2I04A

X-ray crystal structure of magi-1 pdz1 bound to the c-terminal peptide of hpv18 e6
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
85
Chain Sequence
SIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Membrane-associated guanylate kinase, WW and PDZ domain-cont
publication title Structures of a Human Papillomavirus (HPV) E6 Polypeptide Bound to MAGUK Proteins: Mechanisms of Targeting Tumor Suppressors by a High-Risk HPV Oncoprotein.
pubmed doi rcsb
source organism Mus musculus
molecule tags Peptide binding protein
total genus 16
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2i04A00
1TP3A 2VWRA 3KZDA 3R0HA 2D92A 3ID4A 1W9QA 4NXQA 1NTEA 1P1EA 1WIFA 2OCSA 1MC7A 3I18A 4E3BA 3CBXA 2LC6A 2AINA 3TSZA 5I7ZA 2AWUA 2JINA 3KHFA 2YUBA 2M10A 2VZ5A 4NMSA 2AWXA 3STJA 3I4WA 2EEHA 2IWQA 3I1EA 3ZRTA 5HFFA 2M0UA 4OAJA 5A2PA 2EDPA 4K76A 1P1DA 2MHOA 2KAWA 2EEGA 4KFVA 5D13A 1K32A 2X7ZA 1LCYA 1WHAA 1B8QA 1MFGA 1R6JA 5HDYA 5HF4A 2KOMA 2QKUA 2G5MB 5HFDA 3SFJA 4JORA 1I16A 1U39A 2KV8A 1M5ZA 2H3MA 2GZVA 2QKTA 2L4TA 3VQFA 3NGHA 2EDZA 2KRGA 3GSLA 4Q2QA 2KPLA 2E7KA 2L4SA 1UF1A 4E34A 4K6YA 1TQ3A 3MH6A 4N6XA 1U38A 2CSSA 2I0IA 1V1TA 1Z86A 2OGPA 3PV5A 2FE5A 4K78A 1UM1A 2OPGA 1WF8A 2EEIA 2M3MA 4JOHA 2JWEA 3DJ1A 2KL1A 3GCNA 1QAVB 1FCFA 4R2ZA 3K50A 4NNLA 4WYUA 4XHVA 1OBXA 5DTHA 1NF3C 4YDPA 2KOJA 1PDRA 4JOGA 2H3LA 2YUYA 4JOPA 4NXRA 2F5YA 1KY9A 2K1ZA 2KYLA 3ID3A 1X8SA 3FY5A 3CBYA 3QGLA 4NMOA 2V1WA 4NMQA 1G9OA 3R69A 4P0CA 4UU6A 1GQ5A 2EJYA 4GVCA 3RL8A 1N99A 1U3BA 4L8NA 3OU0A 3E17A 4K72A 4Q3HA 1UFXA 2R4HA 3CH8A 4GVDA 1WF7A 5EYZA 3PV4A 1Q3OA 4MPAA 5HJ1A 4NMRA 2DAZA 2ENOA 3DJ3A 2QKVA 4IC6A 1V6BA 4JOKA 1MFLA 3PDVA 2LA8A 1X5NA 3ID1A 3RL7A 5G1DA 2KPKA 4REYA 1VB7A 1W9EA 2QG1A 1RY4A 3DIWA 5E6PB 1QAUA 2YT8A 2L97A 4K75A 1N7EA 1GM1A 3NFKA 4YYXA 2YTWA 2ZPMA 5HEBA 4JOFA 5HFBA 2EHRA 1Z87A 2MX6A 1WH1A 3HPMA 1UJVA 4NXPA 1N7FA 1TP5A 2EGKA 2LOBA 1KWAA 1Y8TA 1WG6A 3TSVA 2DC2A 1RGRA 2KJKA 2DM8A 3PS4A 5F3XA 1QLCA 4HOPA 2R3YA 1TE0A 1FC7A 2JOAA 2EDVA 3K1RA 4OEOA 3PV2A 3HPKA 2VRFA 3DORA 2D8IA 5JXBA 2M0ZA 1ZOKA 4Q6SA 3CS0A 3HVQC 2DB5A 2PA1A 3GDUA 5FB8C 1YBOA 5EZ0A 1UM7A 5B6LA 4JOJA 2CS5A 3OTPA 2EGNA 3VQGA 2OMJA 2F0AA 2VSVA 5GNDA 5HEYA 4NMVA 2DJTA 2H2BA 1WJLA 1IU2A 2EAQA 4OEPA 1UEWA 5HFCA 2EV8A 4NNMA 5E11A 1U37A 1UEQA 4H11A 3GDVA 3AXAA 1SOTA 1UEZA 1WFVA 3EGHC 4UU5A 2ZPLA 5HFEA 3MH4A 1VCWA 2JXOA 1KEFA 1VJ6A 1ZUBA 4PQWA 2EXGA 3QE1A 2FNEA 2PKTA 1OBZA 1X5QA 2AWWA 1GQ4A 3SUZA 4KFWA 3B76A 2DMZA 1V5QA 1N7TA 4O06A 2YT7A 2PDZA 2OQSA 2I4SA 5E1YA 2KQFA 2V90A 3K82A 2QT5A 2G2LA 4JL7A 1X6DA 5G1EA 2P3WA 5E22A 2I0LA 4AMHA 4JOEA 2LC7A 2WL7A 2UZCA 2HGAA 3QDOA 1L6OA 2JREA 3WKLA 1WFGA 4HOPB 1QAVA 4E35A 2PNTA 3RLEA 4Q2OA 2Z9IA 2IWNA 2PZDA 4LMMA 4Q2NA 5HF1A 3EGGC 4RI0A 1UJUA 1OBYA 4FGMA 2H2CA 2DKRA 2HE2A 1XZ9A 2REYA 1VA8A 2DLSA 2QBWA 2HE4A 2O2TA 5HEDA 1X5RA 2EEJA 1D5GA 2I6VA 2LUIA 2RRMA 1WI2A 5E21A 3KZEA 4Q2PA 1N6EA 1RGWA 3DJAA 2DLUA 4EDJA 1N6DA 3JXTA 1UEPA 1BE9A 2Z17A 1UHPA 3ID2A 2VPHA 4Z8JA 2KBSA 1V62A 3SHWA 3GJ9A 2M0TA 3MH7A 3PDZA 2K20A 2M0VA 1BFEA 1RZXA 2KG2A 3CC0A 3QO6A 3LNXA 2I1NA 5F67A 2KJDA 3QJNA 4WYTA 1UJDA 1WI4A 5H3JA 3TMHA 1I92A 1IU0A 2BYGA 3GGEA 1Y7NA 2OS6A 2D90A 4Q6HA 3R68A 1W9OA 3TSWA 2CSJA 1T2MA 2KA9A 2W4FA 2RCZA 3QIKA 2KOHA 5GLJA 2OSGA 4G69A 1UITA 4Z33A 1N6FA 1Q7XA 5FHTA 2JILA 1VAEA 1IHJA 3WKMA 2I04A 2IWOA 4NMTA 3NFLA 1OZIA 2VSPA 3SHUA 2JIKA 2IWPA 2FN5A 2Q9VA 2KJPA 1SOZA 2FCFA 3QJMA 3GDSA 1V5LA 5HETA 1WHDA 1FC6A 1X45A 3O5NA 3CYYA 1Q3PA 4GHNA 4NMPA 4P2AB 3BPUA 1FC9A 2OZFA 3O46A 2W7RA 2EGOA 2PKUA 2Q3GA 4F8KA 3LNYA 3SOEA 3L4FD 3CBZA 3GCOA
chains in the Genus database with same CATH superfamily
1TP3A 2VWRA 3KZDA 3R0HA 2D92A 3ID4A 1W9QA 4NXQA 1NTEA 1P1EA 1WIFA 2OCSA 1MC7A 3I18A 4E3BA 3CBXA 2LC6A 2AINA 3TSZA 5I7ZA 2AWUA 2JINA 3KHFA 2YUBA 2M10A 2VZ5A 4NMSA 2AWXA 3STJA 3I4WA 2EEHA 2IWQA 3I1EA 3ZRTA 5HFFA 2M0UA 4OAJA 5A2PA 2EDPA 4K76A 1P1DA 4JJ3A 2MHOA 2KAWA 2EEGA 4KFVA 5D13A 1K32A 2X7ZA 1LCYA 1WHAA 1B8QA 1MFGA 1R6JA 5HDYA 5HF4A 2KOMA 2QKUA 2G5MB 5HFDA 3SFJA 4JORA 1I16A 1U39A 2KV8A 1M5ZA 2H3MA 2GZVA 2QKTA 2L4TA 3VQFA 3NGHA 2EDZA 2KRGA 3GSLA 4Q2QA 2KPLA 2E7KA 2L4SA 1UF1A 4E34A 4K6YA 1TQ3A 3MH6A 1X9ZA 4N6XA 1U38A 2CSSA 2I0IA 1V1TA 1Z86A 2OGPA 3PV5A 2FE5A 4K78A 1UM1A 2OPGA 1WF8A 2EEIA 2M3MA 4JOHA 2JWEA 3DJ1A 2KL1A 3GCNA 1QAVB 3NCVA 1FCFA 4R2ZA 3K50A 3KDKA 4NNLA 4WYUA 4XHVA 1OBXA 5DTHA 1NF3C 4YDPA 2KOJA 1PDRA 4JOGA 2H3LA 2YUYA 4JOPA 4NXRA 2F5YA 1KY9A 2K1ZA 2KYLA 3ID3A 1X8SA 3FY5A 3CBYA 3QGLA 4NMOA 2V1WA 4NMQA 1G9OA 3R69A 4P0CA 4UU6A 1GQ5A 2EJYA 4GVCA 3RL8A 1N99A 1U3BA 4L8NA 3OU0A 3E17A 4K72A 4Q3HA 1UFXA 2R4HA 3CH8A 4GVDA 1WF7A 4JJ0A 5EYZA 3PV4A 1Q3OA 4MPAA 5HJ1A 4NMRA 2DAZA 2ENOA 3DJ3A 2QKVA 4IC6A 1V6BA 4JOKA 1MFLA 3PDVA 2LA8A 1X5NA 3ID1A 3RL7A 5G1DA 2KPKA 4REYA 1VB7A 1W9EA 2QG1A 1RY4A 3DIWA 5E6PB 1QAUA 2YT8A 2L97A 4K75A 1N7EA 1GM1A 3NFKA 4YYXA 2YTWA 2ZPMA 5HEBA 4JOFA 5HFBA 2EHRA 1Z87A 2MX6A 1WH1A 3HPMA 1UJVA 4NXPA 1N7FA 1TP5A 2EGKA 2LOBA 1KWAA 1Y8TA 1WG6A 3TSVA 2DC2A 1RGRA 2KJKA 2DM8A 3PS4A 5F3XA 1QLCA 4HOPA 2R3YA 1TE0A 1FC7A 2JOAA 2EDVA 3K1RA 4OEOA 3PV2A 3HPKA 2GEFA 2VRFA 3DORA 2D8IA 5JXBA 2M0ZA 1ZOKA 4Q6SA 3CS0A 3HVQC 5IL9A 2JSNA 2DB5A 2PA1A 3GDUA 5FB8C 1YBOA 5EZ0A 1UM7A 5B6LA 4JOJA 2CS5A 3OTPA 2EGNA 3VQGA 2OMJA 2F0AA 2VSVA 5GNDA 5HEYA 4NMVA 2DJTA 3KDGA 2H2BA 1WJLA 1IU2A 2EAQA 4OEPA 1UEWA 5HFCA 2EV8A 4NNMA 5E11A 1U37A 1UEQA 4H11A 3GDVA 3AXAA 1SOTA 1UEZA 1WFVA 3EGHC 4UU5A 2ZPLA 5HFEA 3MH4A 1VCWA 2JXOA 1KEFA 1VJ6A 1ZUBA 4PQWA 2EXGA 3QE1A 2FNEA 2PKTA 1OBZA 1X5QA 2AWWA 1GQ4A 3SUZA 4KFWA 3B76A 2DMZA 1V5QA 1N7TA 4O06A 2YT7A 2PDZA 2OQSA 2I4SA 5E1YA 2KQFA 2V90A 3K82A 2QT5A 2G2LA 4JL7A 1X6DA 5G1EA 2P3WA 5E22A 2I0LA 4AMHA 4JOEA 2LC7A 2WL7A 2UZCA 5B42A 2HGAA 3QDOA 1L6OA 2JREA 3WKLA 1WFGA 4HOPB 1QAVA 4E35A 2PNTA 3RLEA 4Q2OA 2Z9IA 2IWNA 2PZDA 4LMMA 4Q2NA 5HF1A 3EGGC 4RI0A 1UJUA 1OBYA 4FGMA 2H2CA 2DKRA 2HE2A 1XZ9A 2REYA 1VA8A 2DLSA 2QBWA 2HE4A 2O2TA 5HEDA 3GABA 1X5RA 2EEJA 1D5GA 2I6VA 2LUIA 2RRMA 1WI2A 5E21A 3KZEA 4Q2PA 1N6EA 1RGWA 3DJAA 2DLUA 4EDJA 1N6DA 3JXTA 1UEPA 1BE9A 2Z17A 1UHPA 3ID2A 2VPHA 4Z8JA 2KBSA 1V62A 3SHWA 3GJ9A 2M0TA 3MH7A 3PDZA 2K20A 2M0VA 1BFEA 1RZXA 2KG2A 3CC0A 3QO6A 3LNXA 2I1NA 5F67A 5ILBA 2KJDA 3QJNA 4WYTA 1UJDA 1WI4A 5H3JA 3TMHA 1I92A 1IU0A 2BYGA 3GGEA 1Y7NA 2OS6A 2D90A 4Q6HA 3R68A 1W9OA 3TSWA 2CSJA 1T2MA 2KA9A 2W4FA 2RCZA 3QIKA 2KOHA 5GLJA 2OSGA 4FLNA 4G69A 1UITA 4Z33A 1N6FA 1Q7XA 5FHTA 2JILA 1VAEA 1IHJA 3WKMA 2I04A 2IWOA 4NMTA 3NFLA 1OZIA 2VSPA 3SHUA 2JIKA 2IWPA 2FN5A 2Q9VA 2KJPA 1SOZA 2FCFA 3QJMA 3GDSA 1V5LA 5HETA 1WHDA 1FC6A 1X45A 3O5NA 3CYYA 1Q3PA 4GHNA 4NMPA 4P2AB 3BPUA 1FC9A 2OZFA 3O46A 2W7RA 2EGOA 2PKUA 2Q3GA 4F8KA 3LNYA 3SOEA 3L4FD 3CBZA 3GCOA
chains in the Genus database with same CATH topology
1TP3A 2VWRA 3KZDA 3R0HA 2D92A 3ID4A 1W9QA 4NXQA 1NTEA 1P1EA 1WIFA 2OCSA 1MC7A 3I18A 4E3BA 3CBXA 2LC6A 2AINA 3TSZA 5I7ZA 2AWUA 2JINA 3KHFA 2YUBA 2M10A 2VZ5A 4NMSA 2AWXA 3STJA 3I4WA 2EEHA 2IWQA 3I1EA 3ZRTA 5HFFA 2M0UA 4OAJA 5A2PA 2EDPA 4K76A 1P1DA 4JJ3A 2MHOA 2KAWA 2EEGA 4KFVA 5D13A 1K32A 2X7ZA 1LCYA 1WHAA 1B8QA 1MFGA 1R6JA 5HDYA 5HF4A 2KOMA 2QKUA 2G5MB 5HFDA 3SFJA 4JORA 1I16A 1U39A 2KV8A 1M5ZA 2H3MA 2GZVA 2QKTA 2L4TA 3VQFA 3NGHA 2EDZA 2KRGA 3GSLA 4Q2QA 2KPLA 2E7KA 2L4SA 1UF1A 4E34A 4K6YA 1TQ3A 3MH6A 1X9ZA 4N6XA 1U38A 2CSSA 2I0IA 1V1TA 1Z86A 2OGPA 3PV5A 2FE5A 4K78A 1UM1A 2OPGA 1WF8A 2EEIA 2M3MA 4JOHA 2JWEA 3DJ1A 2KL1A 3GCNA 1QAVB 3NCVA 1FCFA 4R2ZA 3K50A 3KDKA 4NNLA 4WYUA 4XHVA 1OBXA 5DTHA 1NF3C 4YDPA 2KOJA 1PDRA 4JOGA 2H3LA 2YUYA 4JOPA 4NXRA 2F5YA 1KY9A 2K1ZA 2KYLA 3ID3A 1X8SA 3FY5A 3CBYA 3QGLA 4NMOA 2V1WA 4NMQA 1G9OA 3R69A 4P0CA 4UU6A 1GQ5A 2EJYA 4GVCA 3RL8A 1N99A 1U3BA 4L8NA 3OU0A 3E17A 4K72A 4Q3HA 1UFXA 2R4HA 3CH8A 4GVDA 1WF7A 4JJ0A 5EYZA 3PV4A 1Q3OA 4MPAA 5HJ1A 4NMRA 2DAZA 2ENOA 3DJ3A 2QKVA 4IC6A 1V6BA 4JOKA 1MFLA 3PDVA 2LA8A 1X5NA 3ID1A 3RL7A 5G1DA 2KPKA 4REYA 1VB7A 1W9EA 2QG1A 1RY4A 3DIWA 5E6PB 1QAUA 2YT8A 2L97A 4K75A 1N7EA 1GM1A 3NFKA 4YYXA 2YTWA 2ZPMA 5HEBA 4JOFA 5HFBA 2EHRA 1Z87A 2MX6A 1WH1A 3HPMA 1UJVA 4NXPA 1N7FA 1TP5A 2EGKA 2LOBA 1KWAA 1Y8TA 1WG6A 3TSVA 2DC2A 1RGRA 2KJKA 2DM8A 3PS4A 5F3XA 1QLCA 4HOPA 2R3YA 1TE0A 1FC7A 2JOAA 2EDVA 3K1RA 4OEOA 3PV2A 3HPKA 2GEFA 2VRFA 3DORA 2D8IA 5JXBA 2M0ZA 1ZOKA 4Q6SA 3CS0A 3HVQC 5IL9A 2JSNA 2DB5A 2PA1A 3GDUA 5FB8C 1YBOA 5EZ0A 1UM7A 5B6LA 4JOJA 2CS5A 3OTPA 2EGNA 3VQGA 2OMJA 2F0AA 2VSVA 5GNDA 5HEYA 4NMVA 2DJTA 3KDGA 2H2BA 1WJLA 1IU2A 2EAQA 4OEPA 1UEWA 5HFCA 2EV8A 4NNMA 5E11A 1U37A 1UEQA 4H11A 3GDVA 3AXAA 1SOTA 1UEZA 1WFVA 3EGHC 4UU5A 2ZPLA 5HFEA 3MH4A 1VCWA 2JXOA 1KEFA 1VJ6A 1ZUBA 4PQWA 2EXGA 3QE1A 2FNEA 2PKTA 1OBZA 1X5QA 2AWWA 1GQ4A 3SUZA 4KFWA 3B76A 2DMZA 1V5QA 1N7TA 4O06A 2YT7A 2PDZA 2OQSA 2I4SA 5E1YA 2KQFA 2V90A 3K82A 2QT5A 2G2LA 4JL7A 1X6DA 5G1EA 2P3WA 5E22A 2I0LA 4AMHA 4JOEA 2LC7A 2WL7A 2UZCA 5B42A 2HGAA 3QDOA 1L6OA 2JREA 3WKLA 1WFGA 4HOPB 1QAVA 4E35A 2PNTA 3RLEA 4Q2OA 2Z9IA 2IWNA 2PZDA 4LMMA 4Q2NA 5HF1A 3EGGC 4RI0A 1UJUA 1OBYA 4FGMA 2H2CA 2DKRA 2HE2A 1XZ9A 2REYA 1VA8A 2DLSA 2QBWA 2HE4A 2O2TA 5HEDA 3GABA 1X5RA 2EEJA 1D5GA 2I6VA 2LUIA 2RRMA 1WI2A 5E21A 3KZEA 4Q2PA 1N6EA 1RGWA 3DJAA 2DLUA 4EDJA 1N6DA 3JXTA 1UEPA 1BE9A 2Z17A 1UHPA 3ID2A 2VPHA 4Z8JA 2KBSA 1V62A 3SHWA 3GJ9A 2M0TA 3MH7A 3PDZA 2K20A 2M0VA 1BFEA 1RZXA 2KG2A 3CC0A 3QO6A 3LNXA 2I1NA 5F67A 5ILBA 2KJDA 3QJNA 4WYTA 1UJDA 1WI4A 5H3JA 3TMHA 1I92A 1IU0A 2BYGA 3GGEA 1Y7NA 2OS6A 2D90A 4Q6HA 3R68A 1W9OA 3TSWA 2CSJA 1T2MA 2KA9A 2W4FA 2RCZA 3QIKA 2KOHA 5GLJA 2OSGA 4FLNA 4G69A 1UITA 4Z33A 1N6FA 1Q7XA 5FHTA 2JILA 1VAEA 1IHJA 3WKMA 2I04A 2IWOA 4NMTA 3NFLA 1OZIA 2VSPA 3SHUA 2JIKA 2IWPA 2FN5A 2Q9VA 2KJPA 1SOZA 2FCFA 3QJMA 3GDSA 1V5LA 5HETA 1WHDA 1FC6A 1X45A 3O5NA 3CYYA 1Q3PA 4GHNA 4NMPA 4P2AB 3BPUA 1FC9A 2OZFA 3O46A 2W7RA 2EGOA 2PKUA 2Q3GA 4F8KA 3LNYA 3SOEA 3L4FD 3CBZA 3GCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TP3 A;  2VWR A;  3KZD A;  3R0H A;  2D92 A;  3ID4 A;  1W9Q A;  4NXQ A;  1NTE A;  1P1E A;  1WIF A;  2OCS A;  1MC7 A;  3I18 A;  4E3B A;  3CBX A;  2LC6 A;  2AIN A;  3TSZ A;  5I7Z A;  2AWU A;  2JIN A;  3KHF A;  2YUB A;  2M10 A;  2VZ5 A;  4NMS A;  2AWX A;  3STJ A;  3I4W A;  2EEH A;  2IWQ A;  3I1E A;  3ZRT A;  5HFF A;  2M0U A;  4OAJ A;  5A2P A;  2EDP A;  4K76 A;  1P1D A;  2MHO A;  2KAW A;  2EEG A;  4KFV A;  5D13 A;  1K32 A;  2X7Z A;  1LCY A;  1WHA A;  1B8Q A;  1MFG A;  1R6J A;  5HDY A;  5HF4 A;  2KOM A;  2QKU A;  2G5M B;  5HFD A;  3SFJ A;  4JOR A;  1I16 A;  1U39 A;  2KV8 A;  1M5Z A;  2H3M A;  2GZV A;  2QKT A;  2L4T A;  3VQF A;  3NGH A;  2EDZ A;  2KRG A;  3GSL A;  4Q2Q A;  2KPL A;  2E7K A;  2L4S A;  1UF1 A;  4E34 A;  4K6Y A;  1TQ3 A;  3MH6 A;  4N6X A;  1U38 A;  2CSS A;  2I0I A;  1V1T A;  1Z86 A;  2OGP A;  3PV5 A;  2FE5 A;  4K78 A;  1UM1 A;  2OPG A;  1WF8 A;  2EEI A;  2M3M A;  4JOH A;  2JWE A;  3DJ1 A;  2KL1 A;  3GCN A;  1QAV B;  1FCF A;  4R2Z A;  3K50 A;  4NNL A;  4WYU A;  4XHV A;  1OBX A;  5DTH A;  1NF3 C;  4YDP A;  2KOJ A;  1PDR A;  4JOG A;  2H3L A;  2YUY A;  4JOP A;  4NXR A;  2F5Y A;  1KY9 A;  2K1Z A;  2KYL A;  3ID3 A;  1X8S A;  3FY5 A;  3CBY A;  3QGL A;  4NMO A;  2V1W A;  4NMQ A;  1G9O A;  3R69 A;  4P0C A;  4UU6 A;  1GQ5 A;  2EJY A;  4GVC A;  3RL8 A;  1N99 A;  1U3B A;  4L8N A;  3OU0 A;  3E17 A;  4K72 A;  4Q3H A;  1UFX A;  2R4H A;  3CH8 A;  4GVD A;  1WF7 A;  5EYZ A;  3PV4 A;  1Q3O A;  4MPA A;  5HJ1 A;  4NMR A;  2DAZ A;  2ENO A;  3DJ3 A;  2QKV A;  4IC6 A;  1V6B A;  4JOK A;  1MFL A;  3PDV A;  2LA8 A;  1X5N A;  3ID1 A;  3RL7 A;  5G1D A;  2KPK A;  4REY A;  1VB7 A;  1W9E A;  2QG1 A;  1RY4 A;  3DIW A;  5E6P B;  1QAU A;  2YT8 A;  2L97 A;  4K75 A;  1N7E A;  1GM1 A;  3NFK A;  4YYX A;  2YTW A;  2ZPM A;  5HEB A;  4JOF A;  5HFB A;  2EHR A;  1Z87 A;  2MX6 A;  1WH1 A;  3HPM A;  1UJV A;  4NXP A;  1N7F A;  1TP5 A;  2EGK A;  2LOB A;  1KWA A;  1Y8T A;  1WG6 A;  3TSV A;  2DC2 A;  1RGR A;  2KJK A;  2DM8 A;  3PS4 A;  5F3X A;  1QLC A;  4HOP A;  2R3Y A;  1TE0 A;  1FC7 A;  2JOA A;  2EDV A;  3K1R A;  4OEO A;  3PV2 A;  3HPK A;  2VRF A;  3DOR A;  2D8I A;  5JXB A;  2M0Z A;  1ZOK A;  4Q6S A;  3CS0 A;  3HVQ C;  2DB5 A;  2PA1 A;  3GDU A;  5FB8 C;  1YBO A;  5EZ0 A;  1UM7 A;  5B6L A;  4JOJ A;  2CS5 A;  3OTP A;  2EGN A;  3VQG A;  2OMJ A;  2F0A A;  2VSV A;  5GND A;  5HEY A;  4NMV A;  2DJT A;  2H2B A;  1WJL A;  1IU2 A;  2EAQ A;  4OEP A;  1UEW A;  5HFC A;  2EV8 A;  4NNM A;  5E11 A;  1U37 A;  1UEQ A;  4H11 A;  3GDV A;  3AXA A;  1SOT A;  1UEZ A;  1WFV A;  3EGH C;  4UU5 A;  2ZPL A;  5HFE A;  3MH4 A;  1VCW A;  2JXO A;  1KEF A;  1VJ6 A;  1ZUB A;  4PQW A;  2EXG A;  3QE1 A;  2FNE A;  2PKT A;  1OBZ A;  1X5Q A;  2AWW A;  1GQ4 A;  3SUZ A;  4KFW A;  3B76 A;  2DMZ A;  1V5Q A;  1N7T A;  4O06 A;  2YT7 A;  2PDZ A;  2OQS A;  2I4S A;  5E1Y A;  2KQF A;  2V90 A;  3K82 A;  2QT5 A;  2G2L A;  4JL7 A;  1X6D A;  5G1E A;  2P3W A;  5E22 A;  2I0L A;  4AMH A;  4JOE A;  2LC7 A;  2WL7 A;  2UZC A;  2HGA A;  3QDO A;  1L6O A;  2JRE A;  3WKL A;  1WFG A;  4HOP B;  1QAV A;  4E35 A;  2PNT A;  3RLE A;  4Q2O A;  2Z9I A;  2IWN A;  2PZD A;  4LMM A;  4Q2N A;  5HF1 A;  3EGG C;  4RI0 A;  1UJU A;  1OBY A;  4FGM A;  2H2C A;  2DKR A;  2HE2 A;  1XZ9 A;  2REY A;  1VA8 A;  2DLS A;  2QBW A;  2HE4 A;  2O2T A;  5HED A;  1X5R A;  2EEJ A;  1D5G A;  2I6V A;  2LUI A;  2RRM A;  1WI2 A;  5E21 A;  3KZE A;  4Q2P A;  1N6E A;  1RGW A;  3DJA A;  2DLU A;  4EDJ A;  1N6D A;  3JXT A;  1UEP A;  1BE9 A;  2Z17 A;  1UHP A;  3ID2 A;  2VPH A;  4Z8J A;  2KBS A;  1V62 A;  3SHW A;  3GJ9 A;  2M0T A;  3MH7 A;  3PDZ A;  2K20 A;  2M0V A;  1BFE A;  1RZX A;  2KG2 A;  3CC0 A;  3QO6 A;  3LNX A;  2I1N A;  5F67 A;  2KJD A;  3QJN A;  4WYT A;  1UJD A;  1WI4 A;  5H3J A;  3TMH A;  1I92 A;  1IU0 A;  2BYG A;  3GGE A;  1Y7N A;  2OS6 A;  2D90 A;  4Q6H A;  3R68 A;  1W9O A;  3TSW A;  2CSJ A;  1T2M A;  2KA9 A;  2W4F A;  2RCZ A;  3QIK A;  2KOH A;  5GLJ A;  2OSG A;  4G69 A;  1UIT A;  4Z33 A;  1N6F A;  1Q7X A;  5FHT A;  2JIL A;  1VAE A;  1IHJ A;  3WKM A;  2I04 A;  2IWO A;  4NMT A;  3NFL A;  1OZI A;  2VSP A;  3SHU A;  2JIK A;  2IWP A;  2FN5 A;  2Q9V A;  2KJP A;  1SOZ A;  2FCF A;  3QJM A;  3GDS A;  1V5L A;  5HET A;  1WHD A;  1FC6 A;  1X45 A;  3O5N A;  3CYY A;  1Q3P A;  4GHN A;  4NMP A;  4P2A B;  3BPU A;  1FC9 A;  2OZF A;  3O46 A;  2W7R A;  2EGO A;  2PKU A;  2Q3G A;  4F8K A;  3LNY A;  3SOE A;  3L4F D;  3CBZ A;  3GCO A; 
#chains in the Genus database with same CATH topology
 1TP3 A;  2VWR A;  3KZD A;  3R0H A;  2D92 A;  3ID4 A;  1W9Q A;  4NXQ A;  1NTE A;  1P1E A;  1WIF A;  2OCS A;  1MC7 A;  3I18 A;  4E3B A;  3CBX A;  2LC6 A;  2AIN A;  3TSZ A;  5I7Z A;  2AWU A;  2JIN A;  3KHF A;  2YUB A;  2M10 A;  2VZ5 A;  4NMS A;  2AWX A;  3STJ A;  3I4W A;  2EEH A;  2IWQ A;  3I1E A;  3ZRT A;  5HFF A;  2M0U A;  4OAJ A;  5A2P A;  2EDP A;  4K76 A;  1P1D A;  4JJ3 A;  2MHO A;  2KAW A;  2EEG A;  4KFV A;  5D13 A;  1K32 A;  2X7Z A;  1LCY A;  1WHA A;  1B8Q A;  1MFG A;  1R6J A;  5HDY A;  5HF4 A;  2KOM A;  2QKU A;  2G5M B;  5HFD A;  3SFJ A;  4JOR A;  1I16 A;  1U39 A;  2KV8 A;  1M5Z A;  2H3M A;  2GZV A;  2QKT A;  2L4T A;  3VQF A;  3NGH A;  2EDZ A;  2KRG A;  3GSL A;  4Q2Q A;  2KPL A;  2E7K A;  2L4S A;  1UF1 A;  4E34 A;  4K6Y A;  1TQ3 A;  3MH6 A;  1X9Z A;  4N6X A;  1U38 A;  2CSS A;  2I0I A;  1V1T A;  1Z86 A;  2OGP A;  3PV5 A;  2FE5 A;  4K78 A;  1UM1 A;  2OPG A;  1WF8 A;  2EEI A;  2M3M A;  4JOH A;  2JWE A;  3DJ1 A;  2KL1 A;  3GCN A;  1QAV B;  3NCV A;  1FCF A;  4R2Z A;  3K50 A;  3KDK A;  4NNL A;  4WYU A;  4XHV A;  1OBX A;  5DTH A;  1NF3 C;  4YDP A;  2KOJ A;  1PDR A;  4JOG A;  2H3L A;  2YUY A;  4JOP A;  4NXR A;  2F5Y A;  1KY9 A;  2K1Z A;  2KYL A;  3ID3 A;  1X8S A;  3FY5 A;  3CBY A;  3QGL A;  4NMO A;  2V1W A;  4NMQ A;  1G9O A;  3R69 A;  4P0C A;  4UU6 A;  1GQ5 A;  2EJY A;  4GVC A;  3RL8 A;  1N99 A;  1U3B A;  4L8N A;  3OU0 A;  3E17 A;  4K72 A;  4Q3H A;  1UFX A;  2R4H A;  3CH8 A;  4GVD A;  1WF7 A;  4JJ0 A;  5EYZ A;  3PV4 A;  1Q3O A;  4MPA A;  5HJ1 A;  4NMR A;  2DAZ A;  2ENO A;  3DJ3 A;  2QKV A;  4IC6 A;  1V6B A;  4JOK A;  1MFL A;  3PDV A;  2LA8 A;  1X5N A;  3ID1 A;  3RL7 A;  5G1D A;  2KPK A;  4REY A;  1VB7 A;  1W9E A;  2QG1 A;  1RY4 A;  3DIW A;  5E6P B;  1QAU A;  2YT8 A;  2L97 A;  4K75 A;  1N7E A;  1GM1 A;  3NFK A;  4YYX A;  2YTW A;  2ZPM A;  5HEB A;  4JOF A;  5HFB A;  2EHR A;  1Z87 A;  2MX6 A;  1WH1 A;  3HPM A;  1UJV A;  4NXP A;  1N7F A;  1TP5 A;  2EGK A;  2LOB A;  1KWA A;  1Y8T A;  1WG6 A;  3TSV A;  2DC2 A;  1RGR A;  2KJK A;  2DM8 A;  3PS4 A;  5F3X A;  1QLC A;  4HOP A;  2R3Y A;  1TE0 A;  1FC7 A;  2JOA A;  2EDV A;  3K1R A;  4OEO A;  3PV2 A;  3HPK A;  2GEF A;  2VRF A;  3DOR A;  2D8I A;  5JXB A;  2M0Z A;  1ZOK A;  4Q6S A;  3CS0 A;  3HVQ C;  5IL9 A;  2JSN A;  2DB5 A;  2PA1 A;  3GDU A;  5FB8 C;  1YBO A;  5EZ0 A;  1UM7 A;  5B6L A;  4JOJ A;  2CS5 A;  3OTP A;  2EGN A;  3VQG A;  2OMJ A;  2F0A A;  2VSV A;  5GND A;  5HEY A;  4NMV A;  2DJT A;  3KDG A;  2H2B A;  1WJL A;  1IU2 A;  2EAQ A;  4OEP A;  1UEW A;  5HFC A;  2EV8 A;  4NNM A;  5E11 A;  1U37 A;  1UEQ A;  4H11 A;  3GDV A;  3AXA A;  1SOT A;  1UEZ A;  1WFV A;  3EGH C;  4UU5 A;  2ZPL A;  5HFE A;  3MH4 A;  1VCW A;  2JXO A;  1KEF A;  1VJ6 A;  1ZUB A;  4PQW A;  2EXG A;  3QE1 A;  2FNE A;  2PKT A;  1OBZ A;  1X5Q A;  2AWW A;  1GQ4 A;  3SUZ A;  4KFW A;  3B76 A;  2DMZ A;  1V5Q A;  1N7T A;  4O06 A;  2YT7 A;  2PDZ A;  2OQS A;  2I4S A;  5E1Y A;  2KQF A;  2V90 A;  3K82 A;  2QT5 A;  2G2L A;  4JL7 A;  1X6D A;  5G1E A;  2P3W A;  5E22 A;  2I0L A;  4AMH A;  4JOE A;  2LC7 A;  2WL7 A;  2UZC A;  5B42 A;  2HGA A;  3QDO A;  1L6O A;  2JRE A;  3WKL A;  1WFG A;  4HOP B;  1QAV A;  4E35 A;  2PNT A;  3RLE A;  4Q2O A;  2Z9I A;  2IWN A;  2PZD A;  4LMM A;  4Q2N A;  5HF1 A;  3EGG C;  4RI0 A;  1UJU A;  1OBY A;  4FGM A;  2H2C A;  2DKR A;  2HE2 A;  1XZ9 A;  2REY A;  1VA8 A;  2DLS A;  2QBW A;  2HE4 A;  2O2T A;  5HED A;  3GAB A;  1X5R A;  2EEJ A;  1D5G A;  2I6V A;  2LUI A;  2RRM A;  1WI2 A;  5E21 A;  3KZE A;  4Q2P A;  1N6E A;  1RGW A;  3DJA A;  2DLU A;  4EDJ A;  1N6D A;  3JXT A;  1UEP A;  1BE9 A;  2Z17 A;  1UHP A;  3ID2 A;  2VPH A;  4Z8J A;  2KBS A;  1V62 A;  3SHW A;  3GJ9 A;  2M0T A;  3MH7 A;  3PDZ A;  2K20 A;  2M0V A;  1BFE A;  1RZX A;  2KG2 A;  3CC0 A;  3QO6 A;  3LNX A;  2I1N A;  5F67 A;  5ILB A;  2KJD A;  3QJN A;  4WYT A;  1UJD A;  1WI4 A;  5H3J A;  3TMH A;  1I92 A;  1IU0 A;  2BYG A;  3GGE A;  1Y7N A;  2OS6 A;  2D90 A;  4Q6H A;  3R68 A;  1W9O A;  3TSW A;  2CSJ A;  1T2M A;  2KA9 A;  2W4F A;  2RCZ A;  3QIK A;  2KOH A;  5GLJ A;  2OSG A;  4FLN A;  4G69 A;  1UIT A;  4Z33 A;  1N6F A;  1Q7X A;  5FHT A;  2JIL A;  1VAE A;  1IHJ A;  3WKM A;  2I04 A;  2IWO A;  4NMT A;  3NFL A;  1OZI A;  2VSP A;  3SHU A;  2JIK A;  2IWP A;  2FN5 A;  2Q9V A;  2KJP A;  1SOZ A;  2FCF A;  3QJM A;  3GDS A;  1V5L A;  5HET A;  1WHD A;  1FC6 A;  1X45 A;  3O5N A;  3CYY A;  1Q3P A;  4GHN A;  4NMP A;  4P2A B;  3BPU A;  1FC9 A;  2OZF A;  3O46 A;  2W7R A;  2EGO A;  2PKU A;  2Q3G A;  4F8K A;  3LNY A;  3SOE A;  3L4F D;  3CBZ A;  3GCO A; 
#chains in the Genus database with same CATH homology
 1TP3 A;  2VWR A;  3KZD A;  3R0H A;  2D92 A;  3ID4 A;  1W9Q A;  4NXQ A;  1NTE A;  1P1E A;  1WIF A;  2OCS A;  1MC7 A;  3I18 A;  4E3B A;  3CBX A;  2LC6 A;  2AIN A;  3TSZ A;  5I7Z A;  2AWU A;  2JIN A;  3KHF A;  2YUB A;  2M10 A;  2VZ5 A;  4NMS A;  2AWX A;  3STJ A;  3I4W A;  2EEH A;  2IWQ A;  3I1E A;  3ZRT A;  5HFF A;  2M0U A;  4OAJ A;  5A2P A;  2EDP A;  4K76 A;  1P1D A;  4JJ3 A;  2MHO A;  2KAW A;  2EEG A;  4KFV A;  5D13 A;  1K32 A;  2X7Z A;  1LCY A;  1WHA A;  1B8Q A;  1MFG A;  1R6J A;  5HDY A;  5HF4 A;  2KOM A;  2QKU A;  2G5M B;  5HFD A;  3SFJ A;  4JOR A;  1I16 A;  1U39 A;  2KV8 A;  1M5Z A;  2H3M A;  2GZV A;  2QKT A;  2L4T A;  3VQF A;  3NGH A;  2EDZ A;  2KRG A;  3GSL A;  4Q2Q A;  2KPL A;  2E7K A;  2L4S A;  1UF1 A;  4E34 A;  4K6Y A;  1TQ3 A;  3MH6 A;  1X9Z A;  4N6X A;  1U38 A;  2CSS A;  2I0I A;  1V1T A;  1Z86 A;  2OGP A;  3PV5 A;  2FE5 A;  4K78 A;  1UM1 A;  2OPG A;  1WF8 A;  2EEI A;  2M3M A;  4JOH A;  2JWE A;  3DJ1 A;  2KL1 A;  3GCN A;  1QAV B;  3NCV A;  1FCF A;  4R2Z A;  3K50 A;  3KDK A;  4NNL A;  4WYU A;  4XHV A;  1OBX A;  5DTH A;  1NF3 C;  4YDP A;  2KOJ A;  1PDR A;  4JOG A;  2H3L A;  2YUY A;  4JOP A;  4NXR A;  2F5Y A;  1KY9 A;  2K1Z A;  2KYL A;  3ID3 A;  1X8S A;  3FY5 A;  3CBY A;  3QGL A;  4NMO A;  2V1W A;  4NMQ A;  1G9O A;  3R69 A;  4P0C A;  4UU6 A;  1GQ5 A;  2EJY A;  4GVC A;  3RL8 A;  1N99 A;  1U3B A;  4L8N A;  3OU0 A;  3E17 A;  4K72 A;  4Q3H A;  1UFX A;  2R4H A;  3CH8 A;  4GVD A;  1WF7 A;  4JJ0 A;  5EYZ A;  3PV4 A;  1Q3O A;  4MPA A;  5HJ1 A;  4NMR A;  2DAZ A;  2ENO A;  3DJ3 A;  2QKV A;  4IC6 A;  1V6B A;  4JOK A;  1MFL A;  3PDV A;  2LA8 A;  1X5N A;  3ID1 A;  3RL7 A;  5G1D A;  2KPK A;  4REY A;  1VB7 A;  1W9E A;  2QG1 A;  1RY4 A;  3DIW A;  5E6P B;  1QAU A;  2YT8 A;  2L97 A;  4K75 A;  1N7E A;  1GM1 A;  3NFK A;  4YYX A;  2YTW A;  2ZPM A;  5HEB A;  4JOF A;  5HFB A;  2EHR A;  1Z87 A;  2MX6 A;  1WH1 A;  3HPM A;  1UJV A;  4NXP A;  1N7F A;  1TP5 A;  2EGK A;  2LOB A;  1KWA A;  1Y8T A;  1WG6 A;  3TSV A;  2DC2 A;  1RGR A;  2KJK A;  2DM8 A;  3PS4 A;  5F3X A;  1QLC A;  4HOP A;  2R3Y A;  1TE0 A;  1FC7 A;  2JOA A;  2EDV A;  3K1R A;  4OEO A;  3PV2 A;  3HPK A;  2GEF A;  2VRF A;  3DOR A;  2D8I A;  5JXB A;  2M0Z A;  1ZOK A;  4Q6S A;  3CS0 A;  3HVQ C;  5IL9 A;  2JSN A;  2DB5 A;  2PA1 A;  3GDU A;  5FB8 C;  1YBO A;  5EZ0 A;  1UM7 A;  5B6L A;  4JOJ A;  2CS5 A;  3OTP A;  2EGN A;  3VQG A;  2OMJ A;  2F0A A;  2VSV A;  5GND A;  5HEY A;  4NMV A;  2DJT A;  3KDG A;  2H2B A;  1WJL A;  1IU2 A;  2EAQ A;  4OEP A;  1UEW A;  5HFC A;  2EV8 A;  4NNM A;  5E11 A;  1U37 A;  1UEQ A;  4H11 A;  3GDV A;  3AXA A;  1SOT A;  1UEZ A;  1WFV A;  3EGH C;  4UU5 A;  2ZPL A;  5HFE A;  3MH4 A;  1VCW A;  2JXO A;  1KEF A;  1VJ6 A;  1ZUB A;  4PQW A;  2EXG A;  3QE1 A;  2FNE A;  2PKT A;  1OBZ A;  1X5Q A;  2AWW A;  1GQ4 A;  3SUZ A;  4KFW A;  3B76 A;  2DMZ A;  1V5Q A;  1N7T A;  4O06 A;  2YT7 A;  2PDZ A;  2OQS A;  2I4S A;  5E1Y A;  2KQF A;  2V90 A;  3K82 A;  2QT5 A;  2G2L A;  4JL7 A;  1X6D A;  5G1E A;  2P3W A;  5E22 A;  2I0L A;  4AMH A;  4JOE A;  2LC7 A;  2WL7 A;  2UZC A;  5B42 A;  2HGA A;  3QDO A;  1L6O A;  2JRE A;  3WKL A;  1WFG A;  4HOP B;  1QAV A;  4E35 A;  2PNT A;  3RLE A;  4Q2O A;  2Z9I A;  2IWN A;  2PZD A;  4LMM A;  4Q2N A;  5HF1 A;  3EGG C;  4RI0 A;  1UJU A;  1OBY A;  4FGM A;  2H2C A;  2DKR A;  2HE2 A;  1XZ9 A;  2REY A;  1VA8 A;  2DLS A;  2QBW A;  2HE4 A;  2O2T A;  5HED A;  3GAB A;  1X5R A;  2EEJ A;  1D5G A;  2I6V A;  2LUI A;  2RRM A;  1WI2 A;  5E21 A;  3KZE A;  4Q2P A;  1N6E A;  1RGW A;  3DJA A;  2DLU A;  4EDJ A;  1N6D A;  3JXT A;  1UEP A;  1BE9 A;  2Z17 A;  1UHP A;  3ID2 A;  2VPH A;  4Z8J A;  2KBS A;  1V62 A;  3SHW A;  3GJ9 A;  2M0T A;  3MH7 A;  3PDZ A;  2K20 A;  2M0V A;  1BFE A;  1RZX A;  2KG2 A;  3CC0 A;  3QO6 A;  3LNX A;  2I1N A;  5F67 A;  5ILB A;  2KJD A;  3QJN A;  4WYT A;  1UJD A;  1WI4 A;  5H3J A;  3TMH A;  1I92 A;  1IU0 A;  2BYG A;  3GGE A;  1Y7N A;  2OS6 A;  2D90 A;  4Q6H A;  3R68 A;  1W9O A;  3TSW A;  2CSJ A;  1T2M A;  2KA9 A;  2W4F A;  2RCZ A;  3QIK A;  2KOH A;  5GLJ A;  2OSG A;  4FLN A;  4G69 A;  1UIT A;  4Z33 A;  1N6F A;  1Q7X A;  5FHT A;  2JIL A;  1VAE A;  1IHJ A;  3WKM A;  2I04 A;  2IWO A;  4NMT A;  3NFL A;  1OZI A;  2VSP A;  3SHU A;  2JIK A;  2IWP A;  2FN5 A;  2Q9V A;  2KJP A;  1SOZ A;  2FCF A;  3QJM A;  3GDS A;  1V5L A;  5HET A;  1WHD A;  1FC6 A;  1X45 A;  3O5N A;  3CYY A;  1Q3P A;  4GHN A;  4NMP A;  4P2A B;  3BPU A;  1FC9 A;  2OZF A;  3O46 A;  2W7R A;  2EGO A;  2PKU A;  2Q3G A;  4F8K A;  3LNY A;  3SOE A;  3L4F D;  3CBZ A;  3GCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...