2DKRA

Solution structure of the pdz domain from human lin-7 homolog b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
93
structure length
93
Chain Sequence
GSSGSSGVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIN-7 homolog B
publication title Solution structure of the PDZ domain from human Lin-7 homolog B
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 9
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2006-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2dkrA00
1UITA 1BE9A 1X8SA 2JWEA 2QKTA 4Q6SA 2JXOA 4OEPA 3MH6A 2EEJA 4KFWA 2KOHA 3CBXA 4XHVA 2PKTA 1R6JA 1IU0A 2FE5A 3KZDA 2Z9IA 1N7EA 1Q3OA 3EGHC 2I0LA 2PNTA 2H2BA 1N6EA 1X5NA 4NMQA 1X5QA 2JIKA 2H2CA 2EHRA 2R4HA 3OTPA 2ENOA 1VB7A 5G1DA 2K20A 1RY4A 2YT7A 1NTEA 3SHUA 4P0CA 2I4SA 4YYXA 2DMZA 5H3JA 3TMHA 2V1WA 4FGMA 4JORA 3PDZA 1N7TA 2IWQA 4NMSA 2VZ5A 3SHWA 5HFFA 2V90A 3DJ3A 2VSVA 2FN5A 2I6VA 3DIWA 4WYUA 1K32A 2KJKA 3LNYA 4NMRA 5F3XA 3QO6A 4K75A 4NMPA 5HFBA 5JXBA 2KOJA 1ZUBA 2CSSA 3PV5A 5FHTA 2M10A 4K78A 2DLUA 1KEFA 2EDPA 2LC7A 2EEIA 3VQFA 3DJAA 2EDZA 1WIFA 4G69A 2IWPA 1I92A 2FCFA 2OCSA 2EDVA 2QG1A 2QKUA 2M3MA 3PV4A 1WI4A 2YT8A 1UEPA 2PZDA 1V6BA 1OZIA 3CH8A 2DAZA 2AWUA 1ZOKA 2P3WA 2X7ZA 1VA8A 5G1EA 1XZ9A 2OGPA 2DM8A 4IC6A 3TSWA 2HE4A 2G2LA 2JILA 2KPLA 4JOHA 2H3MA 1UJDA 3KHFA 3O46A 3B76A 2Q9VA 3R68A 1WHAA 4LMMA 1VAEA 3CBZA 4NXPA 3JXTA 3FY5A 5E1YA 1U3BA 1TP3A 3ID1A 1GM1A 1PDRA 2KQFA 2D92A 1W9OA 3VQGA 4UU5A 2RCZA 3QJNA 2EGKA 2OMJA 4HOPB 2F5YA 1IU2A 5HEBA 3R0HA 3GCNA 1UJVA 3BPUA 4JL7A 3WKMA 1UEZA 2R3YA 2QBWA 2KG2A 2KJDA 3SFJA 2F0AA 2EGNA 1RZXA 3STJA 5HEYA 4EDJA 4O06A 1L6OA 2KBSA 3SUZA 1V5LA 1LCYA 1OBYA 4R2ZA 3PDVA 3EGGC 1VCWA 2AINA 3ID2A 4Q2QA 1P1EA 4OEOA 1WH1A 3MH4A 1N6FA 4HOPA 1VJ6A 2EAQA 1GQ5A 4K76A 5EZ0A 3WKLA 2EGOA 2UZCA 3E17A 2JINA 3QGLA 4PQWA 5D13A 1UEWA 3PS4A 4GVDA 2QT5A 1FC9A 2OPGA 2IWOA 4JOJA 5DTHA 1MFLA 4GVCA 2OSGA 3HPKA 4K72A 2PKUA 5EYZA 2DB5A 2BYGA 1Z86A 2M0ZA 2EV8A 4YDPA 2Q3GA 2DKRA 2OS6A 4E3BA 1OBZA 1IHJA 5E11A 2KL1A 2W4FA 2L4TA 3GJ9A 1FCFA 1QLCA 1V62A 2LC6A 3K82A 2VRFA 3CYYA 3NFKA 3SOEA 1UF1A 3ID4A 1T2MA 4Q3HA 1BFEA 2DJTA 1WI2A 4MPAA 3L4FD 2LOBA 4NMOA 3K1RA 3HPMA 2DLSA 2L4SA 2OQSA 1UEQA 3ID3A 1SOZA 3HVQC 5E22A 1RGRA 5A2PA 3GSLA 2PA1A 1SOTA 1G9OA 4JOGA 3TSVA 2K1ZA 1U37A 1WF8A 3PV2A 3DJ1A 5HJ1A 1V5QA 2I1NA 1MC7A 5HDYA 1Q3PA 3I18A 1X6DA 4NMTA 1N99A 4K6YA 2YTWA 1D5GA 2ZPMA 1N7FA 1U39A 1Z87A 3ZRTA 2WL7A 3CBYA 1W9EA 4AMHA 4P2AB 2Z17A 3QDOA 2CSJA 1RGWA 2E7KA 2EXGA 1KWAA 2KPKA 3R69A 2AWWA 2D8IA 1N6DA 4N6XA 1TP5A 5FB8C 4Q6HA 5GLJA 4JOFA 4E34A 2REYA 2G5MB 2KV8A 1UM7A 3GCOA 2I0IA 3QE1A 3K50A 2M0UA 1QAUA 1QAVB 1TE0A 4UU6A 2VSPA 1UHPA 3MH7A 4OAJA 1M5ZA 2I04A 2JOAA 4NXQA 1KY9A 1WJLA 5HEDA 2EEGA 5HFEA 2EJYA 5GNDA 1FC7A 4GHNA 4NMVA 1UFXA 2YUYA 1YBOA 4JOEA 4JOKA 2FNEA 1UM1A 4Q2PA 5B6LA 4Z33A 2W7RA 2LUIA 2HGAA 2QKVA 4WYTA 5I7ZA 4H11A 2KAWA 4NNMA 1QAVA 3O5NA 2IWNA 5HF4A 3OU0A 1FC6A 3TSZA 2PDZA 3QJMA 2M0TA 2MHOA 1B8QA 3RLEA 3RL7A 2HE2A 3NFLA 2VWRA 1UJUA 2M0VA 2JREA 1X5RA 2OZFA 3I1EA 3QIKA 4JOPA 5HFDA 4Q2OA 1WF7A 5F67A 3GDVA 1V1TA 3DORA 5E6PB 2D90A 4NNLA 4Z8JA 2KOMA 4KFVA 1Q7XA 2KRGA 2VPHA 1P1DA 2RRMA 3KZEA 1MFGA 1WFGA 2EEHA 1U38A 2KJPA 5HETA 2YUBA 1GQ4A 3RL8A 1Y8TA 4Q2NA 1TQ3A 5E21A 1OBXA 3CC0A 1WHDA 3LNXA 2KYLA 4REYA 2H3LA 4RI0A 3I4WA 1WG6A 1X45A 1NF3C 2ZPLA 5HF1A 2LA8A 5HFCA 2DC2A 2L97A 3CS0A 3GDSA 1W9QA 2KA9A 2AWXA 2CS5A 3GGEA 2O2TA 3NGHA 2MX6A 1WFVA 1I16A 1Y7NA 4L8NA 4F8KA 3GDUA 4NXRA 4E35A 3AXAA 2GZVA
chains in the Genus database with same CATH superfamily
1UITA 1BE9A 1X8SA 2JWEA 2QKTA 4Q6SA 2JXOA 4OEPA 3MH6A 2EEJA 4KFWA 2KOHA 3CBXA 4XHVA 2PKTA 1R6JA 1IU0A 2FE5A 3KZDA 2Z9IA 1N7EA 1Q3OA 3EGHC 2I0LA 2PNTA 4FLNA 2H2BA 1N6EA 1X5NA 4NMQA 1X5QA 2JIKA 2H2CA 2EHRA 2R4HA 3OTPA 2ENOA 1VB7A 5G1DA 2K20A 1RY4A 1X9ZA 2YT7A 1NTEA 3SHUA 4P0CA 2I4SA 4YYXA 2DMZA 5H3JA 3TMHA 2V1WA 4FGMA 4JORA 3PDZA 1N7TA 2IWQA 4NMSA 2VZ5A 3SHWA 5HFFA 2V90A 3DJ3A 2VSVA 2FN5A 2I6VA 3DIWA 4WYUA 1K32A 2KJKA 3LNYA 4NMRA 5F3XA 3QO6A 4K75A 4NMPA 5HFBA 5JXBA 2KOJA 1ZUBA 2CSSA 3PV5A 5FHTA 2M10A 4K78A 2DLUA 1KEFA 2EDPA 2LC7A 2EEIA 3VQFA 3DJAA 2EDZA 1WIFA 4G69A 2IWPA 1I92A 2FCFA 3GABA 2OCSA 2EDVA 2QG1A 2QKUA 2M3MA 3PV4A 1WI4A 2YT8A 1UEPA 2PZDA 1V6BA 1OZIA 3CH8A 2DAZA 2AWUA 1ZOKA 2P3WA 2X7ZA 1VA8A 5G1EA 1XZ9A 2OGPA 2DM8A 4IC6A 3TSWA 2HE4A 2G2LA 2JILA 2KPLA 4JOHA 2H3MA 1UJDA 3KHFA 3O46A 3B76A 2Q9VA 3R68A 1WHAA 4LMMA 1VAEA 3CBZA 4NXPA 3JXTA 3FY5A 5E1YA 1U3BA 1TP3A 3ID1A 1GM1A 1PDRA 2KQFA 2D92A 1W9OA 3VQGA 4UU5A 2RCZA 3QJNA 2EGKA 2OMJA 4HOPB 2F5YA 1IU2A 5HEBA 3R0HA 3GCNA 1UJVA 3BPUA 4JL7A 3WKMA 1UEZA 2R3YA 2QBWA 2KG2A 2KJDA 3SFJA 2F0AA 2EGNA 1RZXA 3STJA 5HEYA 4EDJA 4O06A 1L6OA 2KBSA 3SUZA 1V5LA 1LCYA 1OBYA 4R2ZA 3PDVA 3EGGC 1VCWA 2AINA 3ID2A 4Q2QA 1P1EA 4OEOA 1WH1A 5B42A 3MH4A 1N6FA 4HOPA 1VJ6A 2EAQA 1GQ5A 4K76A 5EZ0A 3WKLA 2EGOA 5ILBA 2UZCA 3E17A 2JINA 3QGLA 4PQWA 5D13A 1UEWA 3PS4A 3NCVA 4GVDA 2QT5A 1FC9A 2OPGA 2IWOA 4JOJA 5DTHA 1MFLA 4GVCA 2OSGA 3HPKA 4K72A 2PKUA 5EYZA 2DB5A 2BYGA 1Z86A 2M0ZA 2EV8A 4YDPA 2Q3GA 2DKRA 2OS6A 4E3BA 1OBZA 1IHJA 5E11A 2KL1A 2W4FA 2L4TA 3GJ9A 1FCFA 1QLCA 1V62A 2LC6A 3K82A 2VRFA 3CYYA 3NFKA 3SOEA 1UF1A 3ID4A 1T2MA 4Q3HA 1BFEA 2DJTA 1WI2A 4MPAA 3L4FD 2LOBA 4NMOA 3K1RA 3HPMA 2DLSA 2L4SA 5IL9A 2OQSA 1UEQA 3ID3A 1SOZA 3HVQC 5E22A 1RGRA 5A2PA 3GSLA 2PA1A 1SOTA 1G9OA 4JOGA 3TSVA 2K1ZA 1U37A 1WF8A 3PV2A 3DJ1A 5HJ1A 1V5QA 2I1NA 1MC7A 2JSNA 5HDYA 1Q3PA 3I18A 1X6DA 4NMTA 1N99A 4K6YA 2YTWA 1D5GA 2ZPMA 1N7FA 1U39A 1Z87A 3ZRTA 2WL7A 3CBYA 1W9EA 4AMHA 4P2AB 2Z17A 3QDOA 2CSJA 1RGWA 2E7KA 2EXGA 1KWAA 2KPKA 3R69A 2AWWA 2D8IA 1N6DA 4N6XA 1TP5A 5FB8C 4Q6HA 5GLJA 4JOFA 4E34A 2REYA 2G5MB 2KV8A 1UM7A 3GCOA 2I0IA 3QE1A 3K50A 2M0UA 1QAUA 1QAVB 1TE0A 4UU6A 2VSPA 1UHPA 3MH7A 4OAJA 1M5ZA 2I04A 3KDKA 2JOAA 4NXQA 1KY9A 1WJLA 5HEDA 2EEGA 5HFEA 2EJYA 5GNDA 1FC7A 4GHNA 4NMVA 1UFXA 2YUYA 1YBOA 4JOEA 4JOKA 2FNEA 1UM1A 4Q2PA 5B6LA 4Z33A 2W7RA 4JJ3A 2LUIA 2HGAA 2QKVA 4WYTA 5I7ZA 4H11A 2KAWA 4NNMA 1QAVA 3O5NA 2IWNA 5HF4A 3OU0A 1FC6A 3TSZA 2PDZA 3QJMA 2M0TA 2MHOA 1B8QA 3RLEA 3RL7A 2HE2A 3NFLA 2VWRA 1UJUA 2M0VA 2JREA 1X5RA 2OZFA 3I1EA 3QIKA 4JOPA 5HFDA 4Q2OA 1WF7A 5F67A 3GDVA 1V1TA 3DORA 5E6PB 2D90A 4NNLA 3KDGA 4Z8JA 2KOMA 4KFVA 1Q7XA 2KRGA 2VPHA 1P1DA 2RRMA 3KZEA 1MFGA 1WFGA 2EEHA 1U38A 2KJPA 5HETA 2YUBA 1GQ4A 3RL8A 1Y8TA 4Q2NA 1TQ3A 5E21A 1OBXA 3CC0A 1WHDA 3LNXA 2KYLA 4REYA 2H3LA 4RI0A 3I4WA 1WG6A 1X45A 1NF3C 2ZPLA 5HF1A 2LA8A 5HFCA 2DC2A 2L97A 2GEFA 3CS0A 3GDSA 1W9QA 2KA9A 2AWXA 2CS5A 3GGEA 2O2TA 3NGHA 2MX6A 4JJ0A 1WFVA 1I16A 1Y7NA 4L8NA 4F8KA 3GDUA 4NXRA 4E35A 3AXAA 2GZVA
chains in the Genus database with same CATH topology
1UITA 1BE9A 1X8SA 2JWEA 2QKTA 4Q6SA 2JXOA 4OEPA 3MH6A 2EEJA 4KFWA 2KOHA 3CBXA 4XHVA 2PKTA 1R6JA 1IU0A 2FE5A 3KZDA 2Z9IA 1N7EA 1Q3OA 3EGHC 2I0LA 2PNTA 4FLNA 2H2BA 1N6EA 1X5NA 4NMQA 1X5QA 2JIKA 2H2CA 2EHRA 2R4HA 3OTPA 2ENOA 1VB7A 5G1DA 2K20A 1RY4A 1X9ZA 2YT7A 1NTEA 3SHUA 4P0CA 2I4SA 4YYXA 2DMZA 5H3JA 3TMHA 2V1WA 4FGMA 4JORA 3PDZA 1N7TA 2IWQA 4NMSA 2VZ5A 3SHWA 5HFFA 2V90A 3DJ3A 2VSVA 2FN5A 2I6VA 3DIWA 4WYUA 1K32A 2KJKA 3LNYA 4NMRA 5F3XA 3QO6A 4K75A 4NMPA 5HFBA 5JXBA 2KOJA 1ZUBA 2CSSA 3PV5A 5FHTA 2M10A 4K78A 2DLUA 1KEFA 2EDPA 2LC7A 2EEIA 3VQFA 3DJAA 2EDZA 1WIFA 4G69A 2IWPA 1I92A 2FCFA 3GABA 2OCSA 2EDVA 2QG1A 2QKUA 2M3MA 3PV4A 1WI4A 2YT8A 1UEPA 2PZDA 1V6BA 1OZIA 3CH8A 2DAZA 2AWUA 1ZOKA 2P3WA 2X7ZA 1VA8A 5G1EA 1XZ9A 2OGPA 2DM8A 4IC6A 3TSWA 2HE4A 2G2LA 2JILA 2KPLA 4JOHA 2H3MA 1UJDA 3KHFA 3O46A 3B76A 2Q9VA 3R68A 1WHAA 4LMMA 1VAEA 3CBZA 4NXPA 3JXTA 3FY5A 5E1YA 1U3BA 1TP3A 3ID1A 1GM1A 1PDRA 2KQFA 2D92A 1W9OA 3VQGA 4UU5A 2RCZA 3QJNA 2EGKA 2OMJA 4HOPB 2F5YA 1IU2A 5HEBA 3R0HA 3GCNA 1UJVA 3BPUA 4JL7A 3WKMA 1UEZA 2R3YA 2QBWA 2KG2A 2KJDA 3SFJA 2F0AA 2EGNA 1RZXA 3STJA 5HEYA 4EDJA 4O06A 1L6OA 2KBSA 3SUZA 1V5LA 1LCYA 1OBYA 4R2ZA 3PDVA 3EGGC 1VCWA 2AINA 3ID2A 4Q2QA 1P1EA 4OEOA 1WH1A 5B42A 3MH4A 1N6FA 4HOPA 1VJ6A 2EAQA 1GQ5A 4K76A 5EZ0A 3WKLA 2EGOA 5ILBA 2UZCA 3E17A 2JINA 3QGLA 4PQWA 5D13A 1UEWA 3PS4A 3NCVA 4GVDA 2QT5A 1FC9A 2OPGA 2IWOA 4JOJA 5DTHA 1MFLA 4GVCA 2OSGA 3HPKA 4K72A 2PKUA 5EYZA 2DB5A 2BYGA 1Z86A 2M0ZA 2EV8A 4YDPA 2Q3GA 2DKRA 2OS6A 4E3BA 1OBZA 1IHJA 5E11A 2KL1A 2W4FA 2L4TA 3GJ9A 1FCFA 1QLCA 1V62A 2LC6A 3K82A 2VRFA 3CYYA 3NFKA 3SOEA 1UF1A 3ID4A 1T2MA 4Q3HA 1BFEA 2DJTA 1WI2A 4MPAA 3L4FD 2LOBA 4NMOA 3K1RA 3HPMA 2DLSA 2L4SA 5IL9A 2OQSA 1UEQA 3ID3A 1SOZA 3HVQC 5E22A 1RGRA 5A2PA 3GSLA 2PA1A 1SOTA 1G9OA 4JOGA 3TSVA 2K1ZA 1U37A 1WF8A 3PV2A 3DJ1A 5HJ1A 1V5QA 2I1NA 1MC7A 2JSNA 5HDYA 1Q3PA 3I18A 1X6DA 4NMTA 1N99A 4K6YA 2YTWA 1D5GA 2ZPMA 1N7FA 1U39A 1Z87A 3ZRTA 2WL7A 3CBYA 1W9EA 4AMHA 4P2AB 2Z17A 3QDOA 2CSJA 1RGWA 2E7KA 2EXGA 1KWAA 2KPKA 3R69A 2AWWA 2D8IA 1N6DA 4N6XA 1TP5A 5FB8C 4Q6HA 5GLJA 4JOFA 4E34A 2REYA 2G5MB 2KV8A 1UM7A 3GCOA 2I0IA 3QE1A 3K50A 2M0UA 1QAUA 1QAVB 1TE0A 4UU6A 2VSPA 1UHPA 3MH7A 4OAJA 1M5ZA 2I04A 3KDKA 2JOAA 4NXQA 1KY9A 1WJLA 5HEDA 2EEGA 5HFEA 2EJYA 5GNDA 1FC7A 4GHNA 4NMVA 1UFXA 2YUYA 1YBOA 4JOEA 4JOKA 2FNEA 1UM1A 4Q2PA 5B6LA 4Z33A 2W7RA 4JJ3A 2LUIA 2HGAA 2QKVA 4WYTA 5I7ZA 4H11A 2KAWA 4NNMA 1QAVA 3O5NA 2IWNA 5HF4A 3OU0A 1FC6A 3TSZA 2PDZA 3QJMA 2M0TA 2MHOA 1B8QA 3RLEA 3RL7A 2HE2A 3NFLA 2VWRA 1UJUA 2M0VA 2JREA 1X5RA 2OZFA 3I1EA 3QIKA 4JOPA 5HFDA 4Q2OA 1WF7A 5F67A 3GDVA 1V1TA 3DORA 5E6PB 2D90A 4NNLA 3KDGA 4Z8JA 2KOMA 4KFVA 1Q7XA 2KRGA 2VPHA 1P1DA 2RRMA 3KZEA 1MFGA 1WFGA 2EEHA 1U38A 2KJPA 5HETA 2YUBA 1GQ4A 3RL8A 1Y8TA 4Q2NA 1TQ3A 5E21A 1OBXA 3CC0A 1WHDA 3LNXA 2KYLA 4REYA 2H3LA 4RI0A 3I4WA 1WG6A 1X45A 1NF3C 2ZPLA 5HF1A 2LA8A 5HFCA 2DC2A 2L97A 2GEFA 3CS0A 3GDSA 1W9QA 2KA9A 2AWXA 2CS5A 3GGEA 2O2TA 3NGHA 2MX6A 4JJ0A 1WFVA 1I16A 1Y7NA 4L8NA 4F8KA 3GDUA 4NXRA 4E35A 3AXAA 2GZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UIT A;  1BE9 A;  1X8S A;  2JWE A;  2QKT A;  4Q6S A;  2JXO A;  4OEP A;  3MH6 A;  2EEJ A;  4KFW A;  2KOH A;  3CBX A;  4XHV A;  2PKT A;  1R6J A;  1IU0 A;  2FE5 A;  3KZD A;  2Z9I A;  1N7E A;  1Q3O A;  3EGH C;  2I0L A;  2PNT A;  2H2B A;  1N6E A;  1X5N A;  4NMQ A;  1X5Q A;  2JIK A;  2H2C A;  2EHR A;  2R4H A;  3OTP A;  2ENO A;  1VB7 A;  5G1D A;  2K20 A;  1RY4 A;  2YT7 A;  1NTE A;  3SHU A;  4P0C A;  2I4S A;  4YYX A;  2DMZ A;  5H3J A;  3TMH A;  2V1W A;  4FGM A;  4JOR A;  3PDZ A;  1N7T A;  2IWQ A;  4NMS A;  2VZ5 A;  3SHW A;  5HFF A;  2V90 A;  3DJ3 A;  2VSV A;  2FN5 A;  2I6V A;  3DIW A;  4WYU A;  1K32 A;  2KJK A;  3LNY A;  4NMR A;  5F3X A;  3QO6 A;  4K75 A;  4NMP A;  5HFB A;  5JXB A;  2KOJ A;  1ZUB A;  2CSS A;  3PV5 A;  5FHT A;  2M10 A;  4K78 A;  2DLU A;  1KEF A;  2EDP A;  2LC7 A;  2EEI A;  3VQF A;  3DJA A;  2EDZ A;  1WIF A;  4G69 A;  2IWP A;  1I92 A;  2FCF A;  2OCS A;  2EDV A;  2QG1 A;  2QKU A;  2M3M A;  3PV4 A;  1WI4 A;  2YT8 A;  1UEP A;  2PZD A;  1V6B A;  1OZI A;  3CH8 A;  2DAZ A;  2AWU A;  1ZOK A;  2P3W A;  2X7Z A;  1VA8 A;  5G1E A;  1XZ9 A;  2OGP A;  2DM8 A;  4IC6 A;  3TSW A;  2HE4 A;  2G2L A;  2JIL A;  2KPL A;  4JOH A;  2H3M A;  1UJD A;  3KHF A;  3O46 A;  3B76 A;  2Q9V A;  3R68 A;  1WHA A;  4LMM A;  1VAE A;  3CBZ A;  4NXP A;  3JXT A;  3FY5 A;  5E1Y A;  1U3B A;  1TP3 A;  3ID1 A;  1GM1 A;  1PDR A;  2KQF A;  2D92 A;  1W9O A;  3VQG A;  4UU5 A;  2RCZ A;  3QJN A;  2EGK A;  2OMJ A;  4HOP B;  2F5Y A;  1IU2 A;  5HEB A;  3R0H A;  3GCN A;  1UJV A;  3BPU A;  4JL7 A;  3WKM A;  1UEZ A;  2R3Y A;  2QBW A;  2KG2 A;  2KJD A;  3SFJ A;  2F0A A;  2EGN A;  1RZX A;  3STJ A;  5HEY A;  4EDJ A;  4O06 A;  1L6O A;  2KBS A;  3SUZ A;  1V5L A;  1LCY A;  1OBY A;  4R2Z A;  3PDV A;  3EGG C;  1VCW A;  2AIN A;  3ID2 A;  4Q2Q A;  1P1E A;  4OEO A;  1WH1 A;  3MH4 A;  1N6F A;  4HOP A;  1VJ6 A;  2EAQ A;  1GQ5 A;  4K76 A;  5EZ0 A;  3WKL A;  2EGO A;  2UZC A;  3E17 A;  2JIN A;  3QGL A;  4PQW A;  5D13 A;  1UEW A;  3PS4 A;  4GVD A;  2QT5 A;  1FC9 A;  2OPG A;  2IWO A;  4JOJ A;  5DTH A;  1MFL A;  4GVC A;  2OSG A;  3HPK A;  4K72 A;  2PKU A;  5EYZ A;  2DB5 A;  2BYG A;  1Z86 A;  2M0Z A;  2EV8 A;  4YDP A;  2Q3G A;  2DKR A;  2OS6 A;  4E3B A;  1OBZ A;  1IHJ A;  5E11 A;  2KL1 A;  2W4F A;  2L4T A;  3GJ9 A;  1FCF A;  1QLC A;  1V62 A;  2LC6 A;  3K82 A;  2VRF A;  3CYY A;  3NFK A;  3SOE A;  1UF1 A;  3ID4 A;  1T2M A;  4Q3H A;  1BFE A;  2DJT A;  1WI2 A;  4MPA A;  3L4F D;  2LOB A;  4NMO A;  3K1R A;  3HPM A;  2DLS A;  2L4S A;  2OQS A;  1UEQ A;  3ID3 A;  1SOZ A;  3HVQ C;  5E22 A;  1RGR A;  5A2P A;  3GSL A;  2PA1 A;  1SOT A;  1G9O A;  4JOG A;  3TSV A;  2K1Z A;  1U37 A;  1WF8 A;  3PV2 A;  3DJ1 A;  5HJ1 A;  1V5Q A;  2I1N A;  1MC7 A;  5HDY A;  1Q3P A;  3I18 A;  1X6D A;  4NMT A;  1N99 A;  4K6Y A;  2YTW A;  1D5G A;  2ZPM A;  1N7F A;  1U39 A;  1Z87 A;  3ZRT A;  2WL7 A;  3CBY A;  1W9E A;  4AMH A;  4P2A B;  2Z17 A;  3QDO A;  2CSJ A;  1RGW A;  2E7K A;  2EXG A;  1KWA A;  2KPK A;  3R69 A;  2AWW A;  2D8I A;  1N6D A;  4N6X A;  1TP5 A;  5FB8 C;  4Q6H A;  5GLJ A;  4JOF A;  4E34 A;  2REY A;  2G5M B;  2KV8 A;  1UM7 A;  3GCO A;  2I0I A;  3QE1 A;  3K50 A;  2M0U A;  1QAU A;  1QAV B;  1TE0 A;  4UU6 A;  2VSP A;  1UHP A;  3MH7 A;  4OAJ A;  1M5Z A;  2I04 A;  2JOA A;  4NXQ A;  1KY9 A;  1WJL A;  5HED A;  2EEG A;  5HFE A;  2EJY A;  5GND A;  1FC7 A;  4GHN A;  4NMV A;  1UFX A;  2YUY A;  1YBO A;  4JOE A;  4JOK A;  2FNE A;  1UM1 A;  4Q2P A;  5B6L A;  4Z33 A;  2W7R A;  2LUI A;  2HGA A;  2QKV A;  4WYT A;  5I7Z A;  4H11 A;  2KAW A;  4NNM A;  1QAV A;  3O5N A;  2IWN A;  5HF4 A;  3OU0 A;  1FC6 A;  3TSZ A;  2PDZ A;  3QJM A;  2M0T A;  2MHO A;  1B8Q A;  3RLE A;  3RL7 A;  2HE2 A;  3NFL A;  2VWR A;  1UJU A;  2M0V A;  2JRE A;  1X5R A;  2OZF A;  3I1E A;  3QIK A;  4JOP A;  5HFD A;  4Q2O A;  1WF7 A;  5F67 A;  3GDV A;  1V1T A;  3DOR A;  5E6P B;  2D90 A;  4NNL A;  4Z8J A;  2KOM A;  4KFV A;  1Q7X A;  2KRG A;  2VPH A;  1P1D A;  2RRM A;  3KZE A;  1MFG A;  1WFG A;  2EEH A;  1U38 A;  2KJP A;  5HET A;  2YUB A;  1GQ4 A;  3RL8 A;  1Y8T A;  4Q2N A;  1TQ3 A;  5E21 A;  1OBX A;  3CC0 A;  1WHD A;  3LNX A;  2KYL A;  4REY A;  2H3L A;  4RI0 A;  3I4W A;  1WG6 A;  1X45 A;  1NF3 C;  2ZPL A;  5HF1 A;  2LA8 A;  5HFC A;  2DC2 A;  2L97 A;  3CS0 A;  3GDS A;  1W9Q A;  2KA9 A;  2AWX A;  2CS5 A;  3GGE A;  2O2T A;  3NGH A;  2MX6 A;  1WFV A;  1I16 A;  1Y7N A;  4L8N A;  4F8K A;  3GDU A;  4NXR A;  4E35 A;  3AXA A;  2GZV A; 
#chains in the Genus database with same CATH topology
 1UIT A;  1BE9 A;  1X8S A;  2JWE A;  2QKT A;  4Q6S A;  2JXO A;  4OEP A;  3MH6 A;  2EEJ A;  4KFW A;  2KOH A;  3CBX A;  4XHV A;  2PKT A;  1R6J A;  1IU0 A;  2FE5 A;  3KZD A;  2Z9I A;  1N7E A;  1Q3O A;  3EGH C;  2I0L A;  2PNT A;  4FLN A;  2H2B A;  1N6E A;  1X5N A;  4NMQ A;  1X5Q A;  2JIK A;  2H2C A;  2EHR A;  2R4H A;  3OTP A;  2ENO A;  1VB7 A;  5G1D A;  2K20 A;  1RY4 A;  1X9Z A;  2YT7 A;  1NTE A;  3SHU A;  4P0C A;  2I4S A;  4YYX A;  2DMZ A;  5H3J A;  3TMH A;  2V1W A;  4FGM A;  4JOR A;  3PDZ A;  1N7T A;  2IWQ A;  4NMS A;  2VZ5 A;  3SHW A;  5HFF A;  2V90 A;  3DJ3 A;  2VSV A;  2FN5 A;  2I6V A;  3DIW A;  4WYU A;  1K32 A;  2KJK A;  3LNY A;  4NMR A;  5F3X A;  3QO6 A;  4K75 A;  4NMP A;  5HFB A;  5JXB A;  2KOJ A;  1ZUB A;  2CSS A;  3PV5 A;  5FHT A;  2M10 A;  4K78 A;  2DLU A;  1KEF A;  2EDP A;  2LC7 A;  2EEI A;  3VQF A;  3DJA A;  2EDZ A;  1WIF A;  4G69 A;  2IWP A;  1I92 A;  2FCF A;  3GAB A;  2OCS A;  2EDV A;  2QG1 A;  2QKU A;  2M3M A;  3PV4 A;  1WI4 A;  2YT8 A;  1UEP A;  2PZD A;  1V6B A;  1OZI A;  3CH8 A;  2DAZ A;  2AWU A;  1ZOK A;  2P3W A;  2X7Z A;  1VA8 A;  5G1E A;  1XZ9 A;  2OGP A;  2DM8 A;  4IC6 A;  3TSW A;  2HE4 A;  2G2L A;  2JIL A;  2KPL A;  4JOH A;  2H3M A;  1UJD A;  3KHF A;  3O46 A;  3B76 A;  2Q9V A;  3R68 A;  1WHA A;  4LMM A;  1VAE A;  3CBZ A;  4NXP A;  3JXT A;  3FY5 A;  5E1Y A;  1U3B A;  1TP3 A;  3ID1 A;  1GM1 A;  1PDR A;  2KQF A;  2D92 A;  1W9O A;  3VQG A;  4UU5 A;  2RCZ A;  3QJN A;  2EGK A;  2OMJ A;  4HOP B;  2F5Y A;  1IU2 A;  5HEB A;  3R0H A;  3GCN A;  1UJV A;  3BPU A;  4JL7 A;  3WKM A;  1UEZ A;  2R3Y A;  2QBW A;  2KG2 A;  2KJD A;  3SFJ A;  2F0A A;  2EGN A;  1RZX A;  3STJ A;  5HEY A;  4EDJ A;  4O06 A;  1L6O A;  2KBS A;  3SUZ A;  1V5L A;  1LCY A;  1OBY A;  4R2Z A;  3PDV A;  3EGG C;  1VCW A;  2AIN A;  3ID2 A;  4Q2Q A;  1P1E A;  4OEO A;  1WH1 A;  5B42 A;  3MH4 A;  1N6F A;  4HOP A;  1VJ6 A;  2EAQ A;  1GQ5 A;  4K76 A;  5EZ0 A;  3WKL A;  2EGO A;  5ILB A;  2UZC A;  3E17 A;  2JIN A;  3QGL A;  4PQW A;  5D13 A;  1UEW A;  3PS4 A;  3NCV A;  4GVD A;  2QT5 A;  1FC9 A;  2OPG A;  2IWO A;  4JOJ A;  5DTH A;  1MFL A;  4GVC A;  2OSG A;  3HPK A;  4K72 A;  2PKU A;  5EYZ A;  2DB5 A;  2BYG A;  1Z86 A;  2M0Z A;  2EV8 A;  4YDP A;  2Q3G A;  2DKR A;  2OS6 A;  4E3B A;  1OBZ A;  1IHJ A;  5E11 A;  2KL1 A;  2W4F A;  2L4T A;  3GJ9 A;  1FCF A;  1QLC A;  1V62 A;  2LC6 A;  3K82 A;  2VRF A;  3CYY A;  3NFK A;  3SOE A;  1UF1 A;  3ID4 A;  1T2M A;  4Q3H A;  1BFE A;  2DJT A;  1WI2 A;  4MPA A;  3L4F D;  2LOB A;  4NMO A;  3K1R A;  3HPM A;  2DLS A;  2L4S A;  5IL9 A;  2OQS A;  1UEQ A;  3ID3 A;  1SOZ A;  3HVQ C;  5E22 A;  1RGR A;  5A2P A;  3GSL A;  2PA1 A;  1SOT A;  1G9O A;  4JOG A;  3TSV A;  2K1Z A;  1U37 A;  1WF8 A;  3PV2 A;  3DJ1 A;  5HJ1 A;  1V5Q A;  2I1N A;  1MC7 A;  2JSN A;  5HDY A;  1Q3P A;  3I18 A;  1X6D A;  4NMT A;  1N99 A;  4K6Y A;  2YTW A;  1D5G A;  2ZPM A;  1N7F A;  1U39 A;  1Z87 A;  3ZRT A;  2WL7 A;  3CBY A;  1W9E A;  4AMH A;  4P2A B;  2Z17 A;  3QDO A;  2CSJ A;  1RGW A;  2E7K A;  2EXG A;  1KWA A;  2KPK A;  3R69 A;  2AWW A;  2D8I A;  1N6D A;  4N6X A;  1TP5 A;  5FB8 C;  4Q6H A;  5GLJ A;  4JOF A;  4E34 A;  2REY A;  2G5M B;  2KV8 A;  1UM7 A;  3GCO A;  2I0I A;  3QE1 A;  3K50 A;  2M0U A;  1QAU A;  1QAV B;  1TE0 A;  4UU6 A;  2VSP A;  1UHP A;  3MH7 A;  4OAJ A;  1M5Z A;  2I04 A;  3KDK A;  2JOA A;  4NXQ A;  1KY9 A;  1WJL A;  5HED A;  2EEG A;  5HFE A;  2EJY A;  5GND A;  1FC7 A;  4GHN A;  4NMV A;  1UFX A;  2YUY A;  1YBO A;  4JOE A;  4JOK A;  2FNE A;  1UM1 A;  4Q2P A;  5B6L A;  4Z33 A;  2W7R A;  4JJ3 A;  2LUI A;  2HGA A;  2QKV A;  4WYT A;  5I7Z A;  4H11 A;  2KAW A;  4NNM A;  1QAV A;  3O5N A;  2IWN A;  5HF4 A;  3OU0 A;  1FC6 A;  3TSZ A;  2PDZ A;  3QJM A;  2M0T A;  2MHO A;  1B8Q A;  3RLE A;  3RL7 A;  2HE2 A;  3NFL A;  2VWR A;  1UJU A;  2M0V A;  2JRE A;  1X5R A;  2OZF A;  3I1E A;  3QIK A;  4JOP A;  5HFD A;  4Q2O A;  1WF7 A;  5F67 A;  3GDV A;  1V1T A;  3DOR A;  5E6P B;  2D90 A;  4NNL A;  3KDG A;  4Z8J A;  2KOM A;  4KFV A;  1Q7X A;  2KRG A;  2VPH A;  1P1D A;  2RRM A;  3KZE A;  1MFG A;  1WFG A;  2EEH A;  1U38 A;  2KJP A;  5HET A;  2YUB A;  1GQ4 A;  3RL8 A;  1Y8T A;  4Q2N A;  1TQ3 A;  5E21 A;  1OBX A;  3CC0 A;  1WHD A;  3LNX A;  2KYL A;  4REY A;  2H3L A;  4RI0 A;  3I4W A;  1WG6 A;  1X45 A;  1NF3 C;  2ZPL A;  5HF1 A;  2LA8 A;  5HFC A;  2DC2 A;  2L97 A;  2GEF A;  3CS0 A;  3GDS A;  1W9Q A;  2KA9 A;  2AWX A;  2CS5 A;  3GGE A;  2O2T A;  3NGH A;  2MX6 A;  4JJ0 A;  1WFV A;  1I16 A;  1Y7N A;  4L8N A;  4F8K A;  3GDU A;  4NXR A;  4E35 A;  3AXA A;  2GZV A; 
#chains in the Genus database with same CATH homology
 1UIT A;  1BE9 A;  1X8S A;  2JWE A;  2QKT A;  4Q6S A;  2JXO A;  4OEP A;  3MH6 A;  2EEJ A;  4KFW A;  2KOH A;  3CBX A;  4XHV A;  2PKT A;  1R6J A;  1IU0 A;  2FE5 A;  3KZD A;  2Z9I A;  1N7E A;  1Q3O A;  3EGH C;  2I0L A;  2PNT A;  4FLN A;  2H2B A;  1N6E A;  1X5N A;  4NMQ A;  1X5Q A;  2JIK A;  2H2C A;  2EHR A;  2R4H A;  3OTP A;  2ENO A;  1VB7 A;  5G1D A;  2K20 A;  1RY4 A;  1X9Z A;  2YT7 A;  1NTE A;  3SHU A;  4P0C A;  2I4S A;  4YYX A;  2DMZ A;  5H3J A;  3TMH A;  2V1W A;  4FGM A;  4JOR A;  3PDZ A;  1N7T A;  2IWQ A;  4NMS A;  2VZ5 A;  3SHW A;  5HFF A;  2V90 A;  3DJ3 A;  2VSV A;  2FN5 A;  2I6V A;  3DIW A;  4WYU A;  1K32 A;  2KJK A;  3LNY A;  4NMR A;  5F3X A;  3QO6 A;  4K75 A;  4NMP A;  5HFB A;  5JXB A;  2KOJ A;  1ZUB A;  2CSS A;  3PV5 A;  5FHT A;  2M10 A;  4K78 A;  2DLU A;  1KEF A;  2EDP A;  2LC7 A;  2EEI A;  3VQF A;  3DJA A;  2EDZ A;  1WIF A;  4G69 A;  2IWP A;  1I92 A;  2FCF A;  3GAB A;  2OCS A;  2EDV A;  2QG1 A;  2QKU A;  2M3M A;  3PV4 A;  1WI4 A;  2YT8 A;  1UEP A;  2PZD A;  1V6B A;  1OZI A;  3CH8 A;  2DAZ A;  2AWU A;  1ZOK A;  2P3W A;  2X7Z A;  1VA8 A;  5G1E A;  1XZ9 A;  2OGP A;  2DM8 A;  4IC6 A;  3TSW A;  2HE4 A;  2G2L A;  2JIL A;  2KPL A;  4JOH A;  2H3M A;  1UJD A;  3KHF A;  3O46 A;  3B76 A;  2Q9V A;  3R68 A;  1WHA A;  4LMM A;  1VAE A;  3CBZ A;  4NXP A;  3JXT A;  3FY5 A;  5E1Y A;  1U3B A;  1TP3 A;  3ID1 A;  1GM1 A;  1PDR A;  2KQF A;  2D92 A;  1W9O A;  3VQG A;  4UU5 A;  2RCZ A;  3QJN A;  2EGK A;  2OMJ A;  4HOP B;  2F5Y A;  1IU2 A;  5HEB A;  3R0H A;  3GCN A;  1UJV A;  3BPU A;  4JL7 A;  3WKM A;  1UEZ A;  2R3Y A;  2QBW A;  2KG2 A;  2KJD A;  3SFJ A;  2F0A A;  2EGN A;  1RZX A;  3STJ A;  5HEY A;  4EDJ A;  4O06 A;  1L6O A;  2KBS A;  3SUZ A;  1V5L A;  1LCY A;  1OBY A;  4R2Z A;  3PDV A;  3EGG C;  1VCW A;  2AIN A;  3ID2 A;  4Q2Q A;  1P1E A;  4OEO A;  1WH1 A;  5B42 A;  3MH4 A;  1N6F A;  4HOP A;  1VJ6 A;  2EAQ A;  1GQ5 A;  4K76 A;  5EZ0 A;  3WKL A;  2EGO A;  5ILB A;  2UZC A;  3E17 A;  2JIN A;  3QGL A;  4PQW A;  5D13 A;  1UEW A;  3PS4 A;  3NCV A;  4GVD A;  2QT5 A;  1FC9 A;  2OPG A;  2IWO A;  4JOJ A;  5DTH A;  1MFL A;  4GVC A;  2OSG A;  3HPK A;  4K72 A;  2PKU A;  5EYZ A;  2DB5 A;  2BYG A;  1Z86 A;  2M0Z A;  2EV8 A;  4YDP A;  2Q3G A;  2DKR A;  2OS6 A;  4E3B A;  1OBZ A;  1IHJ A;  5E11 A;  2KL1 A;  2W4F A;  2L4T A;  3GJ9 A;  1FCF A;  1QLC A;  1V62 A;  2LC6 A;  3K82 A;  2VRF A;  3CYY A;  3NFK A;  3SOE A;  1UF1 A;  3ID4 A;  1T2M A;  4Q3H A;  1BFE A;  2DJT A;  1WI2 A;  4MPA A;  3L4F D;  2LOB A;  4NMO A;  3K1R A;  3HPM A;  2DLS A;  2L4S A;  5IL9 A;  2OQS A;  1UEQ A;  3ID3 A;  1SOZ A;  3HVQ C;  5E22 A;  1RGR A;  5A2P A;  3GSL A;  2PA1 A;  1SOT A;  1G9O A;  4JOG A;  3TSV A;  2K1Z A;  1U37 A;  1WF8 A;  3PV2 A;  3DJ1 A;  5HJ1 A;  1V5Q A;  2I1N A;  1MC7 A;  2JSN A;  5HDY A;  1Q3P A;  3I18 A;  1X6D A;  4NMT A;  1N99 A;  4K6Y A;  2YTW A;  1D5G A;  2ZPM A;  1N7F A;  1U39 A;  1Z87 A;  3ZRT A;  2WL7 A;  3CBY A;  1W9E A;  4AMH A;  4P2A B;  2Z17 A;  3QDO A;  2CSJ A;  1RGW A;  2E7K A;  2EXG A;  1KWA A;  2KPK A;  3R69 A;  2AWW A;  2D8I A;  1N6D A;  4N6X A;  1TP5 A;  5FB8 C;  4Q6H A;  5GLJ A;  4JOF A;  4E34 A;  2REY A;  2G5M B;  2KV8 A;  1UM7 A;  3GCO A;  2I0I A;  3QE1 A;  3K50 A;  2M0U A;  1QAU A;  1QAV B;  1TE0 A;  4UU6 A;  2VSP A;  1UHP A;  3MH7 A;  4OAJ A;  1M5Z A;  2I04 A;  3KDK A;  2JOA A;  4NXQ A;  1KY9 A;  1WJL A;  5HED A;  2EEG A;  5HFE A;  2EJY A;  5GND A;  1FC7 A;  4GHN A;  4NMV A;  1UFX A;  2YUY A;  1YBO A;  4JOE A;  4JOK A;  2FNE A;  1UM1 A;  4Q2P A;  5B6L A;  4Z33 A;  2W7R A;  4JJ3 A;  2LUI A;  2HGA A;  2QKV A;  4WYT A;  5I7Z A;  4H11 A;  2KAW A;  4NNM A;  1QAV A;  3O5N A;  2IWN A;  5HF4 A;  3OU0 A;  1FC6 A;  3TSZ A;  2PDZ A;  3QJM A;  2M0T A;  2MHO A;  1B8Q A;  3RLE A;  3RL7 A;  2HE2 A;  3NFL A;  2VWR A;  1UJU A;  2M0V A;  2JRE A;  1X5R A;  2OZF A;  3I1E A;  3QIK A;  4JOP A;  5HFD A;  4Q2O A;  1WF7 A;  5F67 A;  3GDV A;  1V1T A;  3DOR A;  5E6P B;  2D90 A;  4NNL A;  3KDG A;  4Z8J A;  2KOM A;  4KFV A;  1Q7X A;  2KRG A;  2VPH A;  1P1D A;  2RRM A;  3KZE A;  1MFG A;  1WFG A;  2EEH A;  1U38 A;  2KJP A;  5HET A;  2YUB A;  1GQ4 A;  3RL8 A;  1Y8T A;  4Q2N A;  1TQ3 A;  5E21 A;  1OBX A;  3CC0 A;  1WHD A;  3LNX A;  2KYL A;  4REY A;  2H3L A;  4RI0 A;  3I4W A;  1WG6 A;  1X45 A;  1NF3 C;  2ZPL A;  5HF1 A;  2LA8 A;  5HFC A;  2DC2 A;  2L97 A;  2GEF A;  3CS0 A;  3GDS A;  1W9Q A;  2KA9 A;  2AWX A;  2CS5 A;  3GGE A;  2O2T A;  3NGH A;  2MX6 A;  4JJ0 A;  1WFV A;  1I16 A;  1Y7N A;  4L8N A;  4F8K A;  3GDU A;  4NXR A;  4E35 A;  3AXA A;  2GZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...