3QJMA

Structural flexibility of shank pdz domain is important for its binding to different ligands
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
103
structure length
98
Chain Sequence
b'DYIIKEKTVLLQKKDSEGFGFVLRGAIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 and multiple ankyrin repeat domains protein 1
publication title The structural flexibility of the shank1 PDZ domain is important for its binding to different ligands
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 16
structure length 98
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3qjmA00
2QKUA 1N6DA 1RZXA 1VB7A 2H2BA 1XZ9A 2V1WA 1OBYA 1N99A 1Z87A 2LUIA 2JWEA 2OPGA 2KV8A 2O2TA 1RY4A 4E35A 1V1TA 3TSVA 3GDSA 2JOAA 3QO6A 3GJ9A 3WKLA 4O06A 2P3WA 2EEJA 2FE5A 2KG2A 2IWQA 2KOJA 2QT5A 3KZDA 3K82A 2UZCA 3K50A 2VPHA 2YT8A 2OQSA 3FY5A 4MPAA 4K72A 3GCOA 4Z33A 2DLSA 2LC7A 2F5YA 2DB5A 2L97A 3QJNA 4Q2OA 1WF7A 2H3MA 2WL7A 1D5GA 4P0CA 4OEOA 2LA8A 1WH1A 2VSVA 2KJKA 2I1NA 2JILA 4K78A 3NFKA 5HF1A 3QGLA 4GVDA 4JL7A 2IWOA 1TQ3A 2IWPA 4HOPA 3R68A 2KQFA 4NMTA 1QAVA 2EJYA 2AWWA 4XHVA 1P1EA 2AWXA 1WF8A 3EGGC 3K1RA 2PKUA 1SOTA 3VQGA 2I6VA 2VRFA 2KAWA 4K76A 4OAJA 2JIKA 3RL7A 4PQWA 5DTHA 2EDVA 4UU6A 1Z86A 2JXOA 1IU2A 3ID4A 2ZPLA 2F0AA 4H11A 3SHWA 1NF3C 3PDVA 1I16A 5E11A 3NGHA 3L4FD 4Q6HA 2I0LA 1WHDA 1UEWA 2KBSA 3DJ1A 4LMMA 2FCFA 2M0TA 3WKMA 2R4HA 1Q7XA 1X5NA 3ID3A 3PV2A 2M3MA 3TSWA 2EEIA 1WI2A 2EV8A 4YDPA 5I7ZA 2DMZA 1OBXA 1V5QA 5GLJA 2QG1A 3QE1A 4JOGA 2G5MB 2I04A 2M0ZA 3AXAA 1B8QA 4L8NA 2KJDA 5D13A 4Z8JA 3ID2A 1GM1A 1TP5A 2EAQA 3RL8A 1WG6A 5F3XA 2EDZA 3O46A 2MX6A 2Q9VA 1Q3PA 3GDUA 5E6PB 5HETA 2QKVA 4UU5A 3SOEA 4WYUA 2ZPMA 5F67A 3NFLA 1U39A 3O5NA 1PDRA 3GGEA 3LNYA 3HPKA 2IWNA 2KPLA 1UEZA 5HEBA 1MFLA 2D8IA 2K1ZA 4NMPA 1UEPA 1UFXA 4K75A 5G1DA 2PDZA 5E1YA 1IU0A 3KZEA 3MH6A 5HFEA 1BFEA 5HFBA 2KOMA 2H3LA 1W9EA 3CBXA 2KOHA 4HOPB 3R0HA 1QAVB 5G1EA 1GQ4A 5HEDA 1G9OA 3ZRTA 2PA1A 1U3BA 1ZOKA 4NMRA 1T2MA 2QKTA 3HPMA 2EHRA 2YTWA 1WI4A 4IC6A 3QIKA 2EEHA 1Q3OA 4F8KA 4OEPA 1M5ZA 2LOBA 1WFVA 2M0UA 2X7ZA 4JOFA 4JOHA 1UJVA 5HDYA 1RGRA 2BYGA 3HVQC 4P2AB 4Q2PA 2CSJA 1FCFA 2FN5A 3JXTA 1TP3A 2EGOA 4G69A 2VSPA 3DJAA 2CS5A 2DM8A 1OBZA 3GDVA 1X5QA 4Q6SA 3OU0A 1QAUA 3E17A 3CBZA 2E7KA 2L4SA 2OSGA 1UM1A 2EGNA 3STJA 4E34A 2LC6A 4NNLA 5EZ0A 2CSSA 5HFFA 4EDJA 4Q2NA 1W9QA 2REYA 2I4SA 1FC9A 3ID1A 4R2ZA 1KWAA 5HFDA 4YYXA 1N7TA 1NTEA 3KHFA 3LNXA 5FB8C 2L4TA 4E3BA 2Q3GA 3I4WA 4WYTA 2EEGA 1SOZA 2KL1A 2JREA 1X6DA 1VCWA 4JOPA 2DKRA 2EXGA 2RCZA 1X45A 3TMHA 4GVCA 1MC7A 2HE2A 1R6JA 2V90A 4JOKA 1WJLA 1UEQA 2OMJA 2AINA 3CC0A 4KFVA 2G2LA 3SFJA 1FC7A 1BE9A 4NMSA 4AMHA 2OCSA 3I1EA 4NMOA 1K32A 3B76A 2M10A 2FNEA 2HGAA 1X8SA 2JINA 2Z9IA 3BPUA 4KFWA 1UJDA 4N6XA 5HJ1A 1N6EA 2KRGA 5FHTA 1VA8A 1P1DA 5B6LA 2M0VA 2RRMA 1L6OA 4RI0A 5A2PA 1UF1A 2VWRA 1IHJA 1UHPA 1LCYA 1W9OA 1OZIA 5E21A 1RGWA 1GQ5A 4FGMA 4JOEA 4REYA 3MH4A 3CH8A 2PNTA 1KY9A 3DORA 2DJTA 3QJMA 1WFGA 1I92A 3MH7A 3CBYA 5EYZA 4Q2QA 5HF4A 2HE4A 3GSLA 5HFCA 2Z17A 1TE0A 3PS4A 1N6FA 2D90A 1V5LA 2PKTA 4GHNA 3PV5A 2MHOA 2DC2A 5E22A 2W7RA 1U37A 1Y7NA 2OGPA 3TSZA 1N7EA 1VAEA 1ZUBA 3SUZA 1VJ6A 2EDPA 3RLEA 3DIWA 4NNMA 2D92A 1U38A 2GZVA 2YUBA 1X5RA 4NMVA 2DLUA 2DAZA 3QDOA 2QBWA 3DJ3A 3EGHC 1KEFA 2KA9A 3GCNA 4JOJA 4NXQA 3CS0A 4NMQA 3OTPA 1YBOA 2H2CA 2VZ5A 4Q3HA 3PV4A 1WHAA 2YT7A 3SHUA 3R69A 1UM7A 1V6BA 2KJPA 2I0IA 2R3YA 1V62A 1QLCA 2AWUA 2W4FA 1FC6A 4K6YA 2YUYA 2ENOA 2OS6A 4NXPA 2K20A 1UJUA 1N7FA 1MFGA 3VQFA 2KPKA 5H3JA 2OZFA 4JORA 5GNDA 3CYYA 3PDZA 5HEYA 5JXBA 1Y8TA 1UITA 2EGKA 1WIFA 2KYLA 2PZDA 4NXRA 3I18A
chains in the Genus database with same CATH superfamily
2QKUA 1N6DA 1RZXA 1VB7A 2H2BA 1XZ9A 2V1WA 1OBYA 4JJ0A 1N99A 1Z87A 2LUIA 2JWEA 2OPGA 2KV8A 2O2TA 1RY4A 4E35A 1V1TA 3TSVA 3GDSA 2JOAA 3QO6A 3GJ9A 3WKLA 4O06A 2P3WA 2EEJA 2FE5A 2KG2A 2IWQA 2KOJA 2QT5A 3KZDA 3K82A 2UZCA 3K50A 2VPHA 2YT8A 2OQSA 3FY5A 4MPAA 4K72A 3GCOA 4Z33A 2DLSA 2LC7A 2F5YA 2DB5A 2L97A 3QJNA 4Q2OA 1WF7A 2H3MA 2WL7A 1D5GA 4P0CA 4OEOA 2LA8A 1WH1A 2VSVA 2KJKA 2I1NA 2JILA 4K78A 3NFKA 5HF1A 3QGLA 4GVDA 4JL7A 2IWOA 1TQ3A 2IWPA 4HOPA 3R68A 2KQFA 4NMTA 2GEFA 1QAVA 2EJYA 2AWWA 4XHVA 1P1EA 2AWXA 1WF8A 3EGGC 3K1RA 2PKUA 5B42A 1SOTA 3VQGA 2I6VA 2VRFA 2KAWA 4K76A 4OAJA 2JIKA 3RL7A 4PQWA 5DTHA 2EDVA 4UU6A 1Z86A 2JXOA 1IU2A 3ID4A 2ZPLA 2F0AA 4H11A 3SHWA 1NF3C 3PDVA 1I16A 5E11A 3NGHA 3L4FD 4Q6HA 2I0LA 1WHDA 1UEWA 2KBSA 3DJ1A 4LMMA 2FCFA 2M0TA 3WKMA 2R4HA 1Q7XA 1X5NA 3ID3A 3PV2A 2M3MA 3TSWA 2EEIA 1WI2A 2EV8A 4YDPA 5I7ZA 2DMZA 1OBXA 1V5QA 5GLJA 2QG1A 3QE1A 4JOGA 2G5MB 2I04A 2M0ZA 3AXAA 1B8QA 4L8NA 2KJDA 5D13A 4Z8JA 3ID2A 1GM1A 1TP5A 2EAQA 3RL8A 1WG6A 5F3XA 2EDZA 3O46A 2MX6A 2Q9VA 1Q3PA 3GDUA 5E6PB 5HETA 2QKVA 4UU5A 3KDGA 3SOEA 4WYUA 2ZPMA 5F67A 3NFLA 1U39A 3O5NA 1PDRA 3GGEA 3LNYA 3HPKA 2IWNA 2KPLA 1UEZA 5HEBA 1MFLA 2D8IA 2K1ZA 4NMPA 1UEPA 1UFXA 4JJ3A 4K75A 5G1DA 2PDZA 5E1YA 1IU0A 3KZEA 3MH6A 5HFEA 1BFEA 5HFBA 2KOMA 2H3LA 1W9EA 3CBXA 2KOHA 4HOPB 3R0HA 1QAVB 5G1EA 1GQ4A 5HEDA 1G9OA 3ZRTA 2PA1A 1U3BA 1ZOKA 4NMRA 1T2MA 2QKTA 3HPMA 2EHRA 2YTWA 1WI4A 4IC6A 3QIKA 2EEHA 1Q3OA 4F8KA 4OEPA 1M5ZA 2LOBA 1WFVA 2M0UA 2X7ZA 4JOFA 4JOHA 1UJVA 5HDYA 1RGRA 2BYGA 3HVQC 4P2AB 4Q2PA 2CSJA 1FCFA 2FN5A 3JXTA 1TP3A 2EGOA 4G69A 2VSPA 3DJAA 2CS5A 4FLNA 2DM8A 1OBZA 3GDVA 1X5QA 4Q6SA 3OU0A 1QAUA 3E17A 3CBZA 2E7KA 2L4SA 2OSGA 5ILBA 1UM1A 2EGNA 3STJA 4E34A 2LC6A 4NNLA 5EZ0A 2CSSA 5HFFA 4EDJA 4Q2NA 1W9QA 2REYA 2I4SA 1FC9A 3ID1A 4R2ZA 1KWAA 5HFDA 4YYXA 1N7TA 1NTEA 3KHFA 3LNXA 5FB8C 2L4TA 4E3BA 2Q3GA 3I4WA 4WYTA 2EEGA 1SOZA 2KL1A 2JREA 1X6DA 1VCWA 4JOPA 2DKRA 2EXGA 2RCZA 1X45A 3TMHA 4GVCA 1MC7A 2HE2A 1R6JA 2V90A 4JOKA 1WJLA 1UEQA 2OMJA 2AINA 3CC0A 4KFVA 5IL9A 1X9ZA 2G2LA 3SFJA 1FC7A 1BE9A 4NMSA 4AMHA 2OCSA 3I1EA 4NMOA 1K32A 3B76A 2M10A 2FNEA 2HGAA 1X8SA 2JINA 2Z9IA 3BPUA 4KFWA 1UJDA 4N6XA 5HJ1A 1N6EA 2KRGA 5FHTA 1VA8A 1P1DA 5B6LA 2M0VA 2RRMA 1L6OA 4RI0A 5A2PA 1UF1A 2VWRA 1IHJA 1UHPA 1LCYA 1W9OA 1OZIA 3NCVA 5E21A 1RGWA 1GQ5A 4FGMA 4JOEA 4REYA 3MH4A 3CH8A 2PNTA 1KY9A 3DORA 2DJTA 3QJMA 1WFGA 1I92A 3MH7A 3CBYA 5EYZA 4Q2QA 5HF4A 2HE4A 3GSLA 5HFCA 2Z17A 1TE0A 3PS4A 1N6FA 2D90A 2JSNA 1V5LA 2PKTA 4GHNA 3PV5A 2MHOA 2DC2A 5E22A 2W7RA 1U37A 1Y7NA 2OGPA 3TSZA 1N7EA 1VAEA 1ZUBA 3SUZA 1VJ6A 2EDPA 3RLEA 3DIWA 4NNMA 2D92A 1U38A 2GZVA 2YUBA 1X5RA 4NMVA 2DLUA 2DAZA 3QDOA 2QBWA 3DJ3A 3EGHC 1KEFA 2KA9A 3GCNA 4JOJA 4NXQA 3CS0A 4NMQA 3OTPA 1YBOA 2H2CA 3KDKA 2VZ5A 4Q3HA 3PV4A 1WHAA 2YT7A 3GABA 3SHUA 3R69A 1UM7A 1V6BA 2KJPA 2I0IA 2R3YA 1V62A 1QLCA 2AWUA 2W4FA 1FC6A 4K6YA 2YUYA 2ENOA 2OS6A 4NXPA 2K20A 1UJUA 1N7FA 1MFGA 3VQFA 2KPKA 5H3JA 2OZFA 4JORA 5GNDA 3CYYA 3PDZA 5HEYA 5JXBA 1Y8TA 1UITA 2EGKA 1WIFA 2KYLA 2PZDA 4NXRA 3I18A
chains in the Genus database with same CATH topology
2QKUA 1N6DA 1RZXA 1VB7A 2H2BA 1XZ9A 2V1WA 1OBYA 4JJ0A 1N99A 1Z87A 2LUIA 2JWEA 2OPGA 2KV8A 2O2TA 1RY4A 4E35A 1V1TA 3TSVA 3GDSA 2JOAA 3QO6A 3GJ9A 3WKLA 4O06A 2P3WA 2EEJA 2FE5A 2KG2A 2IWQA 2KOJA 2QT5A 3KZDA 3K82A 2UZCA 3K50A 2VPHA 2YT8A 2OQSA 3FY5A 4MPAA 4K72A 3GCOA 4Z33A 2DLSA 2LC7A 2F5YA 2DB5A 2L97A 3QJNA 4Q2OA 1WF7A 2H3MA 2WL7A 1D5GA 4P0CA 4OEOA 2LA8A 1WH1A 2VSVA 2KJKA 2I1NA 2JILA 4K78A 3NFKA 5HF1A 3QGLA 4GVDA 4JL7A 2IWOA 1TQ3A 2IWPA 4HOPA 3R68A 2KQFA 4NMTA 2GEFA 1QAVA 2EJYA 2AWWA 4XHVA 1P1EA 2AWXA 1WF8A 3EGGC 3K1RA 2PKUA 5B42A 1SOTA 3VQGA 2I6VA 2VRFA 2KAWA 4K76A 4OAJA 2JIKA 3RL7A 4PQWA 5DTHA 2EDVA 4UU6A 1Z86A 2JXOA 1IU2A 3ID4A 2ZPLA 2F0AA 4H11A 3SHWA 1NF3C 3PDVA 1I16A 5E11A 3NGHA 3L4FD 4Q6HA 2I0LA 1WHDA 1UEWA 2KBSA 3DJ1A 4LMMA 2FCFA 2M0TA 3WKMA 2R4HA 1Q7XA 1X5NA 3ID3A 3PV2A 2M3MA 3TSWA 2EEIA 1WI2A 2EV8A 4YDPA 5I7ZA 2DMZA 1OBXA 1V5QA 5GLJA 2QG1A 3QE1A 4JOGA 2G5MB 2I04A 2M0ZA 3AXAA 1B8QA 4L8NA 2KJDA 5D13A 4Z8JA 3ID2A 1GM1A 1TP5A 2EAQA 3RL8A 1WG6A 5F3XA 2EDZA 3O46A 2MX6A 2Q9VA 1Q3PA 3GDUA 5E6PB 5HETA 2QKVA 4UU5A 3KDGA 3SOEA 4WYUA 2ZPMA 5F67A 3NFLA 1U39A 3O5NA 1PDRA 3GGEA 3LNYA 3HPKA 2IWNA 2KPLA 1UEZA 5HEBA 1MFLA 2D8IA 2K1ZA 4NMPA 1UEPA 1UFXA 4JJ3A 4K75A 5G1DA 2PDZA 5E1YA 1IU0A 3KZEA 3MH6A 5HFEA 1BFEA 5HFBA 2KOMA 2H3LA 1W9EA 3CBXA 2KOHA 4HOPB 3R0HA 1QAVB 5G1EA 1GQ4A 5HEDA 1G9OA 3ZRTA 2PA1A 1U3BA 1ZOKA 4NMRA 1T2MA 2QKTA 3HPMA 2EHRA 2YTWA 1WI4A 4IC6A 3QIKA 2EEHA 1Q3OA 4F8KA 4OEPA 1M5ZA 2LOBA 1WFVA 2M0UA 2X7ZA 4JOFA 4JOHA 1UJVA 5HDYA 1RGRA 2BYGA 3HVQC 4P2AB 4Q2PA 2CSJA 1FCFA 2FN5A 3JXTA 1TP3A 2EGOA 4G69A 2VSPA 3DJAA 2CS5A 4FLNA 2DM8A 1OBZA 3GDVA 1X5QA 4Q6SA 3OU0A 1QAUA 3E17A 3CBZA 2E7KA 2L4SA 2OSGA 5ILBA 1UM1A 2EGNA 3STJA 4E34A 2LC6A 4NNLA 5EZ0A 2CSSA 5HFFA 4EDJA 4Q2NA 1W9QA 2REYA 2I4SA 1FC9A 3ID1A 4R2ZA 1KWAA 5HFDA 4YYXA 1N7TA 1NTEA 3KHFA 3LNXA 5FB8C 2L4TA 4E3BA 2Q3GA 3I4WA 4WYTA 2EEGA 1SOZA 2KL1A 2JREA 1X6DA 1VCWA 4JOPA 2DKRA 2EXGA 2RCZA 1X45A 3TMHA 4GVCA 1MC7A 2HE2A 1R6JA 2V90A 4JOKA 1WJLA 1UEQA 2OMJA 2AINA 3CC0A 4KFVA 5IL9A 1X9ZA 2G2LA 3SFJA 1FC7A 1BE9A 4NMSA 4AMHA 2OCSA 3I1EA 4NMOA 1K32A 3B76A 2M10A 2FNEA 2HGAA 1X8SA 2JINA 2Z9IA 3BPUA 4KFWA 1UJDA 4N6XA 5HJ1A 1N6EA 2KRGA 5FHTA 1VA8A 1P1DA 5B6LA 2M0VA 2RRMA 1L6OA 4RI0A 5A2PA 1UF1A 2VWRA 1IHJA 1UHPA 1LCYA 1W9OA 1OZIA 3NCVA 5E21A 1RGWA 1GQ5A 4FGMA 4JOEA 4REYA 3MH4A 3CH8A 2PNTA 1KY9A 3DORA 2DJTA 3QJMA 1WFGA 1I92A 3MH7A 3CBYA 5EYZA 4Q2QA 5HF4A 2HE4A 3GSLA 5HFCA 2Z17A 1TE0A 3PS4A 1N6FA 2D90A 2JSNA 1V5LA 2PKTA 4GHNA 3PV5A 2MHOA 2DC2A 5E22A 2W7RA 1U37A 1Y7NA 2OGPA 3TSZA 1N7EA 1VAEA 1ZUBA 3SUZA 1VJ6A 2EDPA 3RLEA 3DIWA 4NNMA 2D92A 1U38A 2GZVA 2YUBA 1X5RA 4NMVA 2DLUA 2DAZA 3QDOA 2QBWA 3DJ3A 3EGHC 1KEFA 2KA9A 3GCNA 4JOJA 4NXQA 3CS0A 4NMQA 3OTPA 1YBOA 2H2CA 3KDKA 2VZ5A 4Q3HA 3PV4A 1WHAA 2YT7A 3GABA 3SHUA 3R69A 1UM7A 1V6BA 2KJPA 2I0IA 2R3YA 1V62A 1QLCA 2AWUA 2W4FA 1FC6A 4K6YA 2YUYA 2ENOA 2OS6A 4NXPA 2K20A 1UJUA 1N7FA 1MFGA 3VQFA 2KPKA 5H3JA 2OZFA 4JORA 5GNDA 3CYYA 3PDZA 5HEYA 5JXBA 1Y8TA 1UITA 2EGKA 1WIFA 2KYLA 2PZDA 4NXRA 3I18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKU A;  1N6D A;  1RZX A;  1VB7 A;  2H2B A;  1XZ9 A;  2V1W A;  1OBY A;  1N99 A;  1Z87 A;  2LUI A;  2JWE A;  2OPG A;  2KV8 A;  2O2T A;  1RY4 A;  4E35 A;  1V1T A;  3TSV A;  3GDS A;  2JOA A;  3QO6 A;  3GJ9 A;  3WKL A;  4O06 A;  2P3W A;  2EEJ A;  2FE5 A;  2KG2 A;  2IWQ A;  2KOJ A;  2QT5 A;  3KZD A;  3K82 A;  2UZC A;  3K50 A;  2VPH A;  2YT8 A;  2OQS A;  3FY5 A;  4MPA A;  4K72 A;  3GCO A;  4Z33 A;  2DLS A;  2LC7 A;  2F5Y A;  2DB5 A;  2L97 A;  3QJN A;  4Q2O A;  1WF7 A;  2H3M A;  2WL7 A;  1D5G A;  4P0C A;  4OEO A;  2LA8 A;  1WH1 A;  2VSV A;  2KJK A;  2I1N A;  2JIL A;  4K78 A;  3NFK A;  5HF1 A;  3QGL A;  4GVD A;  4JL7 A;  2IWO A;  1TQ3 A;  2IWP A;  4HOP A;  3R68 A;  2KQF A;  4NMT A;  1QAV A;  2EJY A;  2AWW A;  4XHV A;  1P1E A;  2AWX A;  1WF8 A;  3EGG C;  3K1R A;  2PKU A;  1SOT A;  3VQG A;  2I6V A;  2VRF A;  2KAW A;  4K76 A;  4OAJ A;  2JIK A;  3RL7 A;  4PQW A;  5DTH A;  2EDV A;  4UU6 A;  1Z86 A;  2JXO A;  1IU2 A;  3ID4 A;  2ZPL A;  2F0A A;  4H11 A;  3SHW A;  1NF3 C;  3PDV A;  1I16 A;  5E11 A;  3NGH A;  3L4F D;  4Q6H A;  2I0L A;  1WHD A;  1UEW A;  2KBS A;  3DJ1 A;  4LMM A;  2FCF A;  2M0T A;  3WKM A;  2R4H A;  1Q7X A;  1X5N A;  3ID3 A;  3PV2 A;  2M3M A;  3TSW A;  2EEI A;  1WI2 A;  2EV8 A;  4YDP A;  5I7Z A;  2DMZ A;  1OBX A;  1V5Q A;  5GLJ A;  2QG1 A;  3QE1 A;  4JOG A;  2G5M B;  2I04 A;  2M0Z A;  3AXA A;  1B8Q A;  4L8N A;  2KJD A;  5D13 A;  4Z8J A;  3ID2 A;  1GM1 A;  1TP5 A;  2EAQ A;  3RL8 A;  1WG6 A;  5F3X A;  2EDZ A;  3O46 A;  2MX6 A;  2Q9V A;  1Q3P A;  3GDU A;  5E6P B;  5HET A;  2QKV A;  4UU5 A;  3SOE A;  4WYU A;  2ZPM A;  5F67 A;  3NFL A;  1U39 A;  3O5N A;  1PDR A;  3GGE A;  3LNY A;  3HPK A;  2IWN A;  2KPL A;  1UEZ A;  5HEB A;  1MFL A;  2D8I A;  2K1Z A;  4NMP A;  1UEP A;  1UFX A;  4K75 A;  5G1D A;  2PDZ A;  5E1Y A;  1IU0 A;  3KZE A;  3MH6 A;  5HFE A;  1BFE A;  5HFB A;  2KOM A;  2H3L A;  1W9E A;  3CBX A;  2KOH A;  4HOP B;  3R0H A;  1QAV B;  5G1E A;  1GQ4 A;  5HED A;  1G9O A;  3ZRT A;  2PA1 A;  1U3B A;  1ZOK A;  4NMR A;  1T2M A;  2QKT A;  3HPM A;  2EHR A;  2YTW A;  1WI4 A;  4IC6 A;  3QIK A;  2EEH A;  1Q3O A;  4F8K A;  4OEP A;  1M5Z A;  2LOB A;  1WFV A;  2M0U A;  2X7Z A;  4JOF A;  4JOH A;  1UJV A;  5HDY A;  1RGR A;  2BYG A;  3HVQ C;  4P2A B;  4Q2P A;  2CSJ A;  1FCF A;  2FN5 A;  3JXT A;  1TP3 A;  2EGO A;  4G69 A;  2VSP A;  3DJA A;  2CS5 A;  2DM8 A;  1OBZ A;  3GDV A;  1X5Q A;  4Q6S A;  3OU0 A;  1QAU A;  3E17 A;  3CBZ A;  2E7K A;  2L4S A;  2OSG A;  1UM1 A;  2EGN A;  3STJ A;  4E34 A;  2LC6 A;  4NNL A;  5EZ0 A;  2CSS A;  5HFF A;  4EDJ A;  4Q2N A;  1W9Q A;  2REY A;  2I4S A;  1FC9 A;  3ID1 A;  4R2Z A;  1KWA A;  5HFD A;  4YYX A;  1N7T A;  1NTE A;  3KHF A;  3LNX A;  5FB8 C;  2L4T A;  4E3B A;  2Q3G A;  3I4W A;  4WYT A;  2EEG A;  1SOZ A;  2KL1 A;  2JRE A;  1X6D A;  1VCW A;  4JOP A;  2DKR A;  2EXG A;  2RCZ A;  1X45 A;  3TMH A;  4GVC A;  1MC7 A;  2HE2 A;  1R6J A;  2V90 A;  4JOK A;  1WJL A;  1UEQ A;  2OMJ A;  2AIN A;  3CC0 A;  4KFV A;  2G2L A;  3SFJ A;  1FC7 A;  1BE9 A;  4NMS A;  4AMH A;  2OCS A;  3I1E A;  4NMO A;  1K32 A;  3B76 A;  2M10 A;  2FNE A;  2HGA A;  1X8S A;  2JIN A;  2Z9I A;  3BPU A;  4KFW A;  1UJD A;  4N6X A;  5HJ1 A;  1N6E A;  2KRG A;  5FHT A;  1VA8 A;  1P1D A;  5B6L A;  2M0V A;  2RRM A;  1L6O A;  4RI0 A;  5A2P A;  1UF1 A;  2VWR A;  1IHJ A;  1UHP A;  1LCY A;  1W9O A;  1OZI A;  5E21 A;  1RGW A;  1GQ5 A;  4FGM A;  4JOE A;  4REY A;  3MH4 A;  3CH8 A;  2PNT A;  1KY9 A;  3DOR A;  2DJT A;  3QJM A;  1WFG A;  1I92 A;  3MH7 A;  3CBY A;  5EYZ A;  4Q2Q A;  5HF4 A;  2HE4 A;  3GSL A;  5HFC A;  2Z17 A;  1TE0 A;  3PS4 A;  1N6F A;  2D90 A;  1V5L A;  2PKT A;  4GHN A;  3PV5 A;  2MHO A;  2DC2 A;  5E22 A;  2W7R A;  1U37 A;  1Y7N A;  2OGP A;  3TSZ A;  1N7E A;  1VAE A;  1ZUB A;  3SUZ A;  1VJ6 A;  2EDP A;  3RLE A;  3DIW A;  4NNM A;  2D92 A;  1U38 A;  2GZV A;  2YUB A;  1X5R A;  4NMV A;  2DLU A;  2DAZ A;  3QDO A;  2QBW A;  3DJ3 A;  3EGH C;  1KEF A;  2KA9 A;  3GCN A;  4JOJ A;  4NXQ A;  3CS0 A;  4NMQ A;  3OTP A;  1YBO A;  2H2C A;  2VZ5 A;  4Q3H A;  3PV4 A;  1WHA A;  2YT7 A;  3SHU A;  3R69 A;  1UM7 A;  1V6B A;  2KJP A;  2I0I A;  2R3Y A;  1V62 A;  1QLC A;  2AWU A;  2W4F A;  1FC6 A;  4K6Y A;  2YUY A;  2ENO A;  2OS6 A;  4NXP A;  2K20 A;  1UJU A;  1N7F A;  1MFG A;  3VQF A;  2KPK A;  5H3J A;  2OZF A;  4JOR A;  5GND A;  3CYY A;  3PDZ A;  5HEY A;  5JXB A;  1Y8T A;  1UIT A;  2EGK A;  1WIF A;  2KYL A;  2PZD A;  4NXR A;  3I18 A; 
#chains in the Genus database with same CATH topology
 2QKU A;  1N6D A;  1RZX A;  1VB7 A;  2H2B A;  1XZ9 A;  2V1W A;  1OBY A;  4JJ0 A;  1N99 A;  1Z87 A;  2LUI A;  2JWE A;  2OPG A;  2KV8 A;  2O2T A;  1RY4 A;  4E35 A;  1V1T A;  3TSV A;  3GDS A;  2JOA A;  3QO6 A;  3GJ9 A;  3WKL A;  4O06 A;  2P3W A;  2EEJ A;  2FE5 A;  2KG2 A;  2IWQ A;  2KOJ A;  2QT5 A;  3KZD A;  3K82 A;  2UZC A;  3K50 A;  2VPH A;  2YT8 A;  2OQS A;  3FY5 A;  4MPA A;  4K72 A;  3GCO A;  4Z33 A;  2DLS A;  2LC7 A;  2F5Y A;  2DB5 A;  2L97 A;  3QJN A;  4Q2O A;  1WF7 A;  2H3M A;  2WL7 A;  1D5G A;  4P0C A;  4OEO A;  2LA8 A;  1WH1 A;  2VSV A;  2KJK A;  2I1N A;  2JIL A;  4K78 A;  3NFK A;  5HF1 A;  3QGL A;  4GVD A;  4JL7 A;  2IWO A;  1TQ3 A;  2IWP A;  4HOP A;  3R68 A;  2KQF A;  4NMT A;  2GEF A;  1QAV A;  2EJY A;  2AWW A;  4XHV A;  1P1E A;  2AWX A;  1WF8 A;  3EGG C;  3K1R A;  2PKU A;  5B42 A;  1SOT A;  3VQG A;  2I6V A;  2VRF A;  2KAW A;  4K76 A;  4OAJ A;  2JIK A;  3RL7 A;  4PQW A;  5DTH A;  2EDV A;  4UU6 A;  1Z86 A;  2JXO A;  1IU2 A;  3ID4 A;  2ZPL A;  2F0A A;  4H11 A;  3SHW A;  1NF3 C;  3PDV A;  1I16 A;  5E11 A;  3NGH A;  3L4F D;  4Q6H A;  2I0L A;  1WHD A;  1UEW A;  2KBS A;  3DJ1 A;  4LMM A;  2FCF A;  2M0T A;  3WKM A;  2R4H A;  1Q7X A;  1X5N A;  3ID3 A;  3PV2 A;  2M3M A;  3TSW A;  2EEI A;  1WI2 A;  2EV8 A;  4YDP A;  5I7Z A;  2DMZ A;  1OBX A;  1V5Q A;  5GLJ A;  2QG1 A;  3QE1 A;  4JOG A;  2G5M B;  2I04 A;  2M0Z A;  3AXA A;  1B8Q A;  4L8N A;  2KJD A;  5D13 A;  4Z8J A;  3ID2 A;  1GM1 A;  1TP5 A;  2EAQ A;  3RL8 A;  1WG6 A;  5F3X A;  2EDZ A;  3O46 A;  2MX6 A;  2Q9V A;  1Q3P A;  3GDU A;  5E6P B;  5HET A;  2QKV A;  4UU5 A;  3KDG A;  3SOE A;  4WYU A;  2ZPM A;  5F67 A;  3NFL A;  1U39 A;  3O5N A;  1PDR A;  3GGE A;  3LNY A;  3HPK A;  2IWN A;  2KPL A;  1UEZ A;  5HEB A;  1MFL A;  2D8I A;  2K1Z A;  4NMP A;  1UEP A;  1UFX A;  4JJ3 A;  4K75 A;  5G1D A;  2PDZ A;  5E1Y A;  1IU0 A;  3KZE A;  3MH6 A;  5HFE A;  1BFE A;  5HFB A;  2KOM A;  2H3L A;  1W9E A;  3CBX A;  2KOH A;  4HOP B;  3R0H A;  1QAV B;  5G1E A;  1GQ4 A;  5HED A;  1G9O A;  3ZRT A;  2PA1 A;  1U3B A;  1ZOK A;  4NMR A;  1T2M A;  2QKT A;  3HPM A;  2EHR A;  2YTW A;  1WI4 A;  4IC6 A;  3QIK A;  2EEH A;  1Q3O A;  4F8K A;  4OEP A;  1M5Z A;  2LOB A;  1WFV A;  2M0U A;  2X7Z A;  4JOF A;  4JOH A;  1UJV A;  5HDY A;  1RGR A;  2BYG A;  3HVQ C;  4P2A B;  4Q2P A;  2CSJ A;  1FCF A;  2FN5 A;  3JXT A;  1TP3 A;  2EGO A;  4G69 A;  2VSP A;  3DJA A;  2CS5 A;  4FLN A;  2DM8 A;  1OBZ A;  3GDV A;  1X5Q A;  4Q6S A;  3OU0 A;  1QAU A;  3E17 A;  3CBZ A;  2E7K A;  2L4S A;  2OSG A;  5ILB A;  1UM1 A;  2EGN A;  3STJ A;  4E34 A;  2LC6 A;  4NNL A;  5EZ0 A;  2CSS A;  5HFF A;  4EDJ A;  4Q2N A;  1W9Q A;  2REY A;  2I4S A;  1FC9 A;  3ID1 A;  4R2Z A;  1KWA A;  5HFD A;  4YYX A;  1N7T A;  1NTE A;  3KHF A;  3LNX A;  5FB8 C;  2L4T A;  4E3B A;  2Q3G A;  3I4W A;  4WYT A;  2EEG A;  1SOZ A;  2KL1 A;  2JRE A;  1X6D A;  1VCW A;  4JOP A;  2DKR A;  2EXG A;  2RCZ A;  1X45 A;  3TMH A;  4GVC A;  1MC7 A;  2HE2 A;  1R6J A;  2V90 A;  4JOK A;  1WJL A;  1UEQ A;  2OMJ A;  2AIN A;  3CC0 A;  4KFV A;  5IL9 A;  1X9Z A;  2G2L A;  3SFJ A;  1FC7 A;  1BE9 A;  4NMS A;  4AMH A;  2OCS A;  3I1E A;  4NMO A;  1K32 A;  3B76 A;  2M10 A;  2FNE A;  2HGA A;  1X8S A;  2JIN A;  2Z9I A;  3BPU A;  4KFW A;  1UJD A;  4N6X A;  5HJ1 A;  1N6E A;  2KRG A;  5FHT A;  1VA8 A;  1P1D A;  5B6L A;  2M0V A;  2RRM A;  1L6O A;  4RI0 A;  5A2P A;  1UF1 A;  2VWR A;  1IHJ A;  1UHP A;  1LCY A;  1W9O A;  1OZI A;  3NCV A;  5E21 A;  1RGW A;  1GQ5 A;  4FGM A;  4JOE A;  4REY A;  3MH4 A;  3CH8 A;  2PNT A;  1KY9 A;  3DOR A;  2DJT A;  3QJM A;  1WFG A;  1I92 A;  3MH7 A;  3CBY A;  5EYZ A;  4Q2Q A;  5HF4 A;  2HE4 A;  3GSL A;  5HFC A;  2Z17 A;  1TE0 A;  3PS4 A;  1N6F A;  2D90 A;  2JSN A;  1V5L A;  2PKT A;  4GHN A;  3PV5 A;  2MHO A;  2DC2 A;  5E22 A;  2W7R A;  1U37 A;  1Y7N A;  2OGP A;  3TSZ A;  1N7E A;  1VAE A;  1ZUB A;  3SUZ A;  1VJ6 A;  2EDP A;  3RLE A;  3DIW A;  4NNM A;  2D92 A;  1U38 A;  2GZV A;  2YUB A;  1X5R A;  4NMV A;  2DLU A;  2DAZ A;  3QDO A;  2QBW A;  3DJ3 A;  3EGH C;  1KEF A;  2KA9 A;  3GCN A;  4JOJ A;  4NXQ A;  3CS0 A;  4NMQ A;  3OTP A;  1YBO A;  2H2C A;  3KDK A;  2VZ5 A;  4Q3H A;  3PV4 A;  1WHA A;  2YT7 A;  3GAB A;  3SHU A;  3R69 A;  1UM7 A;  1V6B A;  2KJP A;  2I0I A;  2R3Y A;  1V62 A;  1QLC A;  2AWU A;  2W4F A;  1FC6 A;  4K6Y A;  2YUY A;  2ENO A;  2OS6 A;  4NXP A;  2K20 A;  1UJU A;  1N7F A;  1MFG A;  3VQF A;  2KPK A;  5H3J A;  2OZF A;  4JOR A;  5GND A;  3CYY A;  3PDZ A;  5HEY A;  5JXB A;  1Y8T A;  1UIT A;  2EGK A;  1WIF A;  2KYL A;  2PZD A;  4NXR A;  3I18 A; 
#chains in the Genus database with same CATH homology
 2QKU A;  1N6D A;  1RZX A;  1VB7 A;  2H2B A;  1XZ9 A;  2V1W A;  1OBY A;  4JJ0 A;  1N99 A;  1Z87 A;  2LUI A;  2JWE A;  2OPG A;  2KV8 A;  2O2T A;  1RY4 A;  4E35 A;  1V1T A;  3TSV A;  3GDS A;  2JOA A;  3QO6 A;  3GJ9 A;  3WKL A;  4O06 A;  2P3W A;  2EEJ A;  2FE5 A;  2KG2 A;  2IWQ A;  2KOJ A;  2QT5 A;  3KZD A;  3K82 A;  2UZC A;  3K50 A;  2VPH A;  2YT8 A;  2OQS A;  3FY5 A;  4MPA A;  4K72 A;  3GCO A;  4Z33 A;  2DLS A;  2LC7 A;  2F5Y A;  2DB5 A;  2L97 A;  3QJN A;  4Q2O A;  1WF7 A;  2H3M A;  2WL7 A;  1D5G A;  4P0C A;  4OEO A;  2LA8 A;  1WH1 A;  2VSV A;  2KJK A;  2I1N A;  2JIL A;  4K78 A;  3NFK A;  5HF1 A;  3QGL A;  4GVD A;  4JL7 A;  2IWO A;  1TQ3 A;  2IWP A;  4HOP A;  3R68 A;  2KQF A;  4NMT A;  2GEF A;  1QAV A;  2EJY A;  2AWW A;  4XHV A;  1P1E A;  2AWX A;  1WF8 A;  3EGG C;  3K1R A;  2PKU A;  5B42 A;  1SOT A;  3VQG A;  2I6V A;  2VRF A;  2KAW A;  4K76 A;  4OAJ A;  2JIK A;  3RL7 A;  4PQW A;  5DTH A;  2EDV A;  4UU6 A;  1Z86 A;  2JXO A;  1IU2 A;  3ID4 A;  2ZPL A;  2F0A A;  4H11 A;  3SHW A;  1NF3 C;  3PDV A;  1I16 A;  5E11 A;  3NGH A;  3L4F D;  4Q6H A;  2I0L A;  1WHD A;  1UEW A;  2KBS A;  3DJ1 A;  4LMM A;  2FCF A;  2M0T A;  3WKM A;  2R4H A;  1Q7X A;  1X5N A;  3ID3 A;  3PV2 A;  2M3M A;  3TSW A;  2EEI A;  1WI2 A;  2EV8 A;  4YDP A;  5I7Z A;  2DMZ A;  1OBX A;  1V5Q A;  5GLJ A;  2QG1 A;  3QE1 A;  4JOG A;  2G5M B;  2I04 A;  2M0Z A;  3AXA A;  1B8Q A;  4L8N A;  2KJD A;  5D13 A;  4Z8J A;  3ID2 A;  1GM1 A;  1TP5 A;  2EAQ A;  3RL8 A;  1WG6 A;  5F3X A;  2EDZ A;  3O46 A;  2MX6 A;  2Q9V A;  1Q3P A;  3GDU A;  5E6P B;  5HET A;  2QKV A;  4UU5 A;  3KDG A;  3SOE A;  4WYU A;  2ZPM A;  5F67 A;  3NFL A;  1U39 A;  3O5N A;  1PDR A;  3GGE A;  3LNY A;  3HPK A;  2IWN A;  2KPL A;  1UEZ A;  5HEB A;  1MFL A;  2D8I A;  2K1Z A;  4NMP A;  1UEP A;  1UFX A;  4JJ3 A;  4K75 A;  5G1D A;  2PDZ A;  5E1Y A;  1IU0 A;  3KZE A;  3MH6 A;  5HFE A;  1BFE A;  5HFB A;  2KOM A;  2H3L A;  1W9E A;  3CBX A;  2KOH A;  4HOP B;  3R0H A;  1QAV B;  5G1E A;  1GQ4 A;  5HED A;  1G9O A;  3ZRT A;  2PA1 A;  1U3B A;  1ZOK A;  4NMR A;  1T2M A;  2QKT A;  3HPM A;  2EHR A;  2YTW A;  1WI4 A;  4IC6 A;  3QIK A;  2EEH A;  1Q3O A;  4F8K A;  4OEP A;  1M5Z A;  2LOB A;  1WFV A;  2M0U A;  2X7Z A;  4JOF A;  4JOH A;  1UJV A;  5HDY A;  1RGR A;  2BYG A;  3HVQ C;  4P2A B;  4Q2P A;  2CSJ A;  1FCF A;  2FN5 A;  3JXT A;  1TP3 A;  2EGO A;  4G69 A;  2VSP A;  3DJA A;  2CS5 A;  4FLN A;  2DM8 A;  1OBZ A;  3GDV A;  1X5Q A;  4Q6S A;  3OU0 A;  1QAU A;  3E17 A;  3CBZ A;  2E7K A;  2L4S A;  2OSG A;  5ILB A;  1UM1 A;  2EGN A;  3STJ A;  4E34 A;  2LC6 A;  4NNL A;  5EZ0 A;  2CSS A;  5HFF A;  4EDJ A;  4Q2N A;  1W9Q A;  2REY A;  2I4S A;  1FC9 A;  3ID1 A;  4R2Z A;  1KWA A;  5HFD A;  4YYX A;  1N7T A;  1NTE A;  3KHF A;  3LNX A;  5FB8 C;  2L4T A;  4E3B A;  2Q3G A;  3I4W A;  4WYT A;  2EEG A;  1SOZ A;  2KL1 A;  2JRE A;  1X6D A;  1VCW A;  4JOP A;  2DKR A;  2EXG A;  2RCZ A;  1X45 A;  3TMH A;  4GVC A;  1MC7 A;  2HE2 A;  1R6J A;  2V90 A;  4JOK A;  1WJL A;  1UEQ A;  2OMJ A;  2AIN A;  3CC0 A;  4KFV A;  5IL9 A;  1X9Z A;  2G2L A;  3SFJ A;  1FC7 A;  1BE9 A;  4NMS A;  4AMH A;  2OCS A;  3I1E A;  4NMO A;  1K32 A;  3B76 A;  2M10 A;  2FNE A;  2HGA A;  1X8S A;  2JIN A;  2Z9I A;  3BPU A;  4KFW A;  1UJD A;  4N6X A;  5HJ1 A;  1N6E A;  2KRG A;  5FHT A;  1VA8 A;  1P1D A;  5B6L A;  2M0V A;  2RRM A;  1L6O A;  4RI0 A;  5A2P A;  1UF1 A;  2VWR A;  1IHJ A;  1UHP A;  1LCY A;  1W9O A;  1OZI A;  3NCV A;  5E21 A;  1RGW A;  1GQ5 A;  4FGM A;  4JOE A;  4REY A;  3MH4 A;  3CH8 A;  2PNT A;  1KY9 A;  3DOR A;  2DJT A;  3QJM A;  1WFG A;  1I92 A;  3MH7 A;  3CBY A;  5EYZ A;  4Q2Q A;  5HF4 A;  2HE4 A;  3GSL A;  5HFC A;  2Z17 A;  1TE0 A;  3PS4 A;  1N6F A;  2D90 A;  2JSN A;  1V5L A;  2PKT A;  4GHN A;  3PV5 A;  2MHO A;  2DC2 A;  5E22 A;  2W7R A;  1U37 A;  1Y7N A;  2OGP A;  3TSZ A;  1N7E A;  1VAE A;  1ZUB A;  3SUZ A;  1VJ6 A;  2EDP A;  3RLE A;  3DIW A;  4NNM A;  2D92 A;  1U38 A;  2GZV A;  2YUB A;  1X5R A;  4NMV A;  2DLU A;  2DAZ A;  3QDO A;  2QBW A;  3DJ3 A;  3EGH C;  1KEF A;  2KA9 A;  3GCN A;  4JOJ A;  4NXQ A;  3CS0 A;  4NMQ A;  3OTP A;  1YBO A;  2H2C A;  3KDK A;  2VZ5 A;  4Q3H A;  3PV4 A;  1WHA A;  2YT7 A;  3GAB A;  3SHU A;  3R69 A;  1UM7 A;  1V6B A;  2KJP A;  2I0I A;  2R3Y A;  1V62 A;  1QLC A;  2AWU A;  2W4F A;  1FC6 A;  4K6Y A;  2YUY A;  2ENO A;  2OS6 A;  4NXP A;  2K20 A;  1UJU A;  1N7F A;  1MFG A;  3VQF A;  2KPK A;  5H3J A;  2OZF A;  4JOR A;  5GND A;  3CYY A;  3PDZ A;  5HEY A;  5JXB A;  1Y8T A;  1UIT A;  2EGK A;  1WIF A;  2KYL A;  2PZD A;  4NXR A;  3I18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...