RGR A;  1V62 A;  1X9Z A;  2WL7 A;  4L8N A;  3TMH A;  1UHP A;  1KY9 A;  1U39 A;  1GQ5 A;  3KDK A;  2YT7 A;  4E3B A;  2H3M A;  2YT8 A;  1VA8 A;  2VZ5 A;  1IU2 A;  5HFD A;  5ILB A;  5E22 A;  3PS4 A;  2KBS A;  3CS0 A;  2F5Y A;  3STJ A;  2FNE A;  1QAV B;  2OSG A;  2OGP A;  2RCZ A;  2LA8 A;  2JIL A;  2MHO A;  2KRG A;  2FN5 A;  2KPK A;  5G1D A;  1TQ3 A;  2LC6 A;  4JOR A;  1UEQ A;  1X6D A;  2VPH A;  3B76 A;  2EDP A;  4HOP A;  2KJK A;  4NMT A;  2D90 A;  2QG1 A;  3SHW A;  3ID4 A;  1X5N A;  2DJT A;  3CH8 A;  5IL9 A;  5GND A;  4MPA A;  4Q6S A;  1R6J A;  2L4S A;  4Q3H A;  5DTH A;  4OEO A;  2RRM A;  5HF4 A;  3WKM A;  5FB8 C;  3ZRT A;  1KEF A;  1IU0 A;  2EHR A;  4JOK A;  3CBZ A;  2Z9I A;  3NCV A;  1Q3P A;  3GDV A;  3TSZ A;  1B8Q A;  2IWN A;  4K75 A;  2DMZ A;  1W9E A;  2I6V A;  1P1D A;  2O2T A;  2KG2 A;  1RY4 A;  3R0H A;  4FLN A;  3HPM A;  4REY A;  1G9O A;  2JRE A;  2AWX A;  2DM8 A;  2W7R A;  2M0Z A;  5HDY A;  1YBO A;  2M0V A;  2OMJ A;  2E7K A;  2VSP A;  4R2Z A;  4K78 A;  2EGO A;  3KZD A;  5E21 A;  1WJL A;  2EV8 A;  1N6D A;  1FC9 A;  1N6E A;  1KWA A;  3LNX A;  2P3W A;  1UFX A;  2R4H A;  3BPU A;  4PQW A;  5F67 A;  1ZOK A;  4RI0 A;  1VCW A;  1ZUB A;  2DLU A;  2Q9V A;  3PV2 A;  2QBW A;  2DAZ A;  1M5Z A;  1Q7X A;  1FCF A;  3DOR A;  2CSJ A;  1GM1 A;  2KQF A;  1UJU A;  2EJY A;  1MC7 A;  3ID2 A;  2YUY A;  3SFJ A;  2EEJ A;  4GHN A;  4WYT A;  2PKT A;  1I16 A;  1WI2 A;  2EDV A;  2JIN A;  1N7F A;  3I1E A;  4JOF A;  2OQS A;  1N7T A;  1UF1 A;  2IWO A;  2HE2 A;  2VRF A;  3DJA A;  2EEI A;  3EGG C;  1U3B A;  2DB5 A;  3SOE A;  3L4F D;  3QJN A;  4NNL A;  4GVC A;  4NMP A;  1WHD A;  4WYU A;  4Q6H A;  4P2A B;  2CS5 A;  5HFB A;  5FHT A;  3QE1 A;  5HFF A;  2PNT A;  1VB7 A;  3I4W A;  1X5Q A;  2YUB A;  1UM7 A;  3CBX A;  2L4T A;  4UU6 A;  2JOA A;  2M3M A;  1WF8 A;  1UJD A;  2QKT A;  2X7Z A;  2M10 A;  2G5M B;  3KHF A;  2OZF A;  4NXP A;  3QO6 A;  1Q3O A;  3PDV A;  2EEH A;  4G69 A;  3GDS A;  2G2L A;  3CBY A;  4JOG A;  2MX6 A;  2D8I A;  2OS6 A;  3NGH A;  2D92 A;  2PDZ A;  2QKU A;  2EAQ A;  1QAV A;  4OEP A;  5E11 A;  2KYL A;  4FGM A;  5B6L A;  2V90 A;  5HJ1 A;  2KV8 A;  2QKV A;  1TP5 A;  3R68 A;  1WF7 A;  3QDO A;  1K32 A;  4E35 A;  2F0A A;  2Z17 A;  5GLJ A;  3EGH C;  2ZPM A;  3PV4 A;  1TE0 A;  1D5G A;  5G1E A;  4NMS A;  2KJD A;  2LOB A;  5HFC A;  4NMO A;  2DKR A;  3NFL A;  4K76 A;  4Q2Q A;  1NTE A;  1RZX A;  1U38 A;  1TP3 A;  2FCF A;  3K50 A;  1I92 A;  2M0T A;  2QT5 A;  2H2C A;  1W9O A;  1QLC A;  3O46 A;  3VQG A;  1FC6 A;  2EGK A;  1V5Q A;  3HPK A;  1X45 A;  3OTP A;  1FC7 A;  1QAU A;  2I4S A;  3CYY A;  4OAJ A;  4F8K A;  3RL8 A;  1BFE A;  1P1E A;  3GJ9 A;  2FE5 A;  5HET A;  2ZPL A;  4KFV A;  5JXB A;  1WH1 A;  1W9Q A;  3I18 A;  1WHA A;  4K72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...