3SOEA

Crystal structure of the 3rd pdz domain of the human membrane-associated guanylate kinase, ww and pdz domain-containing protein 3 (magi3)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
101
Chain Sequence
GAMATLYKKAGLLVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPGQITKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Membrane-associated guanylate kinase, WW and PDZ domain-cont
publication title Crystal Structure of the 3rd PDZ domain of the human Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 (MAGI3)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 101
sequence length 113
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3soeA00
4JOPA 2FNEA 1PDRA 1BE9A 1Q3PA 1BFEA 1N6EA 2KPLA 5FB8C 5EZ0A 3TSZA 1YBOA 5HFBA 2KAWA 1WJLA 2H2CA 2YUBA 4Q2PA 1WFVA 2W4FA 2PA1A 2KV8A 1T2MA 2KG2A 2OZFA 4P2AB 2OPGA 4K75A 1XZ9A 2UZCA 5G1EA 2L4SA 1N6FA 1B8QA 5JXBA 2WL7A 4OEOA 2DLUA 1U3BA 2DJTA 4NNLA 4RI0A 1IU0A 5FHTA 3WKLA 1UJVA 4NMVA 4IC6A 4JOEA 1VAEA 3JXTA 1N6DA 3K1RA 4JOJA 1NTEA 1FCFA 3ID1A 1WG6A 2AWXA 1KEFA 5HFEA 5D13A 3DJAA 3SHUA 2Q9VA 2EXGA 2KOMA 4OEPA 4E34A 4NMQA 1RY4A 2V90A 4L8NA 1UEZA 3TMHA 2RRMA 2KBSA 3MH6A 3CBYA 1V5QA 2EGNA 2JWEA 3R0HA 2K20A 2H2BA 2G2LA 1UHPA 3K82A 4REYA 2G5MB 1D5GA 2DMZA 3OU0A 2QKVA 2OGPA 3ID3A 4NXRA 2L4TA 2DLSA 3I4WA 3RL8A 3QJNA 3DJ1A 5HF1A 1Z86A 5HFFA 4XHVA 5E11A 1V6BA 3NGHA 1W9OA 2KQFA 1QLCA 1U37A 1WIFA 3ZRTA 3SOEA 2EAQA 2EJYA 3PDZA 2KJDA 3KHFA 2JIKA 3AXAA 3TSWA 1Q7XA 1QAUA 1SOZA 1OBXA 2FE5A 2LA8A 3CC0A 3FY5A 3GDSA 5HFCA 1KY9A 1TP5A 3DIWA 5E22A 4E3BA 5H3JA 4KFVA 3ID4A 4NMOA 3MH7A 2YUYA 2OS6A 2JXOA 2IWNA 2OCSA 2KA9A 2M10A 4WYUA 1VCWA 1Y8TA 5GLJA 5F67A 3QGLA 4H11A 2JOAA 5G1DA 1SOTA 1N7TA 2IWOA 2YTWA 1UFXA 2ZPMA 1UM1A 3VQGA 1R6JA 2EEJA 4LMMA 5F3XA 1V62A 3PDVA 1G9OA 3R69A 2KJPA 1IHJA 2LC6A 1OZIA 2EGKA 1RGRA 1FC7A 2PZDA 4NMRA 1ZOKA 3QJMA 1OBZA 1IU2A 2I04A 1I92A 1V5LA 1UEPA 1Z87A 2I1NA 4NMSA 4AMHA 5E1YA 3O5NA 4Z33A 4HOPB 4P0CA 4O06A 1I16A 2GZVA 4GVDA 3TSVA 2D8IA 2H3LA 2QT5A 3HVQC 2V1WA 1WF8A 1QAVB 3R68A 2M3MA 2D92A 2VSVA 2BYGA 2LUIA 1VA8A 2DKRA 5HFDA 1UM7A 3QDOA 1UITA 2LOBA 3L4FD 2ENOA 3EGHC 4R2ZA 3LNYA 3QO6A 4JOFA 1N7EA 2QKTA 4K72A 4K78A 1U38A 3PS4A 2DC2A 2Z9IA 2FCFA 3I18A 4NXQA 3ID2A 3RL7A 1L6OA 1P1EA 2LC7A 1UJDA 2F0AA 5A2PA 2EEGA 1VJ6A 2O2TA 1TP3A 3SFJA 2JILA 2H3MA 1V1TA 2EEIA 2Z17A 3CBZA 3GJ9A 1P1DA 2KPKA 2HE4A 4GVCA 1TE0A 3GSLA 3RLEA 3MH4A 1X5RA 2I0LA 3GDVA 2AINA 1K32A 4HOPA 4NNMA 2VRFA 2JREA 1X6DA 1GQ4A 2M0TA 2R3YA 2DB5A 2VWRA 2KOHA 1VB7A 1RZXA 1WI4A 1FC6A 2QBWA 1ZUBA 4JOHA 5E6PB 2K1ZA 2KYLA 5GNDA 3PV4A 5E21A 5HEDA 2REYA 3OTPA 4Q2NA 2DAZA 2EDPA 2OMJA 2KOJA 3QE1A 1WHDA 2Q3GA 3I1EA 4N6XA 3GDUA 2PNTA 4Q6HA 2DM8A 3E17A 1FC9A 4G69A 3EGGC 4NMTA 3GGEA 2KL1A 3QIKA 1X5NA 3K50A 4K76A 3PV2A 4Z8JA 3PV5A 4Q2OA 1WHAA 4Q6SA 2VSPA 1U39A 2AWUA 5HEBA 3SHWA 4YYXA 2PKUA 4PQWA 3CBXA 2MX6A 2QKUA 3HPMA 5HETA 1TQ3A 2M0VA 1W9QA 2D90A 1LCYA 4JOKA 3VQFA 3CH8A 1RGWA 5I7ZA 1UEWA 3O46A 4UU6A 1WF7A 3LNXA 2OQSA 2PKTA 2PDZA 2IWQA 2I4SA 1X45A 1WFGA 4JOGA 2HE2A 1UF1A 1UEQA 3WKMA 2E7KA 3BPUA 2IWPA 1NF3C 4EDJA 5HF4A 2HGAA 2CSSA 3NFKA 4YDPA 2EDVA 1MC7A 4NXPA 1OBYA 4E35A 2I0IA 2L97A 1W9EA 2MHOA 2OSGA 4F8KA 3KZEA 4JORA 4Q3HA 5HEYA 4GHNA 2CS5A 2W7RA 1N7FA 3KZDA 5EYZA 1X8SA 1GQ5A 1GM1A 1KWAA 4JL7A 2EDZA 3DORA 2M0UA 3HPKA 2JINA 4FGMA 1N99A 2EGOA 2VZ5A 3GCOA 2EV8A 1M5ZA 1WH1A 1MFLA 3CYYA 2P3WA 2EHRA 4NMPA 2YT8A 3B76A 3CS0A 5HJ1A 2M0ZA 2CSJA 3STJA 1UJUA 1Y7NA 2AWWA 2KRGA 1QAVA 2VPHA 3GCNA 2EEHA 4UU5A 2QG1A 2I6VA 2KJKA 2F5YA 1WI2A 4KFWA 3SUZA 5HDYA 1Q3OA 4Q2QA 1MFGA 5B6LA 2ZPLA 2YT7A 3NFLA 4MPAA 4WYTA 2RCZA 2FN5A 2X7ZA 4OAJA 5DTHA 1X5QA 4K6YA 2R4HA 3DJ3A
chains in the Genus database with same CATH superfamily
4JOPA 2FNEA 1PDRA 1BE9A 1Q3PA 1BFEA 1N6EA 2KPLA 5FB8C 5EZ0A 3TSZA 1YBOA 5HFBA 2KAWA 1WJLA 2H2CA 2YUBA 4Q2PA 1WFVA 2W4FA 2PA1A 1X9ZA 2KV8A 1T2MA 2KG2A 2OZFA 4P2AB 2OPGA 4K75A 1XZ9A 2UZCA 5G1EA 2L4SA 1N6FA 1B8QA 5JXBA 2WL7A 4OEOA 2DLUA 1U3BA 2DJTA 4NNLA 4RI0A 1IU0A 4FLNA 5FHTA 3WKLA 1UJVA 4NMVA 4IC6A 4JOEA 1VAEA 3JXTA 1N6DA 3K1RA 4JOJA 1NTEA 1FCFA 3ID1A 1WG6A 2AWXA 1KEFA 5HFEA 5D13A 3DJAA 3SHUA 2Q9VA 2EXGA 2KOMA 4OEPA 4E34A 4NMQA 1RY4A 2V90A 4L8NA 1UEZA 3TMHA 2RRMA 2KBSA 3MH6A 3CBYA 1V5QA 2EGNA 2JWEA 3R0HA 2K20A 2H2BA 2G2LA 2JSNA 1UHPA 3K82A 4REYA 2G5MB 1D5GA 2DMZA 3OU0A 2QKVA 2OGPA 3ID3A 4NXRA 2L4TA 2DLSA 3I4WA 3RL8A 3QJNA 3DJ1A 5HF1A 1Z86A 5HFFA 4XHVA 5E11A 1V6BA 3NGHA 1W9OA 2KQFA 1QLCA 1U37A 1WIFA 3ZRTA 3SOEA 2EAQA 2EJYA 3PDZA 2KJDA 4JJ0A 5IL9A 3KHFA 2JIKA 3AXAA 3TSWA 1Q7XA 1QAUA 1SOZA 1OBXA 2FE5A 2LA8A 3CC0A 3FY5A 3GDSA 5HFCA 1KY9A 5ILBA 1TP5A 3DIWA 5E22A 4E3BA 5H3JA 4KFVA 3ID4A 4NMOA 3MH7A 2YUYA 2OS6A 2JXOA 2IWNA 2OCSA 2KA9A 3GABA 2M10A 4WYUA 1VCWA 1Y8TA 5GLJA 5F67A 3QGLA 4H11A 2JOAA 5G1DA 1SOTA 1N7TA 2IWOA 2YTWA 1UFXA 2ZPMA 1UM1A 3VQGA 1R6JA 2EEJA 4LMMA 5F3XA 1V62A 3PDVA 1G9OA 3R69A 2KJPA 1IHJA 2LC6A 1OZIA 2EGKA 1RGRA 1FC7A 2PZDA 4NMRA 1ZOKA 3QJMA 1OBZA 1IU2A 2I04A 1I92A 1V5LA 1UEPA 1Z87A 2I1NA 4NMSA 4AMHA 5E1YA 3O5NA 4Z33A 4JJ3A 4HOPB 4P0CA 4O06A 1I16A 2GZVA 4GVDA 3TSVA 2D8IA 2H3LA 2QT5A 3HVQC 2V1WA 1WF8A 1QAVB 3R68A 2M3MA 2D92A 2VSVA 2BYGA 2LUIA 1VA8A 2DKRA 5HFDA 1UM7A 3QDOA 1UITA 2LOBA 3L4FD 5B42A 2ENOA 3EGHC 4R2ZA 3LNYA 3QO6A 4JOFA 1N7EA 2QKTA 4K72A 4K78A 1U38A 3PS4A 2DC2A 2Z9IA 2FCFA 3I18A 4NXQA 3ID2A 3RL7A 1L6OA 1P1EA 2LC7A 1UJDA 2F0AA 5A2PA 2EEGA 1VJ6A 2O2TA 1TP3A 3SFJA 2JILA 2H3MA 2GEFA 1V1TA 2EEIA 2Z17A 3CBZA 3GJ9A 1P1DA 2KPKA 2HE4A 4GVCA 1TE0A 3GSLA 3RLEA 3MH4A 1X5RA 2I0LA 3KDGA 3GDVA 2AINA 1K32A 4HOPA 4NNMA 2VRFA 2JREA 1X6DA 1GQ4A 2M0TA 2R3YA 2DB5A 2VWRA 3NCVA 2KOHA 1VB7A 1RZXA 1WI4A 1FC6A 2QBWA 1ZUBA 4JOHA 5E6PB 2K1ZA 2KYLA 5GNDA 3PV4A 5E21A 5HEDA 2REYA 3OTPA 4Q2NA 2DAZA 2EDPA 2OMJA 2KOJA 3QE1A 1WHDA 2Q3GA 3I1EA 4N6XA 3GDUA 2PNTA 4Q6HA 2DM8A 3E17A 1FC9A 4G69A 3EGGC 4NMTA 3GGEA 2KL1A 3QIKA 1X5NA 3K50A 4K76A 3PV2A 4Z8JA 3PV5A 4Q2OA 1WHAA 4Q6SA 2VSPA 1U39A 2AWUA 5HEBA 3SHWA 4YYXA 2PKUA 4PQWA 3CBXA 2MX6A 2QKUA 3HPMA 3KDKA 5HETA 1TQ3A 2M0VA 1W9QA 2D90A 1LCYA 4JOKA 3VQFA 3CH8A 1RGWA 5I7ZA 1UEWA 3O46A 4UU6A 1WF7A 3LNXA 2OQSA 2PKTA 2PDZA 2IWQA 2I4SA 1X45A 1WFGA 4JOGA 2HE2A 1UF1A 1UEQA 3WKMA 2E7KA 3BPUA 2IWPA 1NF3C 4EDJA 5HF4A 2HGAA 2CSSA 3NFKA 4YDPA 2EDVA 1MC7A 4NXPA 1OBYA 4E35A 2I0IA 2L97A 1W9EA 2MHOA 2OSGA 4F8KA 3KZEA 4JORA 4Q3HA 5HEYA 4GHNA 2CS5A 2W7RA 1N7FA 3KZDA 5EYZA 1X8SA 1GQ5A 1GM1A 1KWAA 4JL7A 2EDZA 3DORA 2M0UA 3HPKA 2JINA 4FGMA 1N99A 2EGOA 2VZ5A 3GCOA 2EV8A 1M5ZA 1WH1A 1MFLA 3CYYA 2P3WA 2EHRA 4NMPA 2YT8A 3B76A 3CS0A 5HJ1A 2M0ZA 2CSJA 3STJA 1UJUA 1Y7NA 2AWWA 2KRGA 1QAVA 2VPHA 3GCNA 2EEHA 4UU5A 2QG1A 2I6VA 2KJKA 2F5YA 1WI2A 4KFWA 3SUZA 5HDYA 1Q3OA 4Q2QA 1MFGA 5B6LA 2ZPLA 2YT7A 3NFLA 4MPAA 4WYTA 2RCZA 2FN5A 2X7ZA 4OAJA 5DTHA 1X5QA 4K6YA 2R4HA 3DJ3A
chains in the Genus database with same CATH topology
4JOPA 2FNEA 1PDRA 1BE9A 1Q3PA 1BFEA 1N6EA 2KPLA 5FB8C 5EZ0A 3TSZA 1YBOA 5HFBA 2KAWA 1WJLA 2H2CA 2YUBA 4Q2PA 1WFVA 2W4FA 2PA1A 1X9ZA 2KV8A 1T2MA 2KG2A 2OZFA 4P2AB 2OPGA 4K75A 1XZ9A 2UZCA 5G1EA 2L4SA 1N6FA 1B8QA 5JXBA 2WL7A 4OEOA 2DLUA 1U3BA 2DJTA 4NNLA 4RI0A 1IU0A 4FLNA 5FHTA 3WKLA 1UJVA 4NMVA 4IC6A 4JOEA 1VAEA 3JXTA 1N6DA 3K1RA 4JOJA 1NTEA 1FCFA 3ID1A 1WG6A 2AWXA 1KEFA 5HFEA 5D13A 3DJAA 3SHUA 2Q9VA 2EXGA 2KOMA 4OEPA 4E34A 4NMQA 1RY4A 2V90A 4L8NA 1UEZA 3TMHA 2RRMA 2KBSA 3MH6A 3CBYA 1V5QA 2EGNA 2JWEA 3R0HA 2K20A 2H2BA 2G2LA 2JSNA 1UHPA 3K82A 4REYA 2G5MB 1D5GA 2DMZA 3OU0A 2QKVA 2OGPA 3ID3A 4NXRA 2L4TA 2DLSA 3I4WA 3RL8A 3QJNA 3DJ1A 5HF1A 1Z86A 5HFFA 4XHVA 5E11A 1V6BA 3NGHA 1W9OA 2KQFA 1QLCA 1U37A 1WIFA 3ZRTA 3SOEA 2EAQA 2EJYA 3PDZA 2KJDA 4JJ0A 5IL9A 3KHFA 2JIKA 3AXAA 3TSWA 1Q7XA 1QAUA 1SOZA 1OBXA 2FE5A 2LA8A 3CC0A 3FY5A 3GDSA 5HFCA 1KY9A 5ILBA 1TP5A 3DIWA 5E22A 4E3BA 5H3JA 4KFVA 3ID4A 4NMOA 3MH7A 2YUYA 2OS6A 2JXOA 2IWNA 2OCSA 2KA9A 3GABA 2M10A 4WYUA 1VCWA 1Y8TA 5GLJA 5F67A 3QGLA 4H11A 2JOAA 5G1DA 1SOTA 1N7TA 2IWOA 2YTWA 1UFXA 2ZPMA 1UM1A 3VQGA 1R6JA 2EEJA 4LMMA 5F3XA 1V62A 3PDVA 1G9OA 3R69A 2KJPA 1IHJA 2LC6A 1OZIA 2EGKA 1RGRA 1FC7A 2PZDA 4NMRA 1ZOKA 3QJMA 1OBZA 1IU2A 2I04A 1I92A 1V5LA 1UEPA 1Z87A 2I1NA 4NMSA 4AMHA 5E1YA 3O5NA 4Z33A 4JJ3A 4HOPB 4P0CA 4O06A 1I16A 2GZVA 4GVDA 3TSVA 2D8IA 2H3LA 2QT5A 3HVQC 2V1WA 1WF8A 1QAVB 3R68A 2M3MA 2D92A 2VSVA 2BYGA 2LUIA 1VA8A 2DKRA 5HFDA 1UM7A 3QDOA 1UITA 2LOBA 3L4FD 5B42A 2ENOA 3EGHC 4R2ZA 3LNYA 3QO6A 4JOFA 1N7EA 2QKTA 4K72A 4K78A 1U38A 3PS4A 2DC2A 2Z9IA 2FCFA 3I18A 4NXQA 3ID2A 3RL7A 1L6OA 1P1EA 2LC7A 1UJDA 2F0AA 5A2PA 2EEGA 1VJ6A 2O2TA 1TP3A 3SFJA 2JILA 2H3MA 2GEFA 1V1TA 2EEIA 2Z17A 3CBZA 3GJ9A 1P1DA 2KPKA 2HE4A 4GVCA 1TE0A 3GSLA 3RLEA 3MH4A 1X5RA 2I0LA 3KDGA 3GDVA 2AINA 1K32A 4HOPA 4NNMA 2VRFA 2JREA 1X6DA 1GQ4A 2M0TA 2R3YA 2DB5A 2VWRA 3NCVA 2KOHA 1VB7A 1RZXA 1WI4A 1FC6A 2QBWA 1ZUBA 4JOHA 5E6PB 2K1ZA 2KYLA 5GNDA 3PV4A 5E21A 5HEDA 2REYA 3OTPA 4Q2NA 2DAZA 2EDPA 2OMJA 2KOJA 3QE1A 1WHDA 2Q3GA 3I1EA 4N6XA 3GDUA 2PNTA 4Q6HA 2DM8A 3E17A 1FC9A 4G69A 3EGGC 4NMTA 3GGEA 2KL1A 3QIKA 1X5NA 3K50A 4K76A 3PV2A 4Z8JA 3PV5A 4Q2OA 1WHAA 4Q6SA 2VSPA 1U39A 2AWUA 5HEBA 3SHWA 4YYXA 2PKUA 4PQWA 3CBXA 2MX6A 2QKUA 3HPMA 3KDKA 5HETA 1TQ3A 2M0VA 1W9QA 2D90A 1LCYA 4JOKA 3VQFA 3CH8A 1RGWA 5I7ZA 1UEWA 3O46A 4UU6A 1WF7A 3LNXA 2OQSA 2PKTA 2PDZA 2IWQA 2I4SA 1X45A 1WFGA 4JOGA 2HE2A 1UF1A 1UEQA 3WKMA 2E7KA 3BPUA 2IWPA 1NF3C 4EDJA 5HF4A 2HGAA 2CSSA 3NFKA 4YDPA 2EDVA 1MC7A 4NXPA 1OBYA 4E35A 2I0IA 2L97A 1W9EA 2MHOA 2OSGA 4F8KA 3KZEA 4JORA 4Q3HA 5HEYA 4GHNA 2CS5A 2W7RA 1N7FA 3KZDA 5EYZA 1X8SA 1GQ5A 1GM1A 1KWAA 4JL7A 2EDZA 3DORA 2M0UA 3HPKA 2JINA 4FGMA 1N99A 2EGOA 2VZ5A 3GCOA 2EV8A 1M5ZA 1WH1A 1MFLA 3CYYA 2P3WA 2EHRA 4NMPA 2YT8A 3B76A 3CS0A 5HJ1A 2M0ZA 2CSJA 3STJA 1UJUA 1Y7NA 2AWWA 2KRGA 1QAVA 2VPHA 3GCNA 2EEHA 4UU5A 2QG1A 2I6VA 2KJKA 2F5YA 1WI2A 4KFWA 3SUZA 5HDYA 1Q3OA 4Q2QA 1MFGA 5B6LA 2ZPLA 2YT7A 3NFLA 4MPAA 4WYTA 2RCZA 2FN5A 2X7ZA 4OAJA 5DTHA 1X5QA 4K6YA 2R4HA 3DJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOP A;  2FNE A;  1PDR A;  1BE9 A;  1Q3P A;  1BFE A;  1N6E A;  2KPL A;  5FB8 C;  5EZ0 A;  3TSZ A;  1YBO A;  5HFB A;  2KAW A;  1WJL A;  2H2C A;  2YUB A;  4Q2P A;  1WFV A;  2W4F A;  2PA1 A;  2KV8 A;  1T2M A;  2KG2 A;  2OZF A;  4P2A B;  2OPG A;  4K75 A;  1XZ9 A;  2UZC A;  5G1E A;  2L4S A;  1N6F A;  1B8Q A;  5JXB A;  2WL7 A;  4OEO A;  2DLU A;  1U3B A;  2DJT A;  4NNL A;  4RI0 A;  1IU0 A;  5FHT A;  3WKL A;  1UJV A;  4NMV A;  4IC6 A;  4JOE A;  1VAE A;  3JXT A;  1N6D A;  3K1R A;  4JOJ A;  1NTE A;  1FCF A;  3ID1 A;  1WG6 A;  2AWX A;  1KEF A;  5HFE A;  5D13 A;  3DJA A;  3SHU A;  2Q9V A;  2EXG A;  2KOM A;  4OEP A;  4E34 A;  4NMQ A;  1RY4 A;  2V90 A;  4L8N A;  1UEZ A;  3TMH A;  2RRM A;  2KBS A;  3MH6 A;  3CBY A;  1V5Q A;  2EGN A;  2JWE A;  3R0H A;  2K20 A;  2H2B A;  2G2L A;  1UHP A;  3K82 A;  4REY A;  2G5M B;  1D5G A;  2DMZ A;  3OU0 A;  2QKV A;  2OGP A;  3ID3 A;  4NXR A;  2L4T A;  2DLS A;  3I4W A;  3RL8 A;  3QJN A;  3DJ1 A;  5HF1 A;  1Z86 A;  5HFF A;  4XHV A;  5E11 A;  1V6B A;  3NGH A;  1W9O A;  2KQF A;  1QLC A;  1U37 A;  1WIF A;  3ZRT A;  3SOE A;  2EAQ A;  2EJY A;  3PDZ A;  2KJD A;  3KHF A;  2JIK A;  3AXA A;  3TSW A;  1Q7X A;  1QAU A;  1SOZ A;  1OBX A;  2FE5 A;  2LA8 A;  3CC0 A;  3FY5 A;  3GDS A;  5HFC A;  1KY9 A;  1TP5 A;  3DIW A;  5E22 A;  4E3B A;  5H3J A;  4KFV A;  3ID4 A;  4NMO A;  3MH7 A;  2YUY A;  2OS6 A;  2JXO A;  2IWN A;  2OCS A;  2KA9 A;  2M10 A;  4WYU A;  1VCW A;  1Y8T A;  5GLJ A;  5F67 A;  3QGL A;  4H11 A;  2JOA A;  5G1D A;  1SOT A;  1N7T A;  2IWO A;  2YTW A;  1UFX A;  2ZPM A;  1UM1 A;  3VQG A;  1R6J A;  2EEJ A;  4LMM A;  5F3X A;  1V62 A;  3PDV A;  1G9O A;  3R69 A;  2KJP A;  1IHJ A;  2LC6 A;  1OZI A;  2EGK A;  1RGR A;  1FC7 A;  2PZD A;  4NMR A;  1ZOK A;  3QJM A;  1OBZ A;  1IU2 A;  2I04 A;  1I92 A;  1V5L A;  1UEP A;  1Z87 A;  2I1N A;  4NMS A;  4AMH A;  5E1Y A;  3O5N A;  4Z33 A;  4HOP B;  4P0C A;  4O06 A;  1I16 A;  2GZV A;  4GVD A;  3TSV A;  2D8I A;  2H3L A;  2QT5 A;  3HVQ C;  2V1W A;  1WF8 A;  1QAV B;  3R68 A;  2M3M A;  2D92 A;  2VSV A;  2BYG A;  2LUI A;  1VA8 A;  2DKR A;  5HFD A;  1UM7 A;  3QDO A;  1UIT A;  2LOB A;  3L4F D;  2ENO A;  3EGH C;  4R2Z A;  3LNY A;  3QO6 A;  4JOF A;  1N7E A;  2QKT A;  4K72 A;  4K78 A;  1U38 A;  3PS4 A;  2DC2 A;  2Z9I A;  2FCF A;  3I18 A;  4NXQ A;  3ID2 A;  3RL7 A;  1L6O A;  1P1E A;  2LC7 A;  1UJD A;  2F0A A;  5A2P A;  2EEG A;  1VJ6 A;  2O2T A;  1TP3 A;  3SFJ A;  2JIL A;  2H3M A;  1V1T A;  2EEI A;  2Z17 A;  3CBZ A;  3GJ9 A;  1P1D A;  2KPK A;  2HE4 A;  4GVC A;  1TE0 A;  3GSL A;  3RLE A;  3MH4 A;  1X5R A;  2I0L A;  3GDV A;  2AIN A;  1K32 A;  4HOP A;  4NNM A;  2VRF A;  2JRE A;  1X6D A;  1GQ4 A;  2M0T A;  2R3Y A;  2DB5 A;  2VWR A;  2KOH A;  1VB7 A;  1RZX A;  1WI4 A;  1FC6 A;  2QBW A;  1ZUB A;  4JOH A;  5E6P B;  2K1Z A;  2KYL A;  5GND A;  3PV4 A;  5E21 A;  5HED A;  2REY A;  3OTP A;  4Q2N A;  2DAZ A;  2EDP A;  2OMJ A;  2KOJ A;  3QE1 A;  1WHD A;  2Q3G A;  3I1E A;  4N6X A;  3GDU A;  2PNT A;  4Q6H A;  2DM8 A;  3E17 A;  1FC9 A;  4G69 A;  3EGG C;  4NMT A;  3GGE A;  2KL1 A;  3QIK A;  1X5N A;  3K50 A;  4K76 A;  3PV2 A;  4Z8J A;  3PV5 A;  4Q2O A;  1WHA A;  4Q6S A;  2VSP A;  1U39 A;  2AWU A;  5HEB A;  3SHW A;  4YYX A;  2PKU A;  4PQW A;  3CBX A;  2MX6 A;  2QKU A;  3HPM A;  5HET A;  1TQ3 A;  2M0V A;  1W9Q A;  2D90 A;  1LCY A;  4JOK A;  3VQF A;  3CH8 A;  1RGW A;  5I7Z A;  1UEW A;  3O46 A;  4UU6 A;  1WF7 A;  3LNX A;  2OQS A;  2PKT A;  2PDZ A;  2IWQ A;  2I4S A;  1X45 A;  1WFG A;  4JOG A;  2HE2 A;  1UF1 A;  1UEQ A;  3WKM A;  2E7K A;  3BPU A;  2IWP A;  1NF3 C;  4EDJ A;  5HF4 A;  2HGA A;  2CSS A;  3NFK A;  4YDP A;  2EDV A;  1MC7 A;  4NXP A;  1OBY A;  4E35 A;  2I0I A;  2L97 A;  1W9E A;  2MHO A;  2OSG A;  4F8K A;  3KZE A;  4JOR A;  4Q3H A;  5HEY A;  4GHN A;  2CS5 A;  2W7R A;  1N7F A;  3KZD A;  5EYZ A;  1X8S A;  1GQ5 A;  1GM1 A;  1KWA A;  4JL7 A;  2EDZ A;  3DOR A;  2M0U A;  3HPK A;  2JIN A;  4FGM A;  1N99 A;  2EGO A;  2VZ5 A;  3GCO A;  2EV8 A;  1M5Z A;  1WH1 A;  1MFL A;  3CYY A;  2P3W A;  2EHR A;  4NMP A;  2YT8 A;  3B76 A;  3CS0 A;  5HJ1 A;  2M0Z A;  2CSJ A;  3STJ A;  1UJU A;  1Y7N A;  2AWW A;  2KRG A;  1QAV A;  2VPH A;  3GCN A;  2EEH A;  4UU5 A;  2QG1 A;  2I6V A;  2KJK A;  2F5Y A;  1WI2 A;  4KFW A;  3SUZ A;  5HDY A;  1Q3O A;  4Q2Q A;  1MFG A;  5B6L A;  2ZPL A;  2YT7 A;  3NFL A;  4MPA A;  4WYT A;  2RCZ A;  2FN5 A;  2X7Z A;  4OAJ A;  5DTH A;  1X5Q A;  4K6Y A;  2R4H A;  3DJ3 A; 
#chains in the Genus database with same CATH topology
 4JOP A;  2FNE A;  1PDR A;  1BE9 A;  1Q3P A;  1BFE A;  1N6E A;  2KPL A;  5FB8 C;  5EZ0 A;  3TSZ A;  1YBO A;  5HFB A;  2KAW A;  1WJL A;  2H2C A;  2YUB A;  4Q2P A;  1WFV A;  2W4F A;  2PA1 A;  1X9Z A;  2KV8 A;  1T2M A;  2KG2 A;  2OZF A;  4P2A B;  2OPG A;  4K75 A;  1XZ9 A;  2UZC A;  5G1E A;  2L4S A;  1N6F A;  1B8Q A;  5JXB A;  2WL7 A;  4OEO A;  2DLU A;  1U3B A;  2DJT A;  4NNL A;  4RI0 A;  1IU0 A;  4FLN A;  5FHT A;  3WKL A;  1UJV A;  4NMV A;  4IC6 A;  4JOE A;  1VAE A;  3JXT A;  1N6D A;  3K1R A;  4JOJ A;  1NTE A;  1FCF A;  3ID1 A;  1WG6 A;  2AWX A;  1KEF A;  5HFE A;  5D13 A;  3DJA A;  3SHU A;  2Q9V A;  2EXG A;  2KOM A;  4OEP A;  4E34 A;  4NMQ A;  1RY4 A;  2V90 A;  4L8N A;  1UEZ A;  3TMH A;  2RRM A;  2KBS A;  3MH6 A;  3CBY A;  1V5Q A;  2EGN A;  2JWE A;  3R0H A;  2K20 A;  2H2B A;  2G2L A;  2JSN A;  1UHP A;  3K82 A;  4REY A;  2G5M B;  1D5G A;  2DMZ A;  3OU0 A;  2QKV A;  2OGP A;  3ID3 A;  4NXR A;  2L4T A;  2DLS A;  3I4W A;  3RL8 A;  3QJN A;  3DJ1 A;  5HF1 A;  1Z86 A;  5HFF A;  4XHV A;  5E11 A;  1V6B A;  3NGH A;  1W9O A;  2KQF A;  1QLC A;  1U37 A;  1WIF A;  3ZRT A;  3SOE A;  2EAQ A;  2EJY A;  3PDZ A;  2KJD A;  4JJ0 A;  5IL9 A;  3KHF A;  2JIK A;  3AXA A;  3TSW A;  1Q7X A;  1QAU A;  1SOZ A;  1OBX A;  2FE5 A;  2LA8 A;  3CC0 A;  3FY5 A;  3GDS A;  5HFC A;  1KY9 A;  5ILB A;  1TP5 A;  3DIW A;  5E22 A;  4E3B A;  5H3J A;  4KFV A;  3ID4 A;  4NMO A;  3MH7 A;  2YUY A;  2OS6 A;  2JXO A;  2IWN A;  2OCS A;  2KA9 A;  3GAB A;  2M10 A;  4WYU A;  1VCW A;  1Y8T A;  5GLJ A;  5F67 A;  3QGL A;  4H11 A;  2JOA A;  5G1D A;  1SOT A;  1N7T A;  2IWO A;  2YTW A;  1UFX A;  2ZPM A;  1UM1 A;  3VQG A;  1R6J A;  2EEJ A;  4LMM A;  5F3X A;  1V62 A;  3PDV A;  1G9O A;  3R69 A;  2KJP A;  1IHJ A;  2LC6 A;  1OZI A;  2EGK A;  1RGR A;  1FC7 A;  2PZD A;  4NMR A;  1ZOK A;  3QJM A;  1OBZ A;  1IU2 A;  2I04 A;  1I92 A;  1V5L A;  1UEP A;  1Z87 A;  2I1N A;  4NMS A;  4AMH A;  5E1Y A;  3O5N A;  4Z33 A;  4JJ3 A;  4HOP B;  4P0C A;  4O06 A;  1I16 A;  2GZV A;  4GVD A;  3TSV A;  2D8I A;  2H3L A;  2QT5 A;  3HVQ C;  2V1W A;  1WF8 A;  1QAV B;  3R68 A;  2M3M A;  2D92 A;  2VSV A;  2BYG A;  2LUI A;  1VA8 A;  2DKR A;  5HFD A;  1UM7 A;  3QDO A;  1UIT A;  2LOB A;  3L4F D;  5B42 A;  2ENO A;  3EGH C;  4R2Z A;  3LNY A;  3QO6 A;  4JOF A;  1N7E A;  2QKT A;  4K72 A;  4K78 A;  1U38 A;  3PS4 A;  2DC2 A;  2Z9I A;  2FCF A;  3I18 A;  4NXQ A;  3ID2 A;  3RL7 A;  1L6O A;  1P1E A;  2LC7 A;  1UJD A;  2F0A A;  5A2P A;  2EEG A;  1VJ6 A;  2O2T A;  1TP3 A;  3SFJ A;  2JIL A;  2H3M A;  2GEF A;  1V1T A;  2EEI A;  2Z17 A;  3CBZ A;  3GJ9 A;  1P1D A;  2KPK A;  2HE4 A;  4GVC A;  1TE0 A;  3GSL A;  3RLE A;  3MH4 A;  1X5R A;  2I0L A;  3KDG A;  3GDV A;  2AIN A;  1K32 A;  4HOP A;  4NNM A;  2VRF A;  2JRE A;  1X6D A;  1GQ4 A;  2M0T A;  2R3Y A;  2DB5 A;  2VWR A;  3NCV A;  2KOH A;  1VB7 A;  1RZX A;  1WI4 A;  1FC6 A;  2QBW A;  1ZUB A;  4JOH A;  5E6P B;  2K1Z A;  2KYL A;  5GND A;  3PV4 A;  5E21 A;  5HED A;  2REY A;  3OTP A;  4Q2N A;  2DAZ A;  2EDP A;  2OMJ A;  2KOJ A;  3QE1 A;  1WHD A;  2Q3G A;  3I1E A;  4N6X A;  3GDU A;  2PNT A;  4Q6H A;  2DM8 A;  3E17 A;  1FC9 A;  4G69 A;  3EGG C;  4NMT A;  3GGE A;  2KL1 A;  3QIK A;  1X5N A;  3K50 A;  4K76 A;  3PV2 A;  4Z8J A;  3PV5 A;  4Q2O A;  1WHA A;  4Q6S A;  2VSP A;  1U39 A;  2AWU A;  5HEB A;  3SHW A;  4YYX A;  2PKU A;  4PQW A;  3CBX A;  2MX6 A;  2QKU A;  3HPM A;  3KDK A;  5HET A;  1TQ3 A;  2M0V A;  1W9Q A;  2D90 A;  1LCY A;  4JOK A;  3VQF A;  3CH8 A;  1RGW A;  5I7Z A;  1UEW A;  3O46 A;  4UU6 A;  1WF7 A;  3LNX A;  2OQS A;  2PKT A;  2PDZ A;  2IWQ A;  2I4S A;  1X45 A;  1WFG A;  4JOG A;  2HE2 A;  1UF1 A;  1UEQ A;  3WKM A;  2E7K A;  3BPU A;  2IWP A;  1NF3 C;  4EDJ A;  5HF4 A;  2HGA A;  2CSS A;  3NFK A;  4YDP A;  2EDV A;  1MC7 A;  4NXP A;  1OBY A;  4E35 A;  2I0I A;  2L97 A;  1W9E A;  2MHO A;  2OSG A;  4F8K A;  3KZE A;  4JOR A;  4Q3H A;  5HEY A;  4GHN A;  2CS5 A;  2W7R A;  1N7F A;  3KZD A;  5EYZ A;  1X8S A;  1GQ5 A;  1GM1 A;  1KWA A;  4JL7 A;  2EDZ A;  3DOR A;  2M0U A;  3HPK A;  2JIN A;  4FGM A;  1N99 A;  2EGO A;  2VZ5 A;  3GCO A;  2EV8 A;  1M5Z A;  1WH1 A;  1MFL A;  3CYY A;  2P3W A;  2EHR A;  4NMP A;  2YT8 A;  3B76 A;  3CS0 A;  5HJ1 A;  2M0Z A;  2CSJ A;  3STJ A;  1UJU A;  1Y7N A;  2AWW A;  2KRG A;  1QAV A;  2VPH A;  3GCN A;  2EEH A;  4UU5 A;  2QG1 A;  2I6V A;  2KJK A;  2F5Y A;  1WI2 A;  4KFW A;  3SUZ A;  5HDY A;  1Q3O A;  4Q2Q A;  1MFG A;  5B6L A;  2ZPL A;  2YT7 A;  3NFL A;  4MPA A;  4WYT A;  2RCZ A;  2FN5 A;  2X7Z A;  4OAJ A;  5DTH A;  1X5Q A;  4K6Y A;  2R4H A;  3DJ3 A; 
#chains in the Genus database with same CATH homology
 4JOP A;  2FNE A;  1PDR A;  1BE9 A;  1Q3P A;  1BFE A;  1N6E A;  2KPL A;  5FB8 C;  5EZ0 A;  3TSZ A;  1YBO A;  5HFB A;  2KAW A;  1WJL A;  2H2C A;  2YUB A;  4Q2P A;  1WFV A;  2W4F A;  2PA1 A;  1X9Z A;  2KV8 A;  1T2M A;  2KG2 A;  2OZF A;  4P2A B;  2OPG A;  4K75 A;  1XZ9 A;  2UZC A;  5G1E A;  2L4S A;  1N6F A;  1B8Q A;  5JXB A;  2WL7 A;  4OEO A;  2DLU A;  1U3B A;  2DJT A;  4NNL A;  4RI0 A;  1IU0 A;  4FLN A;  5FHT A;  3WKL A;  1UJV A;  4NMV A;  4IC6 A;  4JOE A;  1VAE A;  3JXT A;  1N6D A;  3K1R A;  4JOJ A;  1NTE A;  1FCF A;  3ID1 A;  1WG6 A;  2AWX A;  1KEF A;  5HFE A;  5D13 A;  3DJA A;  3SHU A;  2Q9V A;  2EXG A;  2KOM A;  4OEP A;  4E34 A;  4NMQ A;  1RY4 A;  2V90 A;  4L8N A;  1UEZ A;  3TMH A;  2RRM A;  2KBS A;  3MH6 A;  3CBY A;  1V5Q A;  2EGN A;  2JWE A;  3R0H A;  2K20 A;  2H2B A;  2G2L A;  2JSN A;  1UHP A;  3K82 A;  4REY A;  2G5M B;  1D5G A;  2DMZ A;  3OU0 A;  2QKV A;  2OGP A;  3ID3 A;  4NXR A;  2L4T A;  2DLS A;  3I4W A;  3RL8 A;  3QJN A;  3DJ1 A;  5HF1 A;  1Z86 A;  5HFF A;  4XHV A;  5E11 A;  1V6B A;  3NGH A;  1W9O A;  2KQF A;  1QLC A;  1U37 A;  1WIF A;  3ZRT A;  3SOE A;  2EAQ A;  2EJY A;  3PDZ A;  2KJD A;  4JJ0 A;  5IL9 A;  3KHF A;  2JIK A;  3AXA A;  3TSW A;  1Q7X A;  1QAU A;  1SOZ A;  1OBX A;  2FE5 A;  2LA8 A;  3CC0 A;  3FY5 A;  3GDS A;  5HFC A;  1KY9 A;  5ILB A;  1TP5 A;  3DIW A;  5E22 A;  4E3B A;  5H3J A;  4KFV A;  3ID4 A;  4NMO A;  3MH7 A;  2YUY A;  2OS6 A;  2JXO A;  2IWN A;  2OCS A;  2KA9 A;  3GAB A;  2M10 A;  4WYU A;  1VCW A;  1Y8T A;  5GLJ A;  5F67 A;  3QGL A;  4H11 A;  2JOA A;  5G1D A;  1SOT A;  1N7T A;  2IWO A;  2YTW A;  1UFX A;  2ZPM A;  1UM1 A;  3VQG A;  1R6J A;  2EEJ A;  4LMM A;  5F3X A;  1V62 A;  3PDV A;  1G9O A;  3R69 A;  2KJP A;  1IHJ A;  2LC6 A;  1OZI A;  2EGK A;  1RGR A;  1FC7 A;  2PZD A;  4NMR A;  1ZOK A;  3QJM A;  1OBZ A;  1IU2 A;  2I04 A;  1I92 A;  1V5L A;  1UEP A;  1Z87 A;  2I1N A;  4NMS A;  4AMH A;  5E1Y A;  3O5N A;  4Z33 A;  4JJ3 A;  4HOP B;  4P0C A;  4O06 A;  1I16 A;  2GZV A;  4GVD A;  3TSV A;  2D8I A;  2H3L A;  2QT5 A;  3HVQ C;  2V1W A;  1WF8 A;  1QAV B;  3R68 A;  2M3M A;  2D92 A;  2VSV A;  2BYG A;  2LUI A;  1VA8 A;  2DKR A;  5HFD A;  1UM7 A;  3QDO A;  1UIT A;  2LOB A;  3L4F D;  5B42 A;  2ENO A;  3EGH C;  4R2Z A;  3LNY A;  3QO6 A;  4JOF A;  1N7E A;  2QKT A;  4K72 A;  4K78 A;  1U38 A;  3PS4 A;  2DC2 A;  2Z9I A;  2FCF A;  3I18 A;  4NXQ A;  3ID2 A;  3RL7 A;  1L6O A;  1P1E A;  2LC7 A;  1UJD A;  2F0A A;  5A2P A;  2EEG A;  1VJ6 A;  2O2T A;  1TP3 A;  3SFJ A;  2JIL A;  2H3M A;  2GEF A;  1V1T A;  2EEI A;  2Z17 A;  3CBZ A;  3GJ9 A;  1P1D A;  2KPK A;  2HE4 A;  4GVC A;  1TE0 A;  3GSL A;  3RLE A;  3MH4 A;  1X5R A;  2I0L A;  3KDG A;  3GDV A;  2AIN A;  1K32 A;  4HOP A;  4NNM A;  2VRF A;  2JRE A;  1X6D A;  1GQ4 A;  2M0T A;  2R3Y A;  2DB5 A;  2VWR A;  3NCV A;  2KOH A;  1VB7 A;  1RZX A;  1WI4 A;  1FC6 A;  2QBW A;  1ZUB A;  4JOH A;  5E6P B;  2K1Z A;  2KYL A;  5GND A;  3PV4 A;  5E21 A;  5HED A;  2REY A;  3OTP A;  4Q2N A;  2DAZ A;  2EDP A;  2OMJ A;  2KOJ A;  3QE1 A;  1WHD A;  2Q3G A;  3I1E A;  4N6X A;  3GDU A;  2PNT A;  4Q6H A;  2DM8 A;  3E17 A;  1FC9 A;  4G69 A;  3EGG C;  4NMT A;  3GGE A;  2KL1 A;  3QIK A;  1X5N A;  3K50 A;  4K76 A;  3PV2 A;  4Z8J A;  3PV5 A;  4Q2O A;  1WHA A;  4Q6S A;  2VSP A;  1U39 A;  2AWU A;  5HEB A;  3SHW A;  4YYX A;  2PKU A;  4PQW A;  3CBX A;  2MX6 A;  2QKU A;  3HPM A;  3KDK A;  5HET A;  1TQ3 A;  2M0V A;  1W9Q A;  2D90 A;  1LCY A;  4JOK A;  3VQF A;  3CH8 A;  1RGW A;  5I7Z A;  1UEW A;  3O46 A;  4UU6 A;  1WF7 A;  3LNX A;  2OQS A;  2PKT A;  2PDZ A;  2IWQ A;  2I4S A;  1X45 A;  1WFG A;  4JOG A;  2HE2 A;  1UF1 A;  1UEQ A;  3WKM A;  2E7K A;  3BPU A;  2IWP A;  1NF3 C;  4EDJ A;  5HF4 A;  2HGA A;  2CSS A;  3NFK A;  4YDP A;  2EDV A;  1MC7 A;  4NXP A;  1OBY A;  4E35 A;  2I0I A;  2L97 A;  1W9E A;  2MHO A;  2OSG A;  4F8K A;  3KZE A;  4JOR A;  4Q3H A;  5HEY A;  4GHN A;  2CS5 A;  2W7R A;  1N7F A;  3KZD A;  5EYZ A;  1X8S A;  1GQ5 A;  1GM1 A;  1KWA A;  4JL7 A;  2EDZ A;  3DOR A;  2M0U A;  3HPK A;  2JIN A;  4FGM A;  1N99 A;  2EGO A;  2VZ5 A;  3GCO A;  2EV8 A;  1M5Z A;  1WH1 A;  1MFL A;  3CYY A;  2P3W A;  2EHR A;  4NMP A;  2YT8 A;  3B76 A;  3CS0 A;  5HJ1 A;  2M0Z A;  2CSJ A;  3STJ A;  1UJU A;  1Y7N A;  2AWW A;  2KRG A;  1QAV A;  2VPH A;  3GCN A;  2EEH A;  4UU5 A;  2QG1 A;  2I6V A;  2KJK A;  2F5Y A;  1WI2 A;  4KFW A;  3SUZ A;  5HDY A;  1Q3O A;  4Q2Q A;  1MFG A;  5B6L A;  2ZPL A;  2YT7 A;  3NFL A;  4MPA A;  4WYT A;  2RCZ A;  2FN5 A;  2X7Z A;  4OAJ A;  5DTH A;  1X5Q A;  4K6Y A;  2R4H A;  3DJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...