1UEWA

Solution structure of the forth pdz domain of human atrophin-1 interacting protein 1 (kiaa0705 protein)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
GSSGSSGSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE ASSOCIATED GUANYLATE KINASE INVERTED-2 (MAGI-2)
publication title Solution Structure of The forth PDZ Domain of Human Atrophin-1 Interacting Protein 1 (KIAA0705 Protein)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1uewA00
2VSVA 4NMTA 3HPMA 2HE4A 2YUYA 2KL1A 1Q3OA 2EGNA 4OAJA 2O2TA 3RL8A 2IWNA 2KOHA 2DB5A 2L4TA 2M0UA 1PDRA 1OBZA 2YUBA 3KZDA 4JL7A 3ZRTA 1TQ3A 3PV5A 2X7ZA 3EGHC 5HJ1A 4O06A 1VCWA 2EHRA 2I1NA 1VB7A 3WKLA 4F8KA 5E1YA 5GLJA 2OZFA 2L97A 3OU0A 1UITA 3SHWA 2G5MB 1X8SA 2KPKA 2M0ZA 3R0HA 1WI2A 4NXPA 1KWAA 1UJVA 2G2LA 1N7EA 4KFWA 1N6FA 2KRGA 5GNDA 1N6EA 1OBXA 1GQ4A 2AWXA 4Z33A 4NMPA 2OCSA 2OGPA 1M5ZA 2DM8A 2JILA 1WF7A 3CBZA 4Q2NA 2FN5A 2DC2A 5G1DA 2EGKA 3CBYA 2H2BA 5HEDA 3ID1A 3TMHA 2Z9IA 2UZCA 1WIFA 3ID3A 5F67A 2VRFA 4JORA 2K20A 4K75A 2KJDA 4HOPB 5E11A 4P2AB 4NNMA 3MH7A 2R3YA 4Q6HA 2Q3GA 1UHPA 4NXRA 3L4FD 1VA8A 2CSJA 1U39A 3GDSA 3QJNA 1UM1A 1LCYA 4Q2QA 5E6PB 3QDOA 2FCFA 2KOJA 1W9EA 1WG6A 1N7FA 2PNTA 1SOTA 2RRMA 1KY9A 4Q2OA 2QKVA 4NMRA 3PV4A 5FB8C 2OSGA 1N6DA 1UEZA 3DJ1A 2I6VA 2PKUA 2YT8A 4PQWA 2DJTA 4GVCA 2ZPLA 2LC6A 3VQFA 3GGEA 3QE1A 1UFXA 2M10A 1TE0A 4E35A 2KJKA 4NMOA 2EEGA 4UU6A 3DJAA 1FC9A 1P1DA 1XZ9A 4YYXA 1SOZA 2KAWA 1QAVB 2PDZA 2W4FA 2AWUA 1U37A 1Y7NA 2KA9A 2D8IA 3K82A 4P0CA 3R69A 1X5NA 2FNEA 2LA8A 2MX6A 1V6BA 1GQ5A 4JOGA 2GZVA 1P1EA 3GSLA 3ID4A 2VWRA 5B6LA 4HOPA 1R6JA 2H3MA 5E22A 4H11A 2VSPA 1Z87A 3RL7A 2QKUA 4NMSA 3CC0A 3SHUA 2AINA 2OQSA 3SUZA 3DJ3A 1MC7A 2P3WA 5HFBA 4RI0A 4JOJA 4G69A 2YTWA 4WYTA 4FGMA 2Q9VA 1RZXA 4JOKA 2F5YA 3BPUA 2V90A 2DMZA 2ZPMA 1KEFA 3CS0A 3R68A 5HFFA 4K72A 2I04A 2RCZA 4IC6A 1FC6A 1N7TA 4JOPA 1QAVA 1RGWA 4NMQA 2W7RA 1X5RA 3PDZA 2JREA 4OEOA 2I0IA 1UJDA 2BYGA 3CH8A 3TSZA 5HFEA 3QGLA 3VQGA 3NFLA 4K78A 2KV8A 2I4SA 3ID2A 5DTHA 4AMHA 5G1EA 4GVDA 1Q7XA 3K50A 1X5QA 3DIWA 3GJ9A 3MH4A 1OZIA 1YBOA 3GDVA 1V5QA 5HETA 2KYLA 3NGHA 2D90A 2DLSA 1RY4A 3QJMA 3E17A 3WKMA 1Z86A 3I18A 2ENOA 3SOEA 2PA1A 1G9OA 5HEBA 4K76A 1OBYA 3MH6A 1VJ6A 2E7KA 2YT7A 3I4WA 5F3XA 1BFEA 2IWOA 3NFKA 1WHAA 2KOMA 3FY5A 2OS6A 4Q6SA 1U3BA 2D92A 1IU0A 2LUIA 2QBWA 1B8QA 2HGAA 3LNYA 5H3JA 2DAZA 3HVQC 3QIKA 2H2CA 5HF4A 2EDPA 2KG2A 2WL7A 4Q2PA 3LNXA 1ZUBA 3CYYA 2KBSA 1WFVA 2PKTA 2EEHA 2EXGA 2OMJA 1I92A 2MHOA 1ZOKA 2H3LA 4OEPA 2L4SA 3GCOA 5JXBA 3O46A 2QT5A 2EJYA 4N6XA 1UM7A 1VAEA 3I1EA 1IU2A 2V1WA 3O5NA 1UF1A 1K32A 2IWPA 1TP5A 2CS5A 2M0TA 1NTEA 2AWWA 5HEYA 3HPKA 3AXAA 3KHFA 2IWQA 5HFCA 1UEQA 5E21A 2EDVA 4E3BA 4JOFA 1GM1A 4Q3HA 2JXOA 2K1ZA 1W9QA 1Q3PA 2Z17A 1FC7A 4E34A 5I7ZA 3STJA 2PZDA 1UEPA 2EGOA 1QLCA 1X45A 4WYUA 3DORA 2QG1A 4EDJA 1WH1A 1UJUA 4MPAA 4NXQA 2R4HA 4K6YA 4JOHA 2OPGA 3OTPA 2DKRA 1WHDA 2M0VA 3CBXA 3PDVA 1WI4A 2M3MA 2JINA 4L8NA 1V62A 5D13A 3KZEA 2I0LA 2VPHA 1MFGA 5FHTA 2FE5A 2EDZA 1V5LA 4JOEA 3EGGC 1U38A 2LOBA 1D5GA 3GDUA 3SFJA 5A2PA 3PV2A 2KQFA 4GHNA 3QO6A 2HE2A 4KFVA 1IHJA 2JIKA 2CSSA 1BE9A 2JWEA 4LMMA 2QKTA 3RLEA 4REYA 3K1RA 2EV8A 4NMVA 1N99A 4Z8JA 4NNLA 5HDYA 1MFLA 2EEJA 2DLUA 4XHVA 3TSWA 2KPLA 1I16A 4YDPA 4UU5A 2VZ5A 2EAQA 3JXTA 3GCNA 2EEIA 5HF1A 1WF8A 1UEWA 1Y8TA 3B76A 5EZ0A 1RGRA 1TP3A 2F0AA 4R2ZA 1X6DA 2JOAA 2REYA 1WFGA 3TSVA 3PS4A 1T2MA 2LC7A 2KJPA 1L6OA 1WJLA 1FCFA 1W9OA 5EYZA 1NF3C 1V1TA 1QAUA 5HFDA
chains in the Genus database with same CATH superfamily
2VSVA 4NMTA 3HPMA 2HE4A 2YUYA 2KL1A 1Q3OA 2EGNA 4OAJA 2O2TA 3RL8A 2IWNA 2KOHA 2DB5A 2L4TA 2M0UA 3NCVA 1PDRA 1OBZA 2YUBA 3KZDA 4JL7A 3ZRTA 1TQ3A 3PV5A 2X7ZA 3EGHC 5HJ1A 4O06A 1VCWA 2EHRA 2I1NA 1VB7A 3WKLA 4F8KA 5E1YA 5GLJA 2OZFA 2L97A 3OU0A 1UITA 3SHWA 2G5MB 1X8SA 2KPKA 2M0ZA 3R0HA 1WI2A 4NXPA 1KWAA 1UJVA 2G2LA 4FLNA 1N7EA 4KFWA 1N6FA 2KRGA 5GNDA 1N6EA 1OBXA 1GQ4A 2AWXA 4Z33A 4NMPA 2OCSA 2OGPA 1M5ZA 2DM8A 2JILA 1WF7A 3CBZA 4Q2NA 2FN5A 2DC2A 5G1DA 2EGKA 3CBYA 2H2BA 5HEDA 3ID1A 3TMHA 2Z9IA 2UZCA 1WIFA 3ID3A 5F67A 2VRFA 4JORA 2K20A 4K75A 2KJDA 4HOPB 5E11A 4P2AB 4NNMA 3MH7A 2R3YA 4Q6HA 2Q3GA 1UHPA 4NXRA 3L4FD 1VA8A 2CSJA 1U39A 3GDSA 3QJNA 4JJ3A 1UM1A 1LCYA 4Q2QA 5E6PB 3QDOA 2FCFA 2KOJA 1W9EA 1WG6A 1N7FA 2JSNA 2PNTA 1SOTA 2RRMA 1KY9A 4Q2OA 2QKVA 4NMRA 1X9ZA 3PV4A 5FB8C 2OSGA 1N6DA 1UEZA 3DJ1A 2I6VA 2PKUA 2YT8A 4JJ0A 4PQWA 2DJTA 4GVCA 2ZPLA 2LC6A 3VQFA 3GGEA 3QE1A 1UFXA 2M10A 1TE0A 4E35A 2KJKA 4NMOA 2EEGA 4UU6A 3DJAA 1FC9A 1P1DA 1XZ9A 4YYXA 1SOZA 2KAWA 1QAVB 2PDZA 2W4FA 2AWUA 1U37A 1Y7NA 2KA9A 2D8IA 3K82A 4P0CA 3R69A 1X5NA 2FNEA 2LA8A 2MX6A 1V6BA 1GQ5A 4JOGA 2GZVA 1P1EA 3GSLA 3ID4A 2VWRA 5B6LA 4HOPA 1R6JA 2H3MA 5E22A 4H11A 3KDKA 2VSPA 1Z87A 3RL7A 2QKUA 4NMSA 3CC0A 3SHUA 2AINA 2OQSA 3SUZA 3DJ3A 1MC7A 2P3WA 5HFBA 4RI0A 4JOJA 4G69A 2YTWA 4WYTA 4FGMA 2Q9VA 1RZXA 4JOKA 2F5YA 3BPUA 2V90A 2DMZA 2ZPMA 1KEFA 3CS0A 3R68A 5HFFA 4K72A 2I04A 2RCZA 4IC6A 1FC6A 1N7TA 4JOPA 1QAVA 1RGWA 4NMQA 2W7RA 1X5RA 3PDZA 2JREA 4OEOA 2I0IA 1UJDA 2BYGA 3CH8A 3TSZA 5HFEA 3QGLA 3VQGA 3NFLA 4K78A 2KV8A 2I4SA 3ID2A 5DTHA 4AMHA 5G1EA 4GVDA 1Q7XA 3K50A 1X5QA 3DIWA 3GABA 3GJ9A 1OZIA 3MH4A 1YBOA 3GDVA 1V5QA 5HETA 2KYLA 3NGHA 2D90A 2DLSA 1RY4A 3QJMA 3KDGA 3E17A 3WKMA 1Z86A 5IL9A 3I18A 2ENOA 3SOEA 2PA1A 1G9OA 5HEBA 4K76A 1OBYA 3MH6A 1VJ6A 2E7KA 2YT7A 3I4WA 5F3XA 1BFEA 2IWOA 3NFKA 1WHAA 2KOMA 3FY5A 2OS6A 4Q6SA 1U3BA 2D92A 1IU0A 2LUIA 2QBWA 1B8QA 2HGAA 3LNYA 5B42A 5H3JA 2DAZA 3HVQC 3QIKA 2H2CA 5HF4A 2EDPA 2KG2A 2WL7A 4Q2PA 3LNXA 1ZUBA 3CYYA 2KBSA 1WFVA 2PKTA 2EEHA 2EXGA 2OMJA 1I92A 2MHOA 1ZOKA 2H3LA 4OEPA 2L4SA 3GCOA 5JXBA 3O46A 2QT5A 2EJYA 4N6XA 1UM7A 1VAEA 3I1EA 1IU2A 2V1WA 3O5NA 1UF1A 1K32A 2IWPA 1TP5A 2CS5A 2M0TA 1NTEA 2AWWA 5HEYA 3HPKA 3AXAA 3KHFA 2IWQA 5HFCA 1UEQA 5E21A 2EDVA 4E3BA 4JOFA 1GM1A 4Q3HA 2JXOA 2K1ZA 1W9QA 1Q3PA 2Z17A 1FC7A 4E34A 5I7ZA 3STJA 2PZDA 1UEPA 2EGOA 1QLCA 1X45A 4WYUA 3DORA 2QG1A 4EDJA 1WH1A 1UJUA 4MPAA 4NXQA 2R4HA 4K6YA 4JOHA 2OPGA 3OTPA 2DKRA 1WHDA 2M0VA 3CBXA 3PDVA 1WI4A 2M3MA 2JINA 4L8NA 1V62A 5D13A 3KZEA 2I0LA 2VPHA 1MFGA 5FHTA 2FE5A 2EDZA 1V5LA 4JOEA 3EGGC 1U38A 2LOBA 1D5GA 3GDUA 3SFJA 5ILBA 5A2PA 3PV2A 2KQFA 4GHNA 3QO6A 2HE2A 4KFVA 1IHJA 2JIKA 2CSSA 1BE9A 2JWEA 4LMMA 2QKTA 3RLEA 4REYA 3K1RA 2EV8A 4NMVA 1N99A 4Z8JA 4NNLA 5HDYA 1MFLA 2EEJA 2DLUA 4XHVA 3TSWA 2KPLA 1I16A 4YDPA 4UU5A 2VZ5A 2EAQA 3JXTA 3GCNA 2EEIA 5HF1A 1WF8A 2GEFA 1UEWA 1Y8TA 3B76A 5EZ0A 1RGRA 1TP3A 2F0AA 4R2ZA 1X6DA 2JOAA 2REYA 1WFGA 3TSVA 3PS4A 1T2MA 2LC7A 2KJPA 1L6OA 1WJLA 1FCFA 1W9OA 5EYZA 1NF3C 1V1TA 1QAUA 5HFDA
chains in the Genus database with same CATH topology
2VSVA 4NMTA 3HPMA 2HE4A 2YUYA 2KL1A 1Q3OA 2EGNA 4OAJA 2O2TA 3RL8A 2IWNA 2KOHA 2DB5A 2L4TA 2M0UA 3NCVA 1PDRA 1OBZA 2YUBA 3KZDA 4JL7A 3ZRTA 1TQ3A 3PV5A 2X7ZA 3EGHC 5HJ1A 4O06A 1VCWA 2EHRA 2I1NA 1VB7A 3WKLA 4F8KA 5E1YA 5GLJA 2OZFA 2L97A 3OU0A 1UITA 3SHWA 2G5MB 1X8SA 2KPKA 2M0ZA 3R0HA 1WI2A 4NXPA 1KWAA 1UJVA 2G2LA 4FLNA 1N7EA 4KFWA 1N6FA 2KRGA 5GNDA 1N6EA 1OBXA 1GQ4A 2AWXA 4Z33A 4NMPA 2OCSA 2OGPA 1M5ZA 2DM8A 2JILA 1WF7A 3CBZA 4Q2NA 2FN5A 2DC2A 5G1DA 2EGKA 3CBYA 2H2BA 5HEDA 3ID1A 3TMHA 2Z9IA 2UZCA 1WIFA 3ID3A 5F67A 2VRFA 4JORA 2K20A 4K75A 2KJDA 4HOPB 5E11A 4P2AB 4NNMA 3MH7A 2R3YA 4Q6HA 2Q3GA 1UHPA 4NXRA 3L4FD 1VA8A 2CSJA 1U39A 3GDSA 3QJNA 4JJ3A 1UM1A 1LCYA 4Q2QA 5E6PB 3QDOA 2FCFA 2KOJA 1W9EA 1WG6A 1N7FA 2JSNA 2PNTA 1SOTA 2RRMA 1KY9A 4Q2OA 2QKVA 4NMRA 1X9ZA 3PV4A 5FB8C 2OSGA 1N6DA 1UEZA 3DJ1A 2I6VA 2PKUA 2YT8A 4JJ0A 4PQWA 2DJTA 4GVCA 2ZPLA 2LC6A 3VQFA 3GGEA 3QE1A 1UFXA 2M10A 1TE0A 4E35A 2KJKA 4NMOA 2EEGA 4UU6A 3DJAA 1FC9A 1P1DA 1XZ9A 4YYXA 1SOZA 2KAWA 1QAVB 2PDZA 2W4FA 2AWUA 1U37A 1Y7NA 2KA9A 2D8IA 3K82A 4P0CA 3R69A 1X5NA 2FNEA 2LA8A 2MX6A 1V6BA 1GQ5A 4JOGA 2GZVA 1P1EA 3GSLA 3ID4A 2VWRA 5B6LA 4HOPA 1R6JA 2H3MA 5E22A 4H11A 3KDKA 2VSPA 1Z87A 3RL7A 2QKUA 4NMSA 3CC0A 3SHUA 2AINA 2OQSA 3SUZA 3DJ3A 1MC7A 2P3WA 5HFBA 4RI0A 4JOJA 4G69A 2YTWA 4WYTA 4FGMA 2Q9VA 1RZXA 4JOKA 2F5YA 3BPUA 2V90A 2DMZA 2ZPMA 1KEFA 3CS0A 3R68A 5HFFA 4K72A 2I04A 2RCZA 4IC6A 1FC6A 1N7TA 4JOPA 1QAVA 1RGWA 4NMQA 2W7RA 1X5RA 3PDZA 2JREA 4OEOA 2I0IA 1UJDA 2BYGA 3CH8A 3TSZA 5HFEA 3QGLA 3VQGA 3NFLA 4K78A 2KV8A 2I4SA 3ID2A 5DTHA 4AMHA 5G1EA 4GVDA 1Q7XA 3K50A 1X5QA 3DIWA 3GABA 3GJ9A 1OZIA 3MH4A 1YBOA 3GDVA 1V5QA 5HETA 2KYLA 3NGHA 2D90A 2DLSA 1RY4A 3QJMA 3KDGA 3E17A 3WKMA 1Z86A 5IL9A 3I18A 2ENOA 3SOEA 2PA1A 1G9OA 5HEBA 4K76A 1OBYA 3MH6A 1VJ6A 2E7KA 2YT7A 3I4WA 5F3XA 1BFEA 2IWOA 3NFKA 1WHAA 2KOMA 3FY5A 2OS6A 4Q6SA 1U3BA 2D92A 1IU0A 2LUIA 2QBWA 1B8QA 2HGAA 3LNYA 5B42A 5H3JA 2DAZA 3HVQC 3QIKA 2H2CA 5HF4A 2EDPA 2KG2A 2WL7A 4Q2PA 3LNXA 1ZUBA 3CYYA 2KBSA 1WFVA 2PKTA 2EEHA 2EXGA 2OMJA 1I92A 2MHOA 1ZOKA 2H3LA 4OEPA 2L4SA 3GCOA 5JXBA 3O46A 2QT5A 2EJYA 4N6XA 1UM7A 1VAEA 3I1EA 1IU2A 2V1WA 3O5NA 1UF1A 1K32A 2IWPA 1TP5A 2CS5A 2M0TA 1NTEA 2AWWA 5HEYA 3HPKA 3AXAA 3KHFA 2IWQA 5HFCA 1UEQA 5E21A 2EDVA 4E3BA 4JOFA 1GM1A 4Q3HA 2JXOA 2K1ZA 1W9QA 1Q3PA 2Z17A 1FC7A 4E34A 5I7ZA 3STJA 2PZDA 1UEPA 2EGOA 1QLCA 1X45A 4WYUA 3DORA 2QG1A 4EDJA 1WH1A 1UJUA 4MPAA 4NXQA 2R4HA 4K6YA 4JOHA 2OPGA 3OTPA 2DKRA 1WHDA 2M0VA 3CBXA 3PDVA 1WI4A 2M3MA 2JINA 4L8NA 1V62A 5D13A 3KZEA 2I0LA 2VPHA 1MFGA 5FHTA 2FE5A 2EDZA 1V5LA 4JOEA 3EGGC 1U38A 2LOBA 1D5GA 3GDUA 3SFJA 5ILBA 5A2PA 3PV2A 2KQFA 4GHNA 3QO6A 2HE2A 4KFVA 1IHJA 2JIKA 2CSSA 1BE9A 2JWEA 4LMMA 2QKTA 3RLEA 4REYA 3K1RA 2EV8A 4NMVA 1N99A 4Z8JA 4NNLA 5HDYA 1MFLA 2EEJA 2DLUA 4XHVA 3TSWA 2KPLA 1I16A 4YDPA 4UU5A 2VZ5A 2EAQA 3JXTA 3GCNA 2EEIA 5HF1A 1WF8A 2GEFA 1UEWA 1Y8TA 3B76A 5EZ0A 1RGRA 1TP3A 2F0AA 4R2ZA 1X6DA 2JOAA 2REYA 1WFGA 3TSVA 3PS4A 1T2MA 2LC7A 2KJPA 1L6OA 1WJLA 1FCFA 1W9OA 5EYZA 1NF3C 1V1TA 1QAUA 5HFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSV A;  4NMT A;  3HPM A;  2HE4 A;  2YUY A;  2KL1 A;  1Q3O A;  2EGN A;  4OAJ A;  2O2T A;  3RL8 A;  2IWN A;  2KOH A;  2DB5 A;  2L4T A;  2M0U A;  1PDR A;  1OBZ A;  2YUB A;  3KZD A;  4JL7 A;  3ZRT A;  1TQ3 A;  3PV5 A;  2X7Z A;  3EGH C;  5HJ1 A;  4O06 A;  1VCW A;  2EHR A;  2I1N A;  1VB7 A;  3WKL A;  4F8K A;  5E1Y A;  5GLJ A;  2OZF A;  2L97 A;  3OU0 A;  1UIT A;  3SHW A;  2G5M B;  1X8S A;  2KPK A;  2M0Z A;  3R0H A;  1WI2 A;  4NXP A;  1KWA A;  1UJV A;  2G2L A;  1N7E A;  4KFW A;  1N6F A;  2KRG A;  5GND A;  1N6E A;  1OBX A;  1GQ4 A;  2AWX A;  4Z33 A;  4NMP A;  2OCS A;  2OGP A;  1M5Z A;  2DM8 A;  2JIL A;  1WF7 A;  3CBZ A;  4Q2N A;  2FN5 A;  2DC2 A;  5G1D A;  2EGK A;  3CBY A;  2H2B A;  5HED A;  3ID1 A;  3TMH A;  2Z9I A;  2UZC A;  1WIF A;  3ID3 A;  5F67 A;  2VRF A;  4JOR A;  2K20 A;  4K75 A;  2KJD A;  4HOP B;  5E11 A;  4P2A B;  4NNM A;  3MH7 A;  2R3Y A;  4Q6H A;  2Q3G A;  1UHP A;  4NXR A;  3L4F D;  1VA8 A;  2CSJ A;  1U39 A;  3GDS A;  3QJN A;  1UM1 A;  1LCY A;  4Q2Q A;  5E6P B;  3QDO A;  2FCF A;  2KOJ A;  1W9E A;  1WG6 A;  1N7F A;  2PNT A;  1SOT A;  2RRM A;  1KY9 A;  4Q2O A;  2QKV A;  4NMR A;  3PV4 A;  5FB8 C;  2OSG A;  1N6D A;  1UEZ A;  3DJ1 A;  2I6V A;  2PKU A;  2YT8 A;  4PQW A;  2DJT A;  4GVC A;  2ZPL A;  2LC6 A;  3VQF A;  3GGE A;  3QE1 A;  1UFX A;  2M10 A;  1TE0 A;  4E35 A;  2KJK A;  4NMO A;  2EEG A;  4UU6 A;  3DJA A;  1FC9 A;  1P1D A;  1XZ9 A;  4YYX A;  1SOZ A;  2KAW A;  1QAV B;  2PDZ A;  2W4F A;  2AWU A;  1U37 A;  1Y7N A;  2KA9 A;  2D8I A;  3K82 A;  4P0C A;  3R69 A;  1X5N A;  2FNE A;  2LA8 A;  2MX6 A;  1V6B A;  1GQ5 A;  4JOG A;  2GZV A;  1P1E A;  3GSL A;  3ID4 A;  2VWR A;  5B6L A;  4HOP A;  1R6J A;  2H3M A;  5E22 A;  4H11 A;  2VSP A;  1Z87 A;  3RL7 A;  2QKU A;  4NMS A;  3CC0 A;  3SHU A;  2AIN A;  2OQS A;  3SUZ A;  3DJ3 A;  1MC7 A;  2P3W A;  5HFB A;  4RI0 A;  4JOJ A;  4G69 A;  2YTW A;  4WYT A;  4FGM A;  2Q9V A;  1RZX A;  4JOK A;  2F5Y A;  3BPU A;  2V90 A;  2DMZ A;  2ZPM A;  1KEF A;  3CS0 A;  3R68 A;  5HFF A;  4K72 A;  2I04 A;  2RCZ A;  4IC6 A;  1FC6 A;  1N7T A;  4JOP A;  1QAV A;  1RGW A;  4NMQ A;  2W7R A;  1X5R A;  3PDZ A;  2JRE A;  4OEO A;  2I0I A;  1UJD A;  2BYG A;  3CH8 A;  3TSZ A;  5HFE A;  3QGL A;  3VQG A;  3NFL A;  4K78 A;  2KV8 A;  2I4S A;  3ID2 A;  5DTH A;  4AMH A;  5G1E A;  4GVD A;  1Q7X A;  3K50 A;  1X5Q A;  3DIW A;  3GJ9 A;  3MH4 A;  1OZI A;  1YBO A;  3GDV A;  1V5Q A;  5HET A;  2KYL A;  3NGH A;  2D90 A;  2DLS A;  1RY4 A;  3QJM A;  3E17 A;  3WKM A;  1Z86 A;  3I18 A;  2ENO A;  3SOE A;  2PA1 A;  1G9O A;  5HEB A;  4K76 A;  1OBY A;  3MH6 A;  1VJ6 A;  2E7K A;  2YT7 A;  3I4W A;  5F3X A;  1BFE A;  2IWO A;  3NFK A;  1WHA A;  2KOM A;  3FY5 A;  2OS6 A;  4Q6S A;  1U3B A;  2D92 A;  1IU0 A;  2LUI A;  2QBW A;  1B8Q A;  2HGA A;  3LNY A;  5H3J A;  2DAZ A;  3HVQ C;  3QIK A;  2H2C A;  5HF4 A;  2EDP A;  2KG2 A;  2WL7 A;  4Q2P A;  3LNX A;  1ZUB A;  3CYY A;  2KBS A;  1WFV A;  2PKT A;  2EEH A;  2EXG A;  2OMJ A;  1I92 A;  2MHO A;  1ZOK A;  2H3L A;  4OEP A;  2L4S A;  3GCO A;  5JXB A;  3O46 A;  2QT5 A;  2EJY A;  4N6X A;  1UM7 A;  1VAE A;  3I1E A;  1IU2 A;  2V1W A;  3O5N A;  1UF1 A;  1K32 A;  2IWP A;  1TP5 A;  2CS5 A;  2M0T A;  1NTE A;  2AWW A;  5HEY A;  3HPK A;  3AXA A;  3KHF A;  2IWQ A;  5HFC A;  1UEQ A;  5E21 A;  2EDV A;  4E3B A;  4JOF A;  1GM1 A;  4Q3H A;  2JXO A;  2K1Z A;  1W9Q A;  1Q3P A;  2Z17 A;  1FC7 A;  4E34 A;  5I7Z A;  3STJ A;  2PZD A;  1UEP A;  2EGO A;  1QLC A;  1X45 A;  4WYU A;  3DOR A;  2QG1 A;  4EDJ A;  1WH1 A;  1UJU A;  4MPA A;  4NXQ A;  2R4H A;  4K6Y A;  4JOH A;  2OPG A;  3OTP A;  2DKR A;  1WHD A;  2M0V A;  3CBX A;  3PDV A;  1WI4 A;  2M3M A;  2JIN A;  4L8N A;  1V62 A;  5D13 A;  3KZE A;  2I0L A;  2VPH A;  1MFG A;  5FHT A;  2FE5 A;  2EDZ A;  1V5L A;  4JOE A;  3EGG C;  1U38 A;  2LOB A;  1D5G A;  3GDU A;  3SFJ A;  5A2P A;  3PV2 A;  2KQF A;  4GHN A;  3QO6 A;  2HE2 A;  4KFV A;  1IHJ A;  2JIK A;  2CSS A;  1BE9 A;  2JWE A;  4LMM A;  2QKT A;  3RLE A;  4REY A;  3K1R A;  2EV8 A;  4NMV A;  1N99 A;  4Z8J A;  4NNL A;  5HDY A;  1MFL A;  2EEJ A;  2DLU A;  4XHV A;  3TSW A;  2KPL A;  1I16 A;  4YDP A;  4UU5 A;  2VZ5 A;  2EAQ A;  3JXT A;  3GCN A;  2EEI A;  5HF1 A;  1WF8 A;  1UEW A;  1Y8T A;  3B76 A;  5EZ0 A;  1RGR A;  1TP3 A;  2F0A A;  4R2Z A;  1X6D A;  2JOA A;  2REY A;  1WFG A;  3TSV A;  3PS4 A;  1T2M A;  2LC7 A;  2KJP A;  1L6O A;  1WJL A;  1FCF A;  1W9O A;  5EYZ A;  1NF3 C;  1V1T A;  1QAU A;  5HFD A; 
#chains in the Genus database with same CATH topology
 2VSV A;  4NMT A;  3HPM A;  2HE4 A;  2YUY A;  2KL1 A;  1Q3O A;  2EGN A;  4OAJ A;  2O2T A;  3RL8 A;  2IWN A;  2KOH A;  2DB5 A;  2L4T A;  2M0U A;  3NCV A;  1PDR A;  1OBZ A;  2YUB A;  3KZD A;  4JL7 A;  3ZRT A;  1TQ3 A;  3PV5 A;  2X7Z A;  3EGH C;  5HJ1 A;  4O06 A;  1VCW A;  2EHR A;  2I1N A;  1VB7 A;  3WKL A;  4F8K A;  5E1Y A;  5GLJ A;  2OZF A;  2L97 A;  3OU0 A;  1UIT A;  3SHW A;  2G5M B;  1X8S A;  2KPK A;  2M0Z A;  3R0H A;  1WI2 A;  4NXP A;  1KWA A;  1UJV A;  2G2L A;  4FLN A;  1N7E A;  4KFW A;  1N6F A;  2KRG A;  5GND A;  1N6E A;  1OBX A;  1GQ4 A;  2AWX A;  4Z33 A;  4NMP A;  2OCS A;  2OGP A;  1M5Z A;  2DM8 A;  2JIL A;  1WF7 A;  3CBZ A;  4Q2N A;  2FN5 A;  2DC2 A;  5G1D A;  2EGK A;  3CBY A;  2H2B A;  5HED A;  3ID1 A;  3TMH A;  2Z9I A;  2UZC A;  1WIF A;  3ID3 A;  5F67 A;  2VRF A;  4JOR A;  2K20 A;  4K75 A;  2KJD A;  4HOP B;  5E11 A;  4P2A B;  4NNM A;  3MH7 A;  2R3Y A;  4Q6H A;  2Q3G A;  1UHP A;  4NXR A;  3L4F D;  1VA8 A;  2CSJ A;  1U39 A;  3GDS A;  3QJN A;  4JJ3 A;  1UM1 A;  1LCY A;  4Q2Q A;  5E6P B;  3QDO A;  2FCF A;  2KOJ A;  1W9E A;  1WG6 A;  1N7F A;  2JSN A;  2PNT A;  1SOT A;  2RRM A;  1KY9 A;  4Q2O A;  2QKV A;  4NMR A;  1X9Z A;  3PV4 A;  5FB8 C;  2OSG A;  1N6D A;  1UEZ A;  3DJ1 A;  2I6V A;  2PKU A;  2YT8 A;  4JJ0 A;  4PQW A;  2DJT A;  4GVC A;  2ZPL A;  2LC6 A;  3VQF A;  3GGE A;  3QE1 A;  1UFX A;  2M10 A;  1TE0 A;  4E35 A;  2KJK A;  4NMO A;  2EEG A;  4UU6 A;  3DJA A;  1FC9 A;  1P1D A;  1XZ9 A;  4YYX A;  1SOZ A;  2KAW A;  1QAV B;  2PDZ A;  2W4F A;  2AWU A;  1U37 A;  1Y7N A;  2KA9 A;  2D8I A;  3K82 A;  4P0C A;  3R69 A;  1X5N A;  2FNE A;  2LA8 A;  2MX6 A;  1V6B A;  1GQ5 A;  4JOG A;  2GZV A;  1P1E A;  3GSL A;  3ID4 A;  2VWR A;  5B6L A;  4HOP A;  1R6J A;  2H3M A;  5E22 A;  4H11 A;  3KDK A;  2VSP A;  1Z87 A;  3RL7 A;  2QKU A;  4NMS A;  3CC0 A;  3SHU A;  2AIN A;  2OQS A;  3SUZ A;  3DJ3 A;  1MC7 A;  2P3W A;  5HFB A;  4RI0 A;  4JOJ A;  4G69 A;  2YTW A;  4WYT A;  4FGM A;  2Q9V A;  1RZX A;  4JOK A;  2F5Y A;  3BPU A;  2V90 A;  2DMZ A;  2ZPM A;  1KEF A;  3CS0 A;  3R68 A;  5HFF A;  4K72 A;  2I04 A;  2RCZ A;  4IC6 A;  1FC6 A;  1N7T A;  4JOP A;  1QAV A;  1RGW A;  4NMQ A;  2W7R A;  1X5R A;  3PDZ A;  2JRE A;  4OEO A;  2I0I A;  1UJD A;  2BYG A;  3CH8 A;  3TSZ A;  5HFE A;  3QGL A;  3VQG A;  3NFL A;  4K78 A;  2KV8 A;  2I4S A;  3ID2 A;  5DTH A;  4AMH A;  5G1E A;  4GVD A;  1Q7X A;  3K50 A;  1X5Q A;  3DIW A;  3GAB A;  3GJ9 A;  1OZI A;  3MH4 A;  1YBO A;  3GDV A;  1V5Q A;  5HET A;  2KYL A;  3NGH A;  2D90 A;  2DLS A;  1RY4 A;  3QJM A;  3KDG A;  3E17 A;  3WKM A;  1Z86 A;  5IL9 A;  3I18 A;  2ENO A;  3SOE A;  2PA1 A;  1G9O A;  5HEB A;  4K76 A;  1OBY A;  3MH6 A;  1VJ6 A;  2E7K A;  2YT7 A;  3I4W A;  5F3X A;  1BFE A;  2IWO A;  3NFK A;  1WHA A;  2KOM A;  3FY5 A;  2OS6 A;  4Q6S A;  1U3B A;  2D92 A;  1IU0 A;  2LUI A;  2QBW A;  1B8Q A;  2HGA A;  3LNY A;  5B42 A;  5H3J A;  2DAZ A;  3HVQ C;  3QIK A;  2H2C A;  5HF4 A;  2EDP A;  2KG2 A;  2WL7 A;  4Q2P A;  3LNX A;  1ZUB A;  3CYY A;  2KBS A;  1WFV A;  2PKT A;  2EEH A;  2EXG A;  2OMJ A;  1I92 A;  2MHO A;  1ZOK A;  2H3L A;  4OEP A;  2L4S A;  3GCO A;  5JXB A;  3O46 A;  2QT5 A;  2EJY A;  4N6X A;  1UM7 A;  1VAE A;  3I1E A;  1IU2 A;  2V1W A;  3O5N A;  1UF1 A;  1K32 A;  2IWP A;  1TP5 A;  2CS5 A;  2M0T A;  1NTE A;  2AWW A;  5HEY A;  3HPK A;  3AXA A;  3KHF A;  2IWQ A;  5HFC A;  1UEQ A;  5E21 A;  2EDV A;  4E3B A;  4JOF A;  1GM1 A;  4Q3H A;  2JXO A;  2K1Z A;  1W9Q A;  1Q3P A;  2Z17 A;  1FC7 A;  4E34 A;  5I7Z A;  3STJ A;  2PZD A;  1UEP A;  2EGO A;  1QLC A;  1X45 A;  4WYU A;  3DOR A;  2QG1 A;  4EDJ A;  1WH1 A;  1UJU A;  4MPA A;  4NXQ A;  2R4H A;  4K6Y A;  4JOH A;  2OPG A;  3OTP A;  2DKR A;  1WHD A;  2M0V A;  3CBX A;  3PDV A;  1WI4 A;  2M3M A;  2JIN A;  4L8N A;  1V62 A;  5D13 A;  3KZE A;  2I0L A;  2VPH A;  1MFG A;  5FHT A;  2FE5 A;  2EDZ A;  1V5L A;  4JOE A;  3EGG C;  1U38 A;  2LOB A;  1D5G A;  3GDU A;  3SFJ A;  5ILB A;  5A2P A;  3PV2 A;  2KQF A;  4GHN A;  3QO6 A;  2HE2 A;  4KFV A;  1IHJ A;  2JIK A;  2CSS A;  1BE9 A;  2JWE A;  4LMM A;  2QKT A;  3RLE A;  4REY A;  3K1R A;  2EV8 A;  4NMV A;  1N99 A;  4Z8J A;  4NNL A;  5HDY A;  1MFL A;  2EEJ A;  2DLU A;  4XHV A;  3TSW A;  2KPL A;  1I16 A;  4YDP A;  4UU5 A;  2VZ5 A;  2EAQ A;  3JXT A;  3GCN A;  2EEI A;  5HF1 A;  1WF8 A;  2GEF A;  1UEW A;  1Y8T A;  3B76 A;  5EZ0 A;  1RGR A;  1TP3 A;  2F0A A;  4R2Z A;  1X6D A;  2JOA A;  2REY A;  1WFG A;  3TSV A;  3PS4 A;  1T2M A;  2LC7 A;  2KJP A;  1L6O A;  1WJL A;  1FCF A;  1W9O A;  5EYZ A;  1NF3 C;  1V1T A;  1QAU A;  5HFD A; 
#chains in the Genus database with same CATH homology
 2VSV A;  4NMT A;  3HPM A;  2HE4 A;  2YUY A;  2KL1 A;  1Q3O A;  2EGN A;  4OAJ A;  2O2T A;  3RL8 A;  2IWN A;  2KOH A;  2DB5 A;  2L4T A;  2M0U A;  3NCV A;  1PDR A;  1OBZ A;  2YUB A;  3KZD A;  4JL7 A;  3ZRT A;  1TQ3 A;  3PV5 A;  2X7Z A;  3EGH C;  5HJ1 A;  4O06 A;  1VCW A;  2EHR A;  2I1N A;  1VB7 A;  3WKL A;  4F8K A;  5E1Y A;  5GLJ A;  2OZF A;  2L97 A;  3OU0 A;  1UIT A;  3SHW A;  2G5M B;  1X8S A;  2KPK A;  2M0Z A;  3R0H A;  1WI2 A;  4NXP A;  1KWA A;  1UJV A;  2G2L A;  4FLN A;  1N7E A;  4KFW A;  1N6F A;  2KRG A;  5GND A;  1N6E A;  1OBX A;  1GQ4 A;  2AWX A;  4Z33 A;  4NMP A;  2OCS A;  2OGP A;  1M5Z A;  2DM8 A;  2JIL A;  1WF7 A;  3CBZ A;  4Q2N A;  2FN5 A;  2DC2 A;  5G1D A;  2EGK A;  3CBY A;  2H2B A;  5HED A;  3ID1 A;  3TMH A;  2Z9I A;  2UZC A;  1WIF A;  3ID3 A;  5F67 A;  2VRF A;  4JOR A;  2K20 A;  4K75 A;  2KJD A;  4HOP B;  5E11 A;  4P2A B;  4NNM A;  3MH7 A;  2R3Y A;  4Q6H A;  2Q3G A;  1UHP A;  4NXR A;  3L4F D;  1VA8 A;  2CSJ A;  1U39 A;  3GDS A;  3QJN A;  4JJ3 A;  1UM1 A;  1LCY A;  4Q2Q A;  5E6P B;  3QDO A;  2FCF A;  2KOJ A;  1W9E A;  1WG6 A;  1N7F A;  2JSN A;  2PNT A;  1SOT A;  2RRM A;  1KY9 A;  4Q2O A;  2QKV A;  4NMR A;  1X9Z A;  3PV4 A;  5FB8 C;  2OSG A;  1N6D A;  1UEZ A;  3DJ1 A;  2I6V A;  2PKU A;  2YT8 A;  4JJ0 A;  4PQW A;  2DJT A;  4GVC A;  2ZPL A;  2LC6 A;  3VQF A;  3GGE A;  3QE1 A;  1UFX A;  2M10 A;  1TE0 A;  4E35 A;  2KJK A;  4NMO A;  2EEG A;  4UU6 A;  3DJA A;  1FC9 A;  1P1D A;  1XZ9 A;  4YYX A;  1SOZ A;  2KAW A;  1QAV B;  2PDZ A;  2W4F A;  2AWU A;  1U37 A;  1Y7N A;  2KA9 A;  2D8I A;  3K82 A;  4P0C A;  3R69 A;  1X5N A;  2FNE A;  2LA8 A;  2MX6 A;  1V6B A;  1GQ5 A;  4JOG A;  2GZV A;  1P1E A;  3GSL A;  3ID4 A;  2VWR A;  5B6L A;  4HOP A;  1R6J A;  2H3M A;  5E22 A;  4H11 A;  3KDK A;  2VSP A;  1Z87 A;  3RL7 A;  2QKU A;  4NMS A;  3CC0 A;  3SHU A;  2AIN A;  2OQS A;  3SUZ A;  3DJ3 A;  1MC7 A;  2P3W A;  5HFB A;  4RI0 A;  4JOJ A;  4G69 A;  2YTW A;  4WYT A;  4FGM A;  2Q9V A;  1RZX A;  4JOK A;  2F5Y A;  3BPU A;  2V90 A;  2DMZ A;  2ZPM A;  1KEF A;  3CS0 A;  3R68 A;  5HFF A;  4K72 A;  2I04 A;  2RCZ A;  4IC6 A;  1FC6 A;  1N7T A;  4JOP A;  1QAV A;  1RGW A;  4NMQ A;  2W7R A;  1X5R A;  3PDZ A;  2JRE A;  4OEO A;  2I0I A;  1UJD A;  2BYG A;  3CH8 A;  3TSZ A;  5HFE A;  3QGL A;  3VQG A;  3NFL A;  4K78 A;  2KV8 A;  2I4S A;  3ID2 A;  5DTH A;  4AMH A;  5G1E A;  4GVD A;  1Q7X A;  3K50 A;  1X5Q A;  3DIW A;  3GAB A;  3GJ9 A;  1OZI A;  3MH4 A;  1YBO A;  3GDV A;  1V5Q A;  5HET A;  2KYL A;  3NGH A;  2D90 A;  2DLS A;  1RY4 A;  3QJM A;  3KDG A;  3E17 A;  3WKM A;  1Z86 A;  5IL9 A;  3I18 A;  2ENO A;  3SOE A;  2PA1 A;  1G9O A;  5HEB A;  4K76 A;  1OBY A;  3MH6 A;  1VJ6 A;  2E7K A;  2YT7 A;  3I4W A;  5F3X A;  1BFE A;  2IWO A;  3NFK A;  1WHA A;  2KOM A;  3FY5 A;  2OS6 A;  4Q6S A;  1U3B A;  2D92 A;  1IU0 A;  2LUI A;  2QBW A;  1B8Q A;  2HGA A;  3LNY A;  5B42 A;  5H3J A;  2DAZ A;  3HVQ C;  3QIK A;  2H2C A;  5HF4 A;  2EDP A;  2KG2 A;  2WL7 A;  4Q2P A;  3LNX A;  1ZUB A;  3CYY A;  2KBS A;  1WFV A;  2PKT A;  2EEH A;  2EXG A;  2OMJ A;  1I92 A;  2MHO A;  1ZOK A;  2H3L A;  4OEP A;  2L4S A;  3GCO A;  5JXB A;  3O46 A;  2QT5 A;  2EJY A;  4N6X A;  1UM7 A;  1VAE A;  3I1E A;  1IU2 A;  2V1W A;  3O5N A;  1UF1 A;  1K32 A;  2IWP A;  1TP5 A;  2CS5 A;  2M0T A;  1NTE A;  2AWW A;  5HEY A;  3HPK A;  3AXA A;  3KHF A;  2IWQ A;  5HFC A;  1UEQ A;  5E21 A;  2EDV A;  4E3B A;  4JOF A;  1GM1 A;  4Q3H A;  2JXO A;  2K1Z A;  1W9Q A;  1Q3P A;  2Z17 A;  1FC7 A;  4E34 A;  5I7Z A;  3STJ A;  2PZD A;  1UEP A;  2EGO A;  1QLC A;  1X45 A;  4WYU A;  3DOR A;  2QG1 A;  4EDJ A;  1WH1 A;  1UJU A;  4MPA A;  4NXQ A;  2R4H A;  4K6Y A;  4JOH A;  2OPG A;  3OTP A;  2DKR A;  1WHD A;  2M0V A;  3CBX A;  3PDV A;  1WI4 A;  2M3M A;  2JIN A;  4L8N A;  1V62 A;  5D13 A;  3KZE A;  2I0L A;  2VPH A;  1MFG A;  5FHT A;  2FE5 A;  2EDZ A;  1V5L A;  4JOE A;  3EGG C;  1U38 A;  2LOB A;  1D5G A;  3GDU A;  3SFJ A;  5ILB A;  5A2P A;  3PV2 A;  2KQF A;  4GHN A;  3QO6 A;  2HE2 A;  4KFV A;  1IHJ A;  2JIK A;  2CSS A;  1BE9 A;  2JWE A;  4LMM A;  2QKT A;  3RLE A;  4REY A;  3K1R A;  2EV8 A;  4NMV A;  1N99 A;  4Z8J A;  4NNL A;  5HDY A;  1MFL A;  2EEJ A;  2DLU A;  4XHV A;  3TSW A;  2KPL A;  1I16 A;  4YDP A;  4UU5 A;  2VZ5 A;  2EAQ A;  3JXT A;  3GCN A;  2EEI A;  5HF1 A;  1WF8 A;  2GEF A;  1UEW A;  1Y8T A;  3B76 A;  5EZ0 A;  1RGR A;  1TP3 A;  2F0A A;  4R2Z A;  1X6D A;  2JOA A;  2REY A;  1WFG A;  3TSV A;  3PS4 A;  1T2M A;  2LC7 A;  2KJP A;  1L6O A;  1WJL A;  1FCF A;  1W9O A;  5EYZ A;  1NF3 C;  1V1T A;  1QAU A;  5HFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...