4JJ0A

Crystal structure of mamp
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
181
structure length
181
Chain Sequence
GGFVAPNVQFSEAHWQGMEALPLSIELKRKLKLPLDLEGLLIDETSLNAAVSGLLAGDVLVAINGRKVKTLKKMQKETRRVQMDRRASLTVYRKGRLLTLTLSEEKNLGLAQVETAPMILPGDIMPHPYRGPCTQCHAIGTTGHITPDPDGIVLPPGPIRAGAKMPHRDRGPCAACHAIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamP
publication title Structural insight into magnetochrome-mediated magnetite biomineralization.
pubmed doi rcsb
source organism Magnetococcus
molecule tags Electron transport
total genus 36
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13180 PDZ_2 PDZ domain
A PF18509 MCR Magnetochrome domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.60 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4jj0A00
4JJ3A 4JJ0A
chains in the Genus database with same CATH superfamily
3SOEA 1BFEA 2KJDA 1W9OA 3R0HA 3HVQC 2H2BA 4KFWA 4NNLA 1UEPA 5H3JA 2VRFA 1I16A 2O2TA 3R68A 2DM8A 3OTPA 4JOFA 2DLSA 2F0AA 3FY5A 2I1NA 1NF3C 3QIKA 1X9ZA 3LNXA 2I0LA 4G69A 2LOBA 3PV5A 4JOJA 2VPHA 1UEZA 2IWPA 1G9OA 3QGLA 2YUYA 1ZOKA 2OSGA 3BPUA 4NMVA 2H2CA 4PQWA 2KOJA 2Z9IA 3E17A 1MC7A 3MH7A 5EYZA 4GVCA 2H3LA 2YTWA 1SOZA 3CBZA 2GEFA 2L4TA 2CSSA 2EDVA 2KJPA 2DJTA 2FE5A 2EJYA 4OEPA 5GNDA 1WG6A 4Z8JA 4JOGA 2UZCA 3K50A 4JOEA 4Z33A 1UEQA 3CC0A 2KG2A 3ID2A 4FGMA 2M0ZA 2JREA 1UF1A 2M0TA 2DC2A 1Z87A 4OAJA 1ZUBA 2DB5A 5I7ZA 4NMSA 3OU0A 1OBXA 3EGGC 1K32A 2AWXA 2AWUA 5HEYA 4Q3HA 3ZRTA 5EZ0A 2HGAA 2PDZA 3SHUA 4JOPA 2KPKA 4IC6A 1Y8TA 4Q2NA 4E3BA 4JL7A 2KPLA 1OZIA 2X7ZA 3TSZA 5HF1A 1QAVA 5E11A 1LCYA 2EGKA 1Q7XA 2G2LA 3PDVA 3WKLA 3SUZA 2DKRA 1V5QA 4UU6A 2D90A 1UM7A 2ENOA 1T2MA 2OGPA 2KRGA 3GCNA 3QJNA 2KJKA 3ID1A 2REYA 2JILA 5FB8C 5E6PB 4E34A 2L97A 3NGHA 1TQ3A 1N99A 1TE0A 1QAVB 4P2AB 3ID4A 3RL8A 2I6VA 2I4SA 1PDRA 1FCFA 3K1RA 1U39A 1WI2A 3O46A 1QAUA 1WHAA 2M0VA 3KHFA 4O06A 1IU0A 2LC6A 3PV4A 2RRMA 3SFJA 1X5NA 3AXAA 2KBSA 1IHJA 1W9QA 3EGHC 3SHWA 5HFFA 2D8IA 4REYA 1W9EA 1GQ4A 3I1EA 4NMPA 4K6YA 5HF4A 1WF8A 1N7TA 1FC6A 1N7EA 3CBYA 4JORA 4NNMA 4NXPA 3KZEA 3HPKA 1X8SA 4JOKA 2JXOA 2JOAA 4K76A 2FNEA 3PDZA 4YYXA 4JJ3A 2M3MA 3NFLA 3RLEA 2EDZA 2VWRA 1B8QA 2JIKA 2EEGA 1WF7A 4K75A 2M0UA 1I92A 2KV8A 2PKTA 1WJLA 4H11A 3QDOA 1M5ZA 1UJVA 1BE9A 3GDSA 5E22A 2OS6A 2FN5A 4K72A 3O5NA 5D13A 3JXTA 4N6XA 2Q3GA 4EDJA 2OZFA 2K1ZA 4GHNA 1GQ5A 1QLCA 5HFEA 3STJA 5HEBA 5F67A 4NMRA 1UM1A 3PS4A 5IL9A 3NCVA 3K82A 2V90A 2D92A 3CBXA 1Z86A 3B76A 1RY4A 1N6EA 3I4WA 1P1DA 2QKTA 4OEOA 2JWEA 1R6JA 2F5YA 1WI4A 1X6DA 4NMQA 4L8NA 4P0CA 4MPAA 4WYTA 1UJDA 1MFLA 2CS5A 3KDGA 3QO6A 5G1DA 1U3BA 2HE2A 2EGNA 2EXGA 2VSPA 1KEFA 3GCOA 2P3WA 1MFGA 4K78A 2JINA 1TP3A 3RL7A 1OBZA 5HFCA 1U37A 2EHRA 1P1EA 2K20A 2RCZA 2PZDA 1U38A 2IWQA 3HPMA 2YT7A 2EEIA 5FHTA 4AMHA 4Q2QA 1VCWA 5HFDA 3I18A 5HEDA 3DJAA 4Q2OA 5GLJA 3DJ1A 1UJUA 3GSLA 4HOPA 1UEWA 4XHVA 2EEHA 2L4SA 2KYLA 2PKUA 3NFKA 2PNTA 5G1EA 2Z17A 2LA8A 2OPGA 5HFBA 1WHDA 4NXQA 5ILBA 1IU2A 3KDKA 3R69A 1X5RA 4HOPB 2W4FA 2AINA 2G5MB 3TSWA 1L6OA 2EDPA 4R2ZA 3GDUA 1WFVA 2ZPMA 2KAWA 3KZDA 4Q2PA 2GZVA 3CH8A 2DLUA 2LC7A 1TP5A 2H3MA 2E7KA 2JSNA 3TSVA 1WIFA 2W7RA 1VA8A 2PA1A 1WH1A 3VQGA 2DMZA 2M10A 2WL7A 4JJ0A 2EV8A 1N7FA 5F3XA 4E35A 3CS0A 2EGOA 2QKUA 2LUIA 2VSVA 1KY9A 1KWAA 5JXBA 2MX6A 1RGWA 3ID3A 4WYUA 3GJ9A 5HDYA 1V1TA 2YT8A 1RGRA 1Q3PA 2KQFA 2I0IA 2VZ5A 1X45A 2KOHA 2R4HA 3DIWA 3MH6A 2ZPLA 2CSJA 2KA9A 1D5GA 1V6BA 1VB7A 2FCFA 3LNYA 1V5LA 1Y7NA 3L4FD 1N6FA 2BYGA 4RI0A 2EEJA 3WKMA 4GVDA 4Q6HA 2QT5A 1FC7A 2AWWA 2QBWA 2HE4A 2Q9VA 5A2PA 1RZXA 1VAEA 3MH4A 3PV2A 5HJ1A 2OCSA 5E1YA 2IWOA 1V62A 4FLNA 3VQFA 4NMTA 3DORA 4LMMA 1N6DA 2QKVA 1UITA 3GGEA 2YUBA 4NMOA 2IWNA 2MHOA 5DTHA 1GM1A 1YBOA 1Q3OA 1XZ9A 1UHPA 2KOMA 3QE1A 4KFVA 2OQSA 4JOHA 5E21A 3CYYA 1FC9A 4Q6SA 1SOTA 1VJ6A 2OMJA 4NXRA 3DJ3A 4F8KA 2KL1A 5HETA 4YDPA 2DAZA 3GABA 3TMHA 2V1WA 1WFGA 1X5QA 5B6LA 3GDVA 2I04A 5B42A 4UU5A 2EAQA 3QJMA 1UFXA 2QG1A 1NTEA 1OBYA 2R3YA
chains in the Genus database with same CATH topology
3SOEA 1BFEA 2KJDA 1W9OA 3R0HA 3HVQC 2H2BA 4KFWA 4NNLA 1UEPA 5H3JA 2VRFA 1I16A 2O2TA 3R68A 2DM8A 3OTPA 4JOFA 2DLSA 2F0AA 3FY5A 2I1NA 1NF3C 3QIKA 1X9ZA 3LNXA 2I0LA 4G69A 2LOBA 3PV5A 4JOJA 2VPHA 1UEZA 2IWPA 1G9OA 3QGLA 2YUYA 1ZOKA 2OSGA 3BPUA 4NMVA 2H2CA 4PQWA 2KOJA 2Z9IA 3E17A 1MC7A 3MH7A 5EYZA 4GVCA 2H3LA 2YTWA 1SOZA 3CBZA 2GEFA 2L4TA 2CSSA 2EDVA 2KJPA 2DJTA 2FE5A 2EJYA 4OEPA 5GNDA 1WG6A 4Z8JA 4JOGA 2UZCA 3K50A 4JOEA 4Z33A 1UEQA 3CC0A 2KG2A 3ID2A 4FGMA 2M0ZA 2JREA 1UF1A 2M0TA 2DC2A 1Z87A 4OAJA 1ZUBA 2DB5A 5I7ZA 4NMSA 3OU0A 1OBXA 3EGGC 1K32A 2AWXA 2AWUA 5HEYA 4Q3HA 3ZRTA 5EZ0A 2HGAA 2PDZA 3SHUA 4JOPA 2KPKA 4IC6A 1Y8TA 4Q2NA 4E3BA 4JL7A 2KPLA 1OZIA 2X7ZA 3TSZA 5HF1A 1QAVA 5E11A 1LCYA 2EGKA 1Q7XA 2G2LA 3PDVA 3WKLA 3SUZA 2DKRA 1V5QA 4UU6A 2D90A 1UM7A 2ENOA 1T2MA 2OGPA 2KRGA 3GCNA 3QJNA 2KJKA 3ID1A 2REYA 2JILA 5FB8C 5E6PB 4E34A 2L97A 3NGHA 1TQ3A 1N99A 1TE0A 1QAVB 4P2AB 3ID4A 3RL8A 2I6VA 2I4SA 1PDRA 1FCFA 3K1RA 1U39A 1WI2A 3O46A 1QAUA 1WHAA 2M0VA 3KHFA 4O06A 1IU0A 2LC6A 3PV4A 2RRMA 3SFJA 1X5NA 3AXAA 2KBSA 1IHJA 1W9QA 3EGHC 3SHWA 5HFFA 2D8IA 4REYA 1W9EA 1GQ4A 3I1EA 4NMPA 4K6YA 5HF4A 1WF8A 1N7TA 1FC6A 1N7EA 3CBYA 4JORA 4NNMA 4NXPA 3KZEA 3HPKA 1X8SA 4JOKA 2JXOA 2JOAA 4K76A 2FNEA 3PDZA 4YYXA 4JJ3A 2M3MA 3NFLA 3RLEA 2EDZA 2VWRA 1B8QA 2JIKA 2EEGA 1WF7A 4K75A 2M0UA 1I92A 2KV8A 2PKTA 1WJLA 4H11A 3QDOA 1M5ZA 1UJVA 1BE9A 3GDSA 5E22A 2OS6A 2FN5A 4K72A 3O5NA 5D13A 3JXTA 4N6XA 2Q3GA 4EDJA 2OZFA 2K1ZA 4GHNA 1GQ5A 1QLCA 5HFEA 3STJA 5HEBA 5F67A 4NMRA 1UM1A 3PS4A 5IL9A 3NCVA 3K82A 2V90A 2D92A 3CBXA 1Z86A 3B76A 1RY4A 1N6EA 3I4WA 1P1DA 2QKTA 4OEOA 2JWEA 1R6JA 2F5YA 1WI4A 1X6DA 4NMQA 4L8NA 4P0CA 4MPAA 4WYTA 1UJDA 1MFLA 2CS5A 3KDGA 3QO6A 5G1DA 1U3BA 2HE2A 2EGNA 2EXGA 2VSPA 1KEFA 3GCOA 2P3WA 1MFGA 4K78A 2JINA 1TP3A 3RL7A 1OBZA 5HFCA 1U37A 2EHRA 1P1EA 2K20A 2RCZA 2PZDA 1U38A 2IWQA 3HPMA 2YT7A 2EEIA 5FHTA 4AMHA 4Q2QA 1VCWA 5HFDA 3I18A 5HEDA 3DJAA 4Q2OA 5GLJA 3DJ1A 1UJUA 3GSLA 4HOPA 1UEWA 4XHVA 2EEHA 2L4SA 2KYLA 2PKUA 3NFKA 2PNTA 5G1EA 2Z17A 2LA8A 2OPGA 5HFBA 1WHDA 4NXQA 5ILBA 1IU2A 3KDKA 3R69A 1X5RA 4HOPB 2W4FA 2AINA 2G5MB 3TSWA 1L6OA 2EDPA 4R2ZA 3GDUA 1WFVA 2ZPMA 2KAWA 3KZDA 4Q2PA 2GZVA 3CH8A 2DLUA 2LC7A 1TP5A 2H3MA 2E7KA 2JSNA 3TSVA 1WIFA 2W7RA 1VA8A 2PA1A 1WH1A 3VQGA 2DMZA 2M10A 2WL7A 4JJ0A 2EV8A 1N7FA 5F3XA 4E35A 3CS0A 2EGOA 2QKUA 2LUIA 2VSVA 1KY9A 1KWAA 5JXBA 2MX6A 1RGWA 3ID3A 4WYUA 3GJ9A 5HDYA 1V1TA 2YT8A 1RGRA 1Q3PA 2KQFA 2I0IA 2VZ5A 1X45A 2KOHA 2R4HA 3DIWA 3MH6A 2ZPLA 2CSJA 2KA9A 1D5GA 1V6BA 1VB7A 2FCFA 3LNYA 1V5LA 1Y7NA 3L4FD 1N6FA 2BYGA 4RI0A 2EEJA 3WKMA 4GVDA 4Q6HA 2QT5A 1FC7A 2AWWA 2QBWA 2HE4A 2Q9VA 5A2PA 1RZXA 1VAEA 3MH4A 3PV2A 5HJ1A 2OCSA 5E1YA 2IWOA 1V62A 4FLNA 3VQFA 4NMTA 3DORA 4LMMA 1N6DA 2QKVA 1UITA 3GGEA 2YUBA 4NMOA 2IWNA 2MHOA 5DTHA 1GM1A 1YBOA 1Q3OA 1XZ9A 1UHPA 2KOMA 3QE1A 4KFVA 2OQSA 4JOHA 5E21A 3CYYA 1FC9A 4Q6SA 1SOTA 1VJ6A 2OMJA 4NXRA 3DJ3A 4F8KA 2KL1A 5HETA 4YDPA 2DAZA 3GABA 3TMHA 2V1WA 1WFGA 1X5QA 5B6LA 3GDVA 2I04A 5B42A 4UU5A 2EAQA 3QJMA 1UFXA 2QG1A 1NTEA 1OBYA 2R3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJ3 A;  4JJ0 A; 
#chains in the Genus database with same CATH topology
 3SOE A;  1BFE A;  2KJD A;  1W9O A;  3R0H A;  3HVQ C;  2H2B A;  4KFW A;  4NNL A;  1UEP A;  5H3J A;  2VRF A;  1I16 A;  2O2T A;  3R68 A;  2DM8 A;  3OTP A;  4JOF A;  2DLS A;  2F0A A;  3FY5 A;  2I1N A;  1NF3 C;  3QIK A;  1X9Z A;  3LNX A;  2I0L A;  4G69 A;  2LOB A;  3PV5 A;  4JOJ A;  2VPH A;  1UEZ A;  2IWP A;  1G9O A;  3QGL A;  2YUY A;  1ZOK A;  2OSG A;  3BPU A;  4NMV A;  2H2C A;  4PQW A;  2KOJ A;  2Z9I A;  3E17 A;  1MC7 A;  3MH7 A;  5EYZ A;  4GVC A;  2H3L A;  2YTW A;  1SOZ A;  3CBZ A;  2GEF A;  2L4T A;  2CSS A;  2EDV A;  2KJP A;  2DJT A;  2FE5 A;  2EJY A;  4OEP A;  5GND A;  1WG6 A;  4Z8J A;  4JOG A;  2UZC A;  3K50 A;  4JOE A;  4Z33 A;  1UEQ A;  3CC0 A;  2KG2 A;  3ID2 A;  4FGM A;  2M0Z A;  2JRE A;  1UF1 A;  2M0T A;  2DC2 A;  1Z87 A;  4OAJ A;  1ZUB A;  2DB5 A;  5I7Z A;  4NMS A;  3OU0 A;  1OBX A;  3EGG C;  1K32 A;  2AWX A;  2AWU A;  5HEY A;  4Q3H A;  3ZRT A;  5EZ0 A;  2HGA A;  2PDZ A;  3SHU A;  4JOP A;  2KPK A;  4IC6 A;  1Y8T A;  4Q2N A;  4E3B A;  4JL7 A;  2KPL A;  1OZI A;  2X7Z A;  3TSZ A;  5HF1 A;  1QAV A;  5E11 A;  1LCY A;  2EGK A;  1Q7X A;  2G2L A;  3PDV A;  3WKL A;  3SUZ A;  2DKR A;  1V5Q A;  4UU6 A;  2D90 A;  1UM7 A;  2ENO A;  1T2M A;  2OGP A;  2KRG A;  3GCN A;  3QJN A;  2KJK A;  3ID1 A;  2REY A;  2JIL A;  5FB8 C;  5E6P B;  4E34 A;  2L97 A;  3NGH A;  1TQ3 A;  1N99 A;  1TE0 A;  1QAV B;  4P2A B;  3ID4 A;  3RL8 A;  2I6V A;  2I4S A;  1PDR A;  1FCF A;  3K1R A;  1U39 A;  1WI2 A;  3O46 A;  1QAU A;  1WHA A;  2M0V A;  3KHF A;  4O06 A;  1IU0 A;  2LC6 A;  3PV4 A;  2RRM A;  3SFJ A;  1X5N A;  3AXA A;  2KBS A;  1IHJ A;  1W9Q A;  3EGH C;  3SHW A;  5HFF A;  2D8I A;  4REY A;  1W9E A;  1GQ4 A;  3I1E A;  4NMP A;  4K6Y A;  5HF4 A;  1WF8 A;  1N7T A;  1FC6 A;  1N7E A;  3CBY A;  4JOR A;  4NNM A;  4NXP A;  3KZE A;  3HPK A;  1X8S A;  4JOK A;  2JXO A;  2JOA A;  4K76 A;  2FNE A;  3PDZ A;  4YYX A;  4JJ3 A;  2M3M A;  3NFL A;  3RLE A;  2EDZ A;  2VWR A;  1B8Q A;  2JIK A;  2EEG A;  1WF7 A;  4K75 A;  2M0U A;  1I92 A;  2KV8 A;  2PKT A;  1WJL A;  4H11 A;  3QDO A;  1M5Z A;  1UJV A;  1BE9 A;  3GDS A;  5E22 A;  2OS6 A;  2FN5 A;  4K72 A;  3O5N A;  5D13 A;  3JXT A;  4N6X A;  2Q3G A;  4EDJ A;  2OZF A;  2K1Z A;  4GHN A;  1GQ5 A;  1QLC A;  5HFE A;  3STJ A;  5HEB A;  5F67 A;  4NMR A;  1UM1 A;  3PS4 A;  5IL9 A;  3NCV A;  3K82 A;  2V90 A;  2D92 A;  3CBX A;  1Z86 A;  3B76 A;  1RY4 A;  1N6E A;  3I4W A;  1P1D A;  2QKT A;  4OEO A;  2JWE A;  1R6J A;  2F5Y A;  1WI4 A;  1X6D A;  4NMQ A;  4L8N A;  4P0C A;  4MPA A;  4WYT A;  1UJD A;  1MFL A;  2CS5 A;  3KDG A;  3QO6 A;  5G1D A;  1U3B A;  2HE2 A;  2EGN A;  2EXG A;  2VSP A;  1KEF A;  3GCO A;  2P3W A;  1MFG A;  4K78 A;  2JIN A;  1TP3 A;  3RL7 A;  1OBZ A;  5HFC A;  1U37 A;  2EHR A;  1P1E A;  2K20 A;  2RCZ A;  2PZD A;  1U38 A;  2IWQ A;  3HPM A;  2YT7 A;  2EEI A;  5FHT A;  4AMH A;  4Q2Q A;  1VCW A;  5HFD A;  3I18 A;  5HED A;  3DJA A;  4Q2O A;  5GLJ A;  3DJ1 A;  1UJU A;  3GSL A;  4HOP A;  1UEW A;  4XHV A;  2EEH A;  2L4S A;  2KYL A;  2PKU A;  3NFK A;  2PNT A;  5G1E A;  2Z17 A;  2LA8 A;  2OPG A;  5HFB A;  1WHD A;  4NXQ A;  5ILB A;  1IU2 A;  3KDK A;  3R69 A;  1X5R A;  4HOP B;  2W4F A;  2AIN A;  2G5M B;  3TSW A;  1L6O A;  2EDP A;  4R2Z A;  3GDU A;  1WFV A;  2ZPM A;  2KAW A;  3KZD A;  4Q2P A;  2GZV A;  3CH8 A;  2DLU A;  2LC7 A;  1TP5 A;  2H3M A;  2E7K A;  2JSN A;  3TSV A;  1WIF A;  2W7R A;  1VA8 A;  2PA1 A;  1WH1 A;  3VQG A;  2DMZ A;  2M10 A;  2WL7 A;  4JJ0 A;  2EV8 A;  1N7F A;  5F3X A;  4E35 A;  3CS0 A;  2EGO A;  2QKU A;  2LUI A;  2VSV A;  1KY9 A;  1KWA A;  5JXB A;  2MX6 A;  1RGW A;  3ID3 A;  4WYU A;  3GJ9 A;  5HDY A;  1V1T A;  2YT8 A;  1RGR A;  1Q3P A;  2KQF A;  2I0I A;  2VZ5 A;  1X45 A;  2KOH A;  2R4H A;  3DIW A;  3MH6 A;  2ZPL A;  2CSJ A;  2KA9 A;  1D5G A;  1V6B A;  1VB7 A;  2FCF A;  3LNY A;  1V5L A;  1Y7N A;  3L4F D;  1N6F A;  2BYG A;  4RI0 A;  2EEJ A;  3WKM A;  4GVD A;  4Q6H A;  2QT5 A;  1FC7 A;  2AWW A;  2QBW A;  2HE4 A;  2Q9V A;  5A2P A;  1RZX A;  1VAE A;  3MH4 A;  3PV2 A;  5HJ1 A;  2OCS A;  5E1Y A;  2IWO A;  1V62 A;  4FLN A;  3VQF A;  4NMT A;  3DOR A;  4LMM A;  1N6D A;  2QKV A;  1UIT A;  3GGE A;  2YUB A;  4NMO A;  2IWN A;  2MHO A;  5DTH A;  1GM1 A;  1YBO A;  1Q3O A;  1XZ9 A;  1UHP A;  2KOM A;  3QE1 A;  4KFV A;  2OQS A;  4JOH A;  5E21 A;  3CYY A;  1FC9 A;  4Q6S A;  1SOT A;  1VJ6 A;  2OMJ A;  4NXR A;  3DJ3 A;  4F8K A;  2KL1 A;  5HET A;  4YDP A;  2DAZ A;  3GAB A;  3TMH A;  2V1W A;  1WFG A;  1X5Q A;  5B6L A;  3GDV A;  2I04 A;  5B42 A;  4UU5 A;  2EAQ A;  3QJM A;  1UFX A;  2QG1 A;  1NTE A;  1OBY A;  2R3Y A; 
#chains in the Genus database with same CATH homology
 3SOE A;  1BFE A;  2KJD A;  1W9O A;  3R0H A;  3HVQ C;  2H2B A;  4KFW A;  4NNL A;  1UEP A;  5H3J A;  2VRF A;  1I16 A;  2O2T A;  3R68 A;  2DM8 A;  3OTP A;  4JOF A;  2DLS A;  2F0A A;  3FY5 A;  2I1N A;  1NF3 C;  3QIK A;  1X9Z A;  3LNX A;  2I0L A;  4G69 A;  2LOB A;  3PV5 A;  4JOJ A;  2VPH A;  1UEZ A;  2IWP A;  1G9O A;  3QGL A;  2YUY A;  1ZOK A;  2OSG A;  3BPU A;  4NMV A;  2H2C A;  4PQW A;  2KOJ A;  2Z9I A;  3E17 A;  1MC7 A;  3MH7 A;  5EYZ A;  4GVC A;  2H3L A;  2YTW A;  1SOZ A;  3CBZ A;  2GEF A;  2L4T A;  2CSS A;  2EDV A;  2KJP A;  2DJT A;  2FE5 A;  2EJY A;  4OEP A;  5GND A;  1WG6 A;  4Z8J A;  4JOG A;  2UZC A;  3K50 A;  4JOE A;  4Z33 A;  1UEQ A;  3CC0 A;  2KG2 A;  3ID2 A;  4FGM A;  2M0Z A;  2JRE A;  1UF1 A;  2M0T A;  2DC2 A;  1Z87 A;  4OAJ A;  1ZUB A;  2DB5 A;  5I7Z A;  4NMS A;  3OU0 A;  1OBX A;  3EGG C;  1K32 A;  2AWX A;  2AWU A;  5HEY A;  4Q3H A;  3ZRT A;  5EZ0 A;  2HGA A;  2PDZ A;  3SHU A;  4JOP A;  2KPK A;  4IC6 A;  1Y8T A;  4Q2N A;  4E3B A;  4JL7 A;  2KPL A;  1OZI A;  2X7Z A;  3TSZ A;  5HF1 A;  1QAV A;  5E11 A;  1LCY A;  2EGK A;  1Q7X A;  2G2L A;  3PDV A;  3WKL A;  3SUZ A;  2DKR A;  1V5Q A;  4UU6 A;  2D90 A;  1UM7 A;  2ENO A;  1T2M A;  2OGP A;  2KRG A;  3GCN A;  3QJN A;  2KJK A;  3ID1 A;  2REY A;  2JIL A;  5FB8 C;  5E6P B;  4E34 A;  2L97 A;  3NGH A;  1TQ3 A;  1N99 A;  1TE0 A;  1QAV B;  4P2A B;  3ID4 A;  3RL8 A;  2I6V A;  2I4S A;  1PDR A;  1FCF A;  3K1R A;  1U39 A;  1WI2 A;  3O46 A;  1QAU A;  1WHA A;  2M0V A;  3KHF A;  4O06 A;  1IU0 A;  2LC6 A;  3PV4 A;  2RRM A;  3SFJ A;  1X5N A;  3AXA A;  2KBS A;  1IHJ A;  1W9Q A;  3EGH C;  3SHW A;  5HFF A;  2D8I A;  4REY A;  1W9E A;  1GQ4 A;  3I1E A;  4NMP A;  4K6Y A;  5HF4 A;  1WF8 A;  1N7T A;  1FC6 A;  1N7E A;  3CBY A;  4JOR A;  4NNM A;  4NXP A;  3KZE A;  3HPK A;  1X8S A;  4JOK A;  2JXO A;  2JOA A;  4K76 A;  2FNE A;  3PDZ A;  4YYX A;  4JJ3 A;  2M3M A;  3NFL A;  3RLE A;  2EDZ A;  2VWR A;  1B8Q A;  2JIK A;  2EEG A;  1WF7 A;  4K75 A;  2M0U A;  1I92 A;  2KV8 A;  2PKT A;  1WJL A;  4H11 A;  3QDO A;  1M5Z A;  1UJV A;  1BE9 A;  3GDS A;  5E22 A;  2OS6 A;  2FN5 A;  4K72 A;  3O5N A;  5D13 A;  3JXT A;  4N6X A;  2Q3G A;  4EDJ A;  2OZF A;  2K1Z A;  4GHN A;  1GQ5 A;  1QLC A;  5HFE A;  3STJ A;  5HEB A;  5F67 A;  4NMR A;  1UM1 A;  3PS4 A;  5IL9 A;  3NCV A;  3K82 A;  2V90 A;  2D92 A;  3CBX A;  1Z86 A;  3B76 A;  1RY4 A;  1N6E A;  3I4W A;  1P1D A;  2QKT A;  4OEO A;  2JWE A;  1R6J A;  2F5Y A;  1WI4 A;  1X6D A;  4NMQ A;  4L8N A;  4P0C A;  4MPA A;  4WYT A;  1UJD A;  1MFL A;  2CS5 A;  3KDG A;  3QO6 A;  5G1D A;  1U3B A;  2HE2 A;  2EGN A;  2EXG A;  2VSP A;  1KEF A;  3GCO A;  2P3W A;  1MFG A;  4K78 A;  2JIN A;  1TP3 A;  3RL7 A;  1OBZ A;  5HFC A;  1U37 A;  2EHR A;  1P1E A;  2K20 A;  2RCZ A;  2PZD A;  1U38 A;  2IWQ A;  3HPM A;  2YT7 A;  2EEI A;  5FHT A;  4AMH A;  4Q2Q A;  1VCW A;  5HFD A;  3I18 A;  5HED A;  3DJA A;  4Q2O A;  5GLJ A;  3DJ1 A;  1UJU A;  3GSL A;  4HOP A;  1UEW A;  4XHV A;  2EEH A;  2L4S A;  2KYL A;  2PKU A;  3NFK A;  2PNT A;  5G1E A;  2Z17 A;  2LA8 A;  2OPG A;  5HFB A;  1WHD A;  4NXQ A;  5ILB A;  1IU2 A;  3KDK A;  3R69 A;  1X5R A;  4HOP B;  2W4F A;  2AIN A;  2G5M B;  3TSW A;  1L6O A;  2EDP A;  4R2Z A;  3GDU A;  1WFV A;  2ZPM A;  2KAW A;  3KZD A;  4Q2P A;  2GZV A;  3CH8 A;  2DLU A;  2LC7 A;  1TP5 A;  2H3M A;  2E7K A;  2JSN A;  3TSV A;  1WIF A;  2W7R A;  1VA8 A;  2PA1 A;  1WH1 A;  3VQG A;  2DMZ A;  2M10 A;  2WL7 A;  4JJ0 A;  2EV8 A;  1N7F A;  5F3X A;  4E35 A;  3CS0 A;  2EGO A;  2QKU A;  2LUI A;  2VSV A;  1KY9 A;  1KWA A;  5JXB A;  2MX6 A;  1RGW A;  3ID3 A;  4WYU A;  3GJ9 A;  5HDY A;  1V1T A;  2YT8 A;  1RGR A;  1Q3P A;  2KQF A;  2I0I A;  2VZ5 A;  1X45 A;  2KOH A;  2R4H A;  3DIW A;  3MH6 A;  2ZPL A;  2CSJ A;  2KA9 A;  1D5G A;  1V6B A;  1VB7 A;  2FCF A;  3LNY A;  1V5L A;  1Y7N A;  3L4F D;  1N6F A;  2BYG A;  4RI0 A;  2EEJ A;  3WKM A;  4GVD A;  4Q6H A;  2QT5 A;  1FC7 A;  2AWW A;  2QBW A;  2HE4 A;  2Q9V A;  5A2P A;  1RZX A;  1VAE A;  3MH4 A;  3PV2 A;  5HJ1 A;  2OCS A;  5E1Y A;  2IWO A;  1V62 A;  4FLN A;  3VQF A;  4NMT A;  3DOR A;  4LMM A;  1N6D A;  2QKV A;  1UIT A;  3GGE A;  2YUB A;  4NMO A;  2IWN A;  2MHO A;  5DTH A;  1GM1 A;  1YBO A;  1Q3O A;  1XZ9 A;  1UHP A;  2KOM A;  3QE1 A;  4KFV A;  2OQS A;  4JOH A;  5E21 A;  3CYY A;  1FC9 A;  4Q6S A;  1SOT A;  1VJ6 A;  2OMJ A;  4NXR A;  3DJ3 A;  4F8K A;  2KL1 A;  5HET A;  4YDP A;  2DAZ A;  3GAB A;  3TMH A;  2V1W A;  1WFG A;  1X5Q A;  5B6L A;  3GDV A;  2I04 A;  5B42 A;  4UU5 A;  2EAQ A;  3QJM A;  1UFX A;  2QG1 A;  1NTE A;  1OBY A;  2R3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...