3TMHA

Crystal structure of dual-specific a-kinase anchoring protein 2 in complex with camp-dependent protein kinase a type ii alpha and pdzk1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
82
structure length
82
Chain Sequence
b'KPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Na(+)/H(+) exchange regulatory cofactor NHE-RF3
publication title Differential mode of D-AKAP2 to PKA isoforms: Insights from D-AKAP2 PKA RII PDZK1 ternary complex structure
rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
total genus 15
structure length 82
sequence length 82
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3tmhA00
2EAQA 2KYLA 2H3LA 2HE2A 3SHWA 4K6YA 3PV2A 2M0TA 2KOHA 1FC6A 2YUBA 2PKUA 3HPKA 2QKUA 1X5NA 2EGKA 4Q3HA 3FY5A 2M0VA 1OBZA 1FC7A 2JOAA 3B76A 3WKMA 4AMHA 2FNEA 4JORA 1XZ9A 2KQFA 1FC9A 1WFVA 3PDVA 1K32A 1WF8A 2D90A 1T2MA 1RZXA 1V62A 1QAVA 1KY9A 2VWRA 1UM7A 3TMHA 2DB5A 5HEBA 2KOMA 4MPAA 1W9OA 5E22A 2M0ZA 1X6DA 1U37A 2VRFA 5F67A 3QGLA 2EXGA 5FHTA 2IWPA 5HDYA 2KL1A 4NMVA 4Q6HA 1BE9A 3CBZA 1GQ4A 4KFWA 1SOTA 1X5RA 5HFEA 3AXAA 4JOGA 2V1WA 4OAJA 5HEDA 1IHJA 2MHOA 2Q9VA 1UF1A 2L4TA 3HVQC 2OGPA 2W4FA 3MH7A 1L6OA 1KEFA 3O46A 2GZVA 4RI0A 3QJMA 4Z8JA 3ID2A 2M10A 5EYZA 5B6LA 5E21A 3VQFA 1U39A 2I1NA 1V1TA 3NGHA 4XHVA 2JWEA 1V5QA 4K75A 4JOHA 3BPUA 4YYXA 4Q2PA 2KJDA 2QKTA 1N7FA 2EEGA 1PDRA 2KJKA 3GCNA 2M0UA 2OCSA 2EGOA 2YT8A 4HOPB 3ID1A 1RGRA 4N6XA 2KJPA 3K1RA 4R2ZA 3PV4A 4G69A 2CSSA 4NNLA 4K72A 1Y8TA 2LA8A 2D92A 3QJNA 3PDZA 1NTEA 2WL7A 2HGAA 2UZCA 3TSVA 2EEHA 2KAWA 4E35A 1UEQA 2KG2A 3STJA 3GCOA 1U38A 1QAUA 2I0LA 3CYYA 1TP5A 1M5ZA 4NXPA 3I1EA 1NF3C 4WYTA 1WF7A 2PZDA 3R68A 2IWOA 2KRGA 4UU5A 2IWNA 2V90A 4IC6A 1WI2A 1V5LA 2I0IA 3K50A 2PA1A 2QG1A 2DM8A 2RCZA 1N6FA 3R69A 4GHNA 3QIKA 3OU0A 4NNMA 4Q2QA 2DJTA 4NMRA 4NMTA 4GVDA 1N7TA 1UJDA 1TP3A 4JL7A 4LMMA 2F5YA 3CBXA 2H2BA 2KOJA 2JIKA 3GJ9A 2LC7A 2PNTA 5F3XA 2JXOA 3RL8A 2HE4A 2EJYA 3CC0A 1U3BA 4WYUA 5GNDA 1MC7A 3HPMA 5GLJA 3PV5A 4E3BA 4NMQA 1FCFA 1IU2A 2QBWA 2G2LA 1YBOA 1OZIA 2FE5A 4HOPA 1BFEA 2CS5A 3VQGA 5EZ0A 3ID4A 3QDOA 5D13A 3CS0A 2BYGA 1VB7A 2G5MB 5HFCA 3EGHC 1TE0A 3GDVA 3DIWA 2DAZA 2AWUA 4P0CA 2REYA 2L97A 4JOPA 1X45A 5FB8C 2VPHA 1VCWA 4NMOA 1UHPA 4NXRA 3NFLA 2DMZA 3I18A 1B8QA 4F8KA 1N6EA 1I16A 3ZRTA 1WHDA 2CSJA 2H2CA 2JINA 5HF4A 2OSGA 3MH4A 1MFGA 1ZUBA 2EEIA 4P2AB 2EEJA 2L4SA 2KA9A 4K78A 2EDPA 3LNXA 5DTHA 3L4FD 2EDVA 1GM1A 3CH8A 4Z33A 3CBYA 2D8IA 1R6JA 1KWAA 5E11A 2VZ5A 2DLUA 3RLEA 1X8SA 1UM1A 1Q3PA 1Z87A 1WFGA 3EGGC 2OZFA 2DKRA 2YUYA 1TQ3A 2R3YA 5G1EA 3K82A 3R0HA 2F0AA 1D5GA 5I7ZA 1N7EA 2EDZA 2X7ZA 1OBXA 3PS4A 2E7KA 3WKLA 1N99A 4UU6A 2AWWA 3SOEA 3KZDA 4YDPA 3ID3A 3E17A 2KPLA 2OQSA 4GVCA 3GSLA 3I4WA 3OTPA 2AINA 4H11A 1UEZA 1V6BA 2ZPLA 3SFJA 2P3WA 1I92A 2LC6A 2QT5A 3SHUA 2EV8A 2ENOA 1MFLA 2EHRA 2FCFA 4NMSA 1VJ6A 3RL7A 5A2PA 2OPGA 3MH6A 2I6VA 4OEPA 4JOJA 2KV8A 1IU0A 2FN5A 2KBSA 3JXTA 1GQ5A 3LNYA 2O2TA 4JOFA 1G9OA 1P1EA 1ZOKA 4PQWA 1WIFA 2EGNA 1UJVA 1W9QA 4JOKA 5HEYA 1UJUA 5G1DA 4Q2NA 4Q2OA 2Q3GA 3KHFA 4L8NA 5HFDA 2JREA 1VA8A 1UFXA 2AWXA 2ZPMA 1WHAA 2YTWA 2W7RA 3GDSA 3O5NA 2PKTA 2IWQA 5H3JA 3TSZA 1OBYA 2QKVA 2LUIA 1UEWA 5HETA 2K20A 1SOZA 1WI4A 5HFFA 1UEPA 1VAEA 5HF1A 4OEOA 5HJ1A 2VSVA 4JOEA 1Y7NA 5E1YA 3DJ3A 2Z17A 2Z9IA 2OS6A 2R4HA 1UITA 3NFKA 1QLCA 4O06A 1Q3OA 2I04A 1LCYA 1WH1A 4Q6SA 2KPKA 4E34A 1RY4A 1P1DA 1QAVB 2M3MA 4NMPA 2OMJA 2JILA 2PDZA 5JXBA 3SUZA 2DLSA 3DJ1A 4REYA 2I4SA 1WG6A 1X5QA 3QO6A 5HFBA 2LOBA 1Q7XA 2VSPA 3DJAA 3QE1A 4KFVA 3TSWA 2RRMA 3DORA 3KZEA 5E6PB 1N6DA 2YT7A 4EDJA 2DC2A 2H3MA 3GGEA 2MX6A 4FGMA 1RGWA 1Z86A 4K76A 3GDUA 1W9EA 4NXQA 2K1ZA 1WJLA
chains in the Genus database with same CATH superfamily
2EAQA 2KYLA 2H3LA 2JSNA 2HE2A 3SHWA 4K6YA 3PV2A 2M0TA 2KOHA 1FC6A 2YUBA 2PKUA 3HPKA 2QKUA 1X5NA 2EGKA 4Q3HA 3FY5A 2M0VA 1OBZA 1FC7A 2JOAA 3B76A 3WKMA 4AMHA 2FNEA 4JORA 1XZ9A 2KQFA 1FC9A 1WFVA 3PDVA 1K32A 1WF8A 2D90A 1T2MA 1RZXA 1V62A 1QAVA 1KY9A 2VWRA 1UM7A 3TMHA 2GEFA 2DB5A 5HEBA 2KOMA 4MPAA 1W9OA 5E22A 2M0ZA 1X6DA 1U37A 2VRFA 5F67A 3QGLA 2EXGA 5FHTA 2IWPA 5HDYA 2KL1A 4NMVA 4Q6HA 1BE9A 3CBZA 1GQ4A 4KFWA 1X9ZA 1SOTA 1X5RA 5HFEA 3AXAA 4JOGA 2V1WA 4OAJA 5HEDA 1IHJA 2MHOA 2Q9VA 1UF1A 2L4TA 3HVQC 2OGPA 2W4FA 3MH7A 1L6OA 1KEFA 4JJ0A 3O46A 2GZVA 4RI0A 3QJMA 4Z8JA 2M10A 3ID2A 5EYZA 5B6LA 5E21A 3VQFA 1U39A 2I1NA 1V1TA 3NGHA 4XHVA 2JWEA 1V5QA 4K75A 4JOHA 3BPUA 4YYXA 5IL9A 4Q2PA 2KJDA 2QKTA 1N7FA 4JJ3A 2EEGA 1PDRA 2KJKA 3GCNA 2M0UA 2OCSA 2EGOA 2YT8A 4HOPB 3ID1A 1RGRA 4N6XA 2KJPA 3K1RA 4R2ZA 3PV4A 4G69A 2CSSA 4NNLA 4K72A 1Y8TA 2LA8A 2D92A 3QJNA 3PDZA 1NTEA 2WL7A 4FLNA 2HGAA 2UZCA 3TSVA 2EEHA 2KAWA 4E35A 1UEQA 2KG2A 3STJA 3GCOA 1U38A 1QAUA 2I0LA 3CYYA 1TP5A 1M5ZA 5B42A 4NXPA 3I1EA 1NF3C 4WYTA 1WF7A 2PZDA 3R68A 2IWOA 2KRGA 4UU5A 2IWNA 2V90A 4IC6A 1WI2A 1V5LA 2I0IA 3K50A 2PA1A 2QG1A 2DM8A 2RCZA 1N6FA 3R69A 4GHNA 3QIKA 3OU0A 4NNMA 4Q2QA 2DJTA 4NMRA 4NMTA 4GVDA 1N7TA 1UJDA 1TP3A 4JL7A 4LMMA 2F5YA 3CBXA 2H2BA 2KOJA 2JIKA 3GJ9A 2LC7A 2PNTA 3KDGA 5F3XA 2JXOA 3RL8A 2HE4A 2EJYA 3CC0A 1U3BA 4WYUA 5GNDA 1MC7A 3HPMA 5GLJA 3PV5A 4E3BA 4NMQA 1FCFA 1IU2A 2QBWA 2G2LA 1YBOA 1OZIA 2FE5A 4HOPA 1BFEA 2CS5A 3VQGA 5EZ0A 3ID4A 3QDOA 5D13A 3CS0A 2BYGA 1VB7A 2G5MB 5HFCA 3EGHC 1TE0A 3GDVA 3DIWA 2DAZA 2AWUA 4P0CA 2REYA 2L97A 4JOPA 1X45A 5FB8C 2VPHA 1VCWA 4NMOA 1UHPA 4NXRA 3NFLA 2DMZA 3I18A 1B8QA 4F8KA 1N6EA 1I16A 3ZRTA 1WHDA 2CSJA 2H2CA 2JINA 5HF4A 2OSGA 3MH4A 1MFGA 1ZUBA 2EEIA 4P2AB 2EEJA 2L4SA 2KA9A 4K78A 2EDPA 3LNXA 5DTHA 3L4FD 2EDVA 1GM1A 3CH8A 4Z33A 3CBYA 2D8IA 1R6JA 1KWAA 5E11A 2VZ5A 2DLUA 3RLEA 1X8SA 1UM1A 1Q3PA 1Z87A 1WFGA 3EGGC 2OZFA 2DKRA 2YUYA 1TQ3A 2R3YA 5G1EA 3K82A 3R0HA 2F0AA 1D5GA 3GABA 5I7ZA 1N7EA 2EDZA 2X7ZA 1OBXA 3PS4A 2E7KA 3WKLA 1N99A 4UU6A 2AWWA 3SOEA 3KZDA 4YDPA 3ID3A 3E17A 2KPLA 2OQSA 4GVCA 3GSLA 3I4WA 3OTPA 3KDKA 2AINA 4H11A 1UEZA 1V6BA 2ZPLA 3SFJA 2P3WA 1I92A 2LC6A 2QT5A 3SHUA 2EV8A 2ENOA 1MFLA 2EHRA 2FCFA 4NMSA 1VJ6A 3RL7A 5A2PA 2OPGA 3MH6A 2I6VA 4OEPA 4JOJA 2KV8A 1IU0A 2FN5A 2KBSA 3JXTA 1GQ5A 3LNYA 2O2TA 4JOFA 1G9OA 1P1EA 3NCVA 1ZOKA 4PQWA 1WIFA 2EGNA 1UJVA 1W9QA 4JOKA 5HEYA 1UJUA 5G1DA 4Q2NA 4Q2OA 2Q3GA 3KHFA 4L8NA 5HFDA 5ILBA 2JREA 1VA8A 1UFXA 2AWXA 2ZPMA 1WHAA 2YTWA 2W7RA 3GDSA 3O5NA 2PKTA 2IWQA 5H3JA 3TSZA 1OBYA 2QKVA 2LUIA 1UEWA 5HETA 2K20A 1SOZA 1WI4A 5HFFA 1UEPA 1VAEA 5HF1A 4OEOA 5HJ1A 2VSVA 4JOEA 1Y7NA 5E1YA 3DJ3A 2Z17A 2Z9IA 2OS6A 2R4HA 1UITA 3NFKA 1QLCA 4O06A 1Q3OA 2I04A 1LCYA 1WH1A 4Q6SA 2KPKA 4E34A 1RY4A 1P1DA 1QAVB 2M3MA 4NMPA 2OMJA 2JILA 2PDZA 5JXBA 3SUZA 2DLSA 3DJ1A 4REYA 2I4SA 1WG6A 1X5QA 3QO6A 5HFBA 2LOBA 1Q7XA 2VSPA 3DJAA 3QE1A 4KFVA 3TSWA 2RRMA 3DORA 3KZEA 5E6PB 1N6DA 2YT7A 4EDJA 2DC2A 2H3MA 3GGEA 2MX6A 4FGMA 1RGWA 1Z86A 4K76A 3GDUA 1W9EA 4NXQA 2K1ZA 1WJLA
chains in the Genus database with same CATH topology
2EAQA 2KYLA 2H3LA 2JSNA 2HE2A 3SHWA 4K6YA 3PV2A 2M0TA 2KOHA 1FC6A 2YUBA 2PKUA 3HPKA 2QKUA 1X5NA 2EGKA 4Q3HA 3FY5A 2M0VA 1OBZA 1FC7A 2JOAA 3B76A 3WKMA 4AMHA 2FNEA 4JORA 1XZ9A 2KQFA 1FC9A 1WFVA 3PDVA 1K32A 1WF8A 2D90A 1T2MA 1RZXA 1V62A 1QAVA 1KY9A 2VWRA 1UM7A 3TMHA 2GEFA 2DB5A 5HEBA 2KOMA 4MPAA 1W9OA 5E22A 2M0ZA 1X6DA 1U37A 2VRFA 5F67A 3QGLA 2EXGA 5FHTA 2IWPA 5HDYA 2KL1A 4NMVA 4Q6HA 1BE9A 3CBZA 1GQ4A 4KFWA 1X9ZA 1SOTA 1X5RA 5HFEA 3AXAA 4JOGA 2V1WA 4OAJA 5HEDA 1IHJA 2MHOA 2Q9VA 1UF1A 2L4TA 3HVQC 2OGPA 2W4FA 3MH7A 1L6OA 1KEFA 4JJ0A 3O46A 2GZVA 4RI0A 3QJMA 4Z8JA 2M10A 3ID2A 5EYZA 5B6LA 5E21A 3VQFA 1U39A 2I1NA 1V1TA 3NGHA 4XHVA 2JWEA 1V5QA 4K75A 4JOHA 3BPUA 4YYXA 5IL9A 4Q2PA 2KJDA 2QKTA 1N7FA 4JJ3A 2EEGA 1PDRA 2KJKA 3GCNA 2M0UA 2OCSA 2EGOA 2YT8A 4HOPB 3ID1A 1RGRA 4N6XA 2KJPA 3K1RA 4R2ZA 3PV4A 4G69A 2CSSA 4NNLA 4K72A 1Y8TA 2LA8A 2D92A 3QJNA 3PDZA 1NTEA 2WL7A 4FLNA 2HGAA 2UZCA 3TSVA 2EEHA 2KAWA 4E35A 1UEQA 2KG2A 3STJA 3GCOA 1U38A 1QAUA 2I0LA 3CYYA 1TP5A 1M5ZA 5B42A 4NXPA 3I1EA 1NF3C 4WYTA 1WF7A 2PZDA 3R68A 2IWOA 2KRGA 4UU5A 2IWNA 2V90A 4IC6A 1WI2A 1V5LA 2I0IA 3K50A 2PA1A 2QG1A 2DM8A 2RCZA 1N6FA 3R69A 4GHNA 3QIKA 3OU0A 4NNMA 4Q2QA 2DJTA 4NMRA 4NMTA 4GVDA 1N7TA 1UJDA 1TP3A 4JL7A 4LMMA 2F5YA 3CBXA 2H2BA 2KOJA 2JIKA 3GJ9A 2LC7A 2PNTA 3KDGA 5F3XA 2JXOA 3RL8A 2HE4A 2EJYA 3CC0A 1U3BA 4WYUA 5GNDA 1MC7A 3HPMA 5GLJA 3PV5A 4E3BA 4NMQA 1FCFA 1IU2A 2QBWA 2G2LA 1YBOA 1OZIA 2FE5A 4HOPA 1BFEA 2CS5A 3VQGA 5EZ0A 3ID4A 3QDOA 5D13A 3CS0A 2BYGA 1VB7A 2G5MB 5HFCA 3EGHC 1TE0A 3GDVA 3DIWA 2DAZA 2AWUA 4P0CA 2REYA 2L97A 4JOPA 1X45A 5FB8C 2VPHA 1VCWA 4NMOA 1UHPA 4NXRA 3NFLA 2DMZA 3I18A 1B8QA 4F8KA 1N6EA 1I16A 3ZRTA 1WHDA 2CSJA 2H2CA 2JINA 5HF4A 2OSGA 3MH4A 1MFGA 1ZUBA 2EEIA 4P2AB 2EEJA 2L4SA 2KA9A 4K78A 2EDPA 3LNXA 5DTHA 3L4FD 2EDVA 1GM1A 3CH8A 4Z33A 3CBYA 2D8IA 1R6JA 1KWAA 5E11A 2VZ5A 2DLUA 3RLEA 1X8SA 1UM1A 1Q3PA 1Z87A 1WFGA 3EGGC 2OZFA 2DKRA 2YUYA 1TQ3A 2R3YA 5G1EA 3K82A 3R0HA 2F0AA 1D5GA 3GABA 5I7ZA 1N7EA 2EDZA 2X7ZA 1OBXA 3PS4A 2E7KA 3WKLA 1N99A 4UU6A 2AWWA 3SOEA 3KZDA 4YDPA 3ID3A 3E17A 2KPLA 2OQSA 4GVCA 3GSLA 3I4WA 3OTPA 3KDKA 2AINA 4H11A 1UEZA 1V6BA 2ZPLA 3SFJA 2P3WA 1I92A 2LC6A 2QT5A 3SHUA 2EV8A 2ENOA 1MFLA 2EHRA 2FCFA 4NMSA 1VJ6A 3RL7A 5A2PA 2OPGA 3MH6A 2I6VA 4OEPA 4JOJA 2KV8A 1IU0A 2FN5A 2KBSA 3JXTA 1GQ5A 3LNYA 2O2TA 4JOFA 1G9OA 1P1EA 3NCVA 1ZOKA 4PQWA 1WIFA 2EGNA 1UJVA 1W9QA 4JOKA 5HEYA 1UJUA 5G1DA 4Q2NA 4Q2OA 2Q3GA 3KHFA 4L8NA 5HFDA 5ILBA 2JREA 1VA8A 1UFXA 2AWXA 2ZPMA 1WHAA 2YTWA 2W7RA 3GDSA 3O5NA 2PKTA 2IWQA 5H3JA 3TSZA 1OBYA 2QKVA 2LUIA 1UEWA 5HETA 2K20A 1SOZA 1WI4A 5HFFA 1UEPA 1VAEA 5HF1A 4OEOA 5HJ1A 2VSVA 4JOEA 1Y7NA 5E1YA 3DJ3A 2Z17A 2Z9IA 2OS6A 2R4HA 1UITA 3NFKA 1QLCA 4O06A 1Q3OA 2I04A 1LCYA 1WH1A 4Q6SA 2KPKA 4E34A 1RY4A 1P1DA 1QAVB 2M3MA 4NMPA 2OMJA 2JILA 2PDZA 5JXBA 3SUZA 2DLSA 3DJ1A 4REYA 2I4SA 1WG6A 1X5QA 3QO6A 5HFBA 2LOBA 1Q7XA 2VSPA 3DJAA 3QE1A 4KFVA 3TSWA 2RRMA 3DORA 3KZEA 5E6PB 1N6DA 2YT7A 4EDJA 2DC2A 2H3MA 3GGEA 2MX6A 4FGMA 1RGWA 1Z86A 4K76A 3GDUA 1W9EA 4NXQA 2K1ZA 1WJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAQ A;  2KYL A;  2H3L A;  2HE2 A;  3SHW A;  4K6Y A;  3PV2 A;  2M0T A;  2KOH A;  1FC6 A;  2YUB A;  2PKU A;  3HPK A;  2QKU A;  1X5N A;  2EGK A;  4Q3H A;  3FY5 A;  2M0V A;  1OBZ A;  1FC7 A;  2JOA A;  3B76 A;  3WKM A;  4AMH A;  2FNE A;  4JOR A;  1XZ9 A;  2KQF A;  1FC9 A;  1WFV A;  3PDV A;  1K32 A;  1WF8 A;  2D90 A;  1T2M A;  1RZX A;  1V62 A;  1QAV A;  1KY9 A;  2VWR A;  1UM7 A;  3TMH A;  2DB5 A;  5HEB A;  2KOM A;  4MPA A;  1W9O A;  5E22 A;  2M0Z A;  1X6D A;  1U37 A;  2VRF A;  5F67 A;  3QGL A;  2EXG A;  5FHT A;  2IWP A;  5HDY A;  2KL1 A;  4NMV A;  4Q6H A;  1BE9 A;  3CBZ A;  1GQ4 A;  4KFW A;  1SOT A;  1X5R A;  5HFE A;  3AXA A;  4JOG A;  2V1W A;  4OAJ A;  5HED A;  1IHJ A;  2MHO A;  2Q9V A;  1UF1 A;  2L4T A;  3HVQ C;  2OGP A;  2W4F A;  3MH7 A;  1L6O A;  1KEF A;  3O46 A;  2GZV A;  4RI0 A;  3QJM A;  4Z8J A;  3ID2 A;  2M10 A;  5EYZ A;  5B6L A;  5E21 A;  3VQF A;  1U39 A;  2I1N A;  1V1T A;  3NGH A;  4XHV A;  2JWE A;  1V5Q A;  4K75 A;  4JOH A;  3BPU A;  4YYX A;  4Q2P A;  2KJD A;  2QKT A;  1N7F A;  2EEG A;  1PDR A;  2KJK A;  3GCN A;  2M0U A;  2OCS A;  2EGO A;  2YT8 A;  4HOP B;  3ID1 A;  1RGR A;  4N6X A;  2KJP A;  3K1R A;  4R2Z A;  3PV4 A;  4G69 A;  2CSS A;  4NNL A;  4K72 A;  1Y8T A;  2LA8 A;  2D92 A;  3QJN A;  3PDZ A;  1NTE A;  2WL7 A;  2HGA A;  2UZC A;  3TSV A;  2EEH A;  2KAW A;  4E35 A;  1UEQ A;  2KG2 A;  3STJ A;  3GCO A;  1U38 A;  1QAU A;  2I0L A;  3CYY A;  1TP5 A;  1M5Z A;  4NXP A;  3I1E A;  1NF3 C;  4WYT A;  1WF7 A;  2PZD A;  3R68 A;  2IWO A;  2KRG A;  4UU5 A;  2IWN A;  2V90 A;  4IC6 A;  1WI2 A;  1V5L A;  2I0I A;  3K50 A;  2PA1 A;  2QG1 A;  2DM8 A;  2RCZ A;  1N6F A;  3R69 A;  4GHN A;  3QIK A;  3OU0 A;  4NNM A;  4Q2Q A;  2DJT A;  4NMR A;  4NMT A;  4GVD A;  1N7T A;  1UJD A;  1TP3 A;  4JL7 A;  4LMM A;  2F5Y A;  3CBX A;  2H2B A;  2KOJ A;  2JIK A;  3GJ9 A;  2LC7 A;  2PNT A;  5F3X A;  2JXO A;  3RL8 A;  2HE4 A;  2EJY A;  3CC0 A;  1U3B A;  4WYU A;  5GND A;  1MC7 A;  3HPM A;  5GLJ A;  3PV5 A;  4E3B A;  4NMQ A;  1FCF A;  1IU2 A;  2QBW A;  2G2L A;  1YBO A;  1OZI A;  2FE5 A;  4HOP A;  1BFE A;  2CS5 A;  3VQG A;  5EZ0 A;  3ID4 A;  3QDO A;  5D13 A;  3CS0 A;  2BYG A;  1VB7 A;  2G5M B;  5HFC A;  3EGH C;  1TE0 A;  3GDV A;  3DIW A;  2DAZ A;  2AWU A;  4P0C A;  2REY A;  2L97 A;  4JOP A;  1X45 A;  5FB8 C;  2VPH A;  1VCW A;  4NMO A;  1UHP A;  4NXR A;  3NFL A;  2DMZ A;  3I18 A;  1B8Q A;  4F8K A;  1N6E A;  1I16 A;  3ZRT A;  1WHD A;  2CSJ A;  2H2C A;  2JIN A;  5HF4 A;  2OSG A;  3MH4 A;  1MFG A;  1ZUB A;  2EEI A;  4P2A B;  2EEJ A;  2L4S A;  2KA9 A;  4K78 A;  2EDP A;  3LNX A;  5DTH A;  3L4F D;  2EDV A;  1GM1 A;  3CH8 A;  4Z33 A;  3CBY A;  2D8I A;  1R6J A;  1KWA A;  5E11 A;  2VZ5 A;  2DLU A;  3RLE A;  1X8S A;  1UM1 A;  1Q3P A;  1Z87 A;  1WFG A;  3EGG C;  2OZF A;  2DKR A;  2YUY A;  1TQ3 A;  2R3Y A;  5G1E A;  3K82 A;  3R0H A;  2F0A A;  1D5G A;  5I7Z A;  1N7E A;  2EDZ A;  2X7Z A;  1OBX A;  3PS4 A;  2E7K A;  3WKL A;  1N99 A;  4UU6 A;  2AWW A;  3SOE A;  3KZD A;  4YDP A;  3ID3 A;  3E17 A;  2KPL A;  2OQS A;  4GVC A;  3GSL A;  3I4W A;  3OTP A;  2AIN A;  4H11 A;  1UEZ A;  1V6B A;  2ZPL A;  3SFJ A;  2P3W A;  1I92 A;  2LC6 A;  2QT5 A;  3SHU A;  2EV8 A;  2ENO A;  1MFL A;  2EHR A;  2FCF A;  4NMS A;  1VJ6 A;  3RL7 A;  5A2P A;  2OPG A;  3MH6 A;  2I6V A;  4OEP A;  4JOJ A;  2KV8 A;  1IU0 A;  2FN5 A;  2KBS A;  3JXT A;  1GQ5 A;  3LNY A;  2O2T A;  4JOF A;  1G9O A;  1P1E A;  1ZOK A;  4PQW A;  1WIF A;  2EGN A;  1UJV A;  1W9Q A;  4JOK A;  5HEY A;  1UJU A;  5G1D A;  4Q2N A;  4Q2O A;  2Q3G A;  3KHF A;  4L8N A;  5HFD A;  2JRE A;  1VA8 A;  1UFX A;  2AWX A;  2ZPM A;  1WHA A;  2YTW A;  2W7R A;  3GDS A;  3O5N A;  2PKT A;  2IWQ A;  5H3J A;  3TSZ A;  1OBY A;  2QKV A;  2LUI A;  1UEW A;  5HET A;  2K20 A;  1SOZ A;  1WI4 A;  5HFF A;  1UEP A;  1VAE A;  5HF1 A;  4OEO A;  5HJ1 A;  2VSV A;  4JOE A;  1Y7N A;  5E1Y A;  3DJ3 A;  2Z17 A;  2Z9I A;  2OS6 A;  2R4H A;  1UIT A;  3NFK A;  1QLC A;  4O06 A;  1Q3O A;  2I04 A;  1LCY A;  1WH1 A;  4Q6S A;  2KPK A;  4E34 A;  1RY4 A;  1P1D A;  1QAV B;  2M3M A;  4NMP A;  2OMJ A;  2JIL A;  2PDZ A;  5JXB A;  3SUZ A;  2DLS A;  3DJ1 A;  4REY A;  2I4S A;  1WG6 A;  1X5Q A;  3QO6 A;  5HFB A;  2LOB A;  1Q7X A;  2VSP A;  3DJA A;  3QE1 A;  4KFV A;  3TSW A;  2RRM A;  3DOR A;  3KZE A;  5E6P B;  1N6D A;  2YT7 A;  4EDJ A;  2DC2 A;  2H3M A;  3GGE A;  2MX6 A;  4FGM A;  1RGW A;  1Z86 A;  4K76 A;  3GDU A;  1W9E A;  4NXQ A;  2K1Z A;  1WJL A; 
#chains in the Genus database with same CATH topology
 2EAQ A;  2KYL A;  2H3L A;  2JSN A;  2HE2 A;  3SHW A;  4K6Y A;  3PV2 A;  2M0T A;  2KOH A;  1FC6 A;  2YUB A;  2PKU A;  3HPK A;  2QKU A;  1X5N A;  2EGK A;  4Q3H A;  3FY5 A;  2M0V A;  1OBZ A;  1FC7 A;  2JOA A;  3B76 A;  3WKM A;  4AMH A;  2FNE A;  4JOR A;  1XZ9 A;  2KQF A;  1FC9 A;  1WFV A;  3PDV A;  1K32 A;  1WF8 A;  2D90 A;  1T2M A;  1RZX A;  1V62 A;  1QAV A;  1KY9 A;  2VWR A;  1UM7 A;  3TMH A;  2GEF A;  2DB5 A;  5HEB A;  2KOM A;  4MPA A;  1W9O A;  5E22 A;  2M0Z A;  1X6D A;  1U37 A;  2VRF A;  5F67 A;  3QGL A;  2EXG A;  5FHT A;  2IWP A;  5HDY A;  2KL1 A;  4NMV A;  4Q6H A;  1BE9 A;  3CBZ A;  1GQ4 A;  4KFW A;  1X9Z A;  1SOT A;  1X5R A;  5HFE A;  3AXA A;  4JOG A;  2V1W A;  4OAJ A;  5HED A;  1IHJ A;  2MHO A;  2Q9V A;  1UF1 A;  2L4T A;  3HVQ C;  2OGP A;  2W4F A;  3MH7 A;  1L6O A;  1KEF A;  4JJ0 A;  3O46 A;  2GZV A;  4RI0 A;  3QJM A;  4Z8J A;  2M10 A;  3ID2 A;  5EYZ A;  5B6L A;  5E21 A;  3VQF A;  1U39 A;  2I1N A;  1V1T A;  3NGH A;  4XHV A;  2JWE A;  1V5Q A;  4K75 A;  4JOH A;  3BPU A;  4YYX A;  5IL9 A;  4Q2P A;  2KJD A;  2QKT A;  1N7F A;  4JJ3 A;  2EEG A;  1PDR A;  2KJK A;  3GCN A;  2M0U A;  2OCS A;  2EGO A;  2YT8 A;  4HOP B;  3ID1 A;  1RGR A;  4N6X A;  2KJP A;  3K1R A;  4R2Z A;  3PV4 A;  4G69 A;  2CSS A;  4NNL A;  4K72 A;  1Y8T A;  2LA8 A;  2D92 A;  3QJN A;  3PDZ A;  1NTE A;  2WL7 A;  4FLN A;  2HGA A;  2UZC A;  3TSV A;  2EEH A;  2KAW A;  4E35 A;  1UEQ A;  2KG2 A;  3STJ A;  3GCO A;  1U38 A;  1QAU A;  2I0L A;  3CYY A;  1TP5 A;  1M5Z A;  5B42 A;  4NXP A;  3I1E A;  1NF3 C;  4WYT A;  1WF7 A;  2PZD A;  3R68 A;  2IWO A;  2KRG A;  4UU5 A;  2IWN A;  2V90 A;  4IC6 A;  1WI2 A;  1V5L A;  2I0I A;  3K50 A;  2PA1 A;  2QG1 A;  2DM8 A;  2RCZ A;  1N6F A;  3R69 A;  4GHN A;  3QIK A;  3OU0 A;  4NNM A;  4Q2Q A;  2DJT A;  4NMR A;  4NMT A;  4GVD A;  1N7T A;  1UJD A;  1TP3 A;  4JL7 A;  4LMM A;  2F5Y A;  3CBX A;  2H2B A;  2KOJ A;  2JIK A;  3GJ9 A;  2LC7 A;  2PNT A;  3KDG A;  5F3X A;  2JXO A;  3RL8 A;  2HE4 A;  2EJY A;  3CC0 A;  1U3B A;  4WYU A;  5GND A;  1MC7 A;  3HPM A;  5GLJ A;  3PV5 A;  4E3B A;  4NMQ A;  1FCF A;  1IU2 A;  2QBW A;  2G2L A;  1YBO A;  1OZI A;  2FE5 A;  4HOP A;  1BFE A;  2CS5 A;  3VQG A;  5EZ0 A;  3ID4 A;  3QDO A;  5D13 A;  3CS0 A;  2BYG A;  1VB7 A;  2G5M B;  5HFC A;  3EGH C;  1TE0 A;  3GDV A;  3DIW A;  2DAZ A;  2AWU A;  4P0C A;  2REY A;  2L97 A;  4JOP A;  1X45 A;  5FB8 C;  2VPH A;  1VCW A;  4NMO A;  1UHP A;  4NXR A;  3NFL A;  2DMZ A;  3I18 A;  1B8Q A;  4F8K A;  1N6E A;  1I16 A;  3ZRT A;  1WHD A;  2CSJ A;  2H2C A;  2JIN A;  5HF4 A;  2OSG A;  3MH4 A;  1MFG A;  1ZUB A;  2EEI A;  4P2A B;  2EEJ A;  2L4S A;  2KA9 A;  4K78 A;  2EDP A;  3LNX A;  5DTH A;  3L4F D;  2EDV A;  1GM1 A;  3CH8 A;  4Z33 A;  3CBY A;  2D8I A;  1R6J A;  1KWA A;  5E11 A;  2VZ5 A;  2DLU A;  3RLE A;  1X8S A;  1UM1 A;  1Q3P A;  1Z87 A;  1WFG A;  3EGG C;  2OZF A;  2DKR A;  2YUY A;  1TQ3 A;  2R3Y A;  5G1E A;  3K82 A;  3R0H A;  2F0A A;  1D5G A;  3GAB A;  5I7Z A;  1N7E A;  2EDZ A;  2X7Z A;  1OBX A;  3PS4 A;  2E7K A;  3WKL A;  1N99 A;  4UU6 A;  2AWW A;  3SOE A;  3KZD A;  4YDP A;  3ID3 A;  3E17 A;  2KPL A;  2OQS A;  4GVC A;  3GSL A;  3I4W A;  3OTP A;  3KDK A;  2AIN A;  4H11 A;  1UEZ A;  1V6B A;  2ZPL A;  3SFJ A;  2P3W A;  1I92 A;  2LC6 A;  2QT5 A;  3SHU A;  2EV8 A;  2ENO A;  1MFL A;  2EHR A;  2FCF A;  4NMS A;  1VJ6 A;  3RL7 A;  5A2P A;  2OPG A;  3MH6 A;  2I6V A;  4OEP A;  4JOJ A;  2KV8 A;  1IU0 A;  2FN5 A;  2KBS A;  3JXT A;  1GQ5 A;  3LNY A;  2O2T A;  4JOF A;  1G9O A;  1P1E A;  3NCV A;  1ZOK A;  4PQW A;  1WIF A;  2EGN A;  1UJV A;  1W9Q A;  4JOK A;  5HEY A;  1UJU A;  5G1D A;  4Q2N A;  4Q2O A;  2Q3G A;  3KHF A;  4L8N A;  5HFD A;  5ILB A;  2JRE A;  1VA8 A;  1UFX A;  2AWX A;  2ZPM A;  1WHA A;  2YTW A;  2W7R A;  3GDS A;  3O5N A;  2PKT A;  2IWQ A;  5H3J A;  3TSZ A;  1OBY A;  2QKV A;  2LUI A;  1UEW A;  5HET A;  2K20 A;  1SOZ A;  1WI4 A;  5HFF A;  1UEP A;  1VAE A;  5HF1 A;  4OEO A;  5HJ1 A;  2VSV A;  4JOE A;  1Y7N A;  5E1Y A;  3DJ3 A;  2Z17 A;  2Z9I A;  2OS6 A;  2R4H A;  1UIT A;  3NFK A;  1QLC A;  4O06 A;  1Q3O A;  2I04 A;  1LCY A;  1WH1 A;  4Q6S A;  2KPK A;  4E34 A;  1RY4 A;  1P1D A;  1QAV B;  2M3M A;  4NMP A;  2OMJ A;  2JIL A;  2PDZ A;  5JXB A;  3SUZ A;  2DLS A;  3DJ1 A;  4REY A;  2I4S A;  1WG6 A;  1X5Q A;  3QO6 A;  5HFB A;  2LOB A;  1Q7X A;  2VSP A;  3DJA A;  3QE1 A;  4KFV A;  3TSW A;  2RRM A;  3DOR A;  3KZE A;  5E6P B;  1N6D A;  2YT7 A;  4EDJ A;  2DC2 A;  2H3M A;  3GGE A;  2MX6 A;  4FGM A;  1RGW A;  1Z86 A;  4K76 A;  3GDU A;  1W9E A;  4NXQ A;  2K1Z A;  1WJL A; 
#chains in the Genus database with same CATH homology
 2EAQ A;  2KYL A;  2H3L A;  2JSN A;  2HE2 A;  3SHW A;  4K6Y A;  3PV2 A;  2M0T A;  2KOH A;  1FC6 A;  2YUB A;  2PKU A;  3HPK A;  2QKU A;  1X5N A;  2EGK A;  4Q3H A;  3FY5 A;  2M0V A;  1OBZ A;  1FC7 A;  2JOA A;  3B76 A;  3WKM A;  4AMH A;  2FNE A;  4JOR A;  1XZ9 A;  2KQF A;  1FC9 A;  1WFV A;  3PDV A;  1K32 A;  1WF8 A;  2D90 A;  1T2M A;  1RZX A;  1V62 A;  1QAV A;  1KY9 A;  2VWR A;  1UM7 A;  3TMH A;  2GEF A;  2DB5 A;  5HEB A;  2KOM A;  4MPA A;  1W9O A;  5E22 A;  2M0Z A;  1X6D A;  1U37 A;  2VRF A;  5F67 A;  3QGL A;  2EXG A;  5FHT A;  2IWP A;  5HDY A;  2KL1 A;  4NMV A;  4Q6H A;  1BE9 A;  3CBZ A;  1GQ4 A;  4KFW A;  1X9Z A;  1SOT A;  1X5R A;  5HFE A;  3AXA A;  4JOG A;  2V1W A;  4OAJ A;  5HED A;  1IHJ A;  2MHO A;  2Q9V A;  1UF1 A;  2L4T A;  3HVQ C;  2OGP A;  2W4F A;  3MH7 A;  1L6O A;  1KEF A;  4JJ0 A;  3O46 A;  2GZV A;  4RI0 A;  3QJM A;  4Z8J A;  2M10 A;  3ID2 A;  5EYZ A;  5B6L A;  5E21 A;  3VQF A;  1U39 A;  2I1N A;  1V1T A;  3NGH A;  4XHV A;  2JWE A;  1V5Q A;  4K75 A;  4JOH A;  3BPU A;  4YYX A;  5IL9 A;  4Q2P A;  2KJD A;  2QKT A;  1N7F A;  4JJ3 A;  2EEG A;  1PDR A;  2KJK A;  3GCN A;  2M0U A;  2OCS A;  2EGO A;  2YT8 A;  4HOP B;  3ID1 A;  1RGR A;  4N6X A;  2KJP A;  3K1R A;  4R2Z A;  3PV4 A;  4G69 A;  2CSS A;  4NNL A;  4K72 A;  1Y8T A;  2LA8 A;  2D92 A;  3QJN A;  3PDZ A;  1NTE A;  2WL7 A;  4FLN A;  2HGA A;  2UZC A;  3TSV A;  2EEH A;  2KAW A;  4E35 A;  1UEQ A;  2KG2 A;  3STJ A;  3GCO A;  1U38 A;  1QAU A;  2I0L A;  3CYY A;  1TP5 A;  1M5Z A;  5B42 A;  4NXP A;  3I1E A;  1NF3 C;  4WYT A;  1WF7 A;  2PZD A;  3R68 A;  2IWO A;  2KRG A;  4UU5 A;  2IWN A;  2V90 A;  4IC6 A;  1WI2 A;  1V5L A;  2I0I A;  3K50 A;  2PA1 A;  2QG1 A;  2DM8 A;  2RCZ A;  1N6F A;  3R69 A;  4GHN A;  3QIK A;  3OU0 A;  4NNM A;  4Q2Q A;  2DJT A;  4NMR A;  4NMT A;  4GVD A;  1N7T A;  1UJD A;  1TP3 A;  4JL7 A;  4LMM A;  2F5Y A;  3CBX A;  2H2B A;  2KOJ A;  2JIK A;  3GJ9 A;  2LC7 A;  2PNT A;  3KDG A;  5F3X A;  2JXO A;  3RL8 A;  2HE4 A;  2EJY A;  3CC0 A;  1U3B A;  4WYU A;  5GND A;  1MC7 A;  3HPM A;  5GLJ A;  3PV5 A;  4E3B A;  4NMQ A;  1FCF A;  1IU2 A;  2QBW A;  2G2L A;  1YBO A;  1OZI A;  2FE5 A;  4HOP A;  1BFE A;  2CS5 A;  3VQG A;  5EZ0 A;  3ID4 A;  3QDO A;  5D13 A;  3CS0 A;  2BYG A;  1VB7 A;  2G5M B;  5HFC A;  3EGH C;  1TE0 A;  3GDV A;  3DIW A;  2DAZ A;  2AWU A;  4P0C A;  2REY A;  2L97 A;  4JOP A;  1X45 A;  5FB8 C;  2VPH A;  1VCW A;  4NMO A;  1UHP A;  4NXR A;  3NFL A;  2DMZ A;  3I18 A;  1B8Q A;  4F8K A;  1N6E A;  1I16 A;  3ZRT A;  1WHD A;  2CSJ A;  2H2C A;  2JIN A;  5HF4 A;  2OSG A;  3MH4 A;  1MFG A;  1ZUB A;  2EEI A;  4P2A B;  2EEJ A;  2L4S A;  2KA9 A;  4K78 A;  2EDP A;  3LNX A;  5DTH A;  3L4F D;  2EDV A;  1GM1 A;  3CH8 A;  4Z33 A;  3CBY A;  2D8I A;  1R6J A;  1KWA A;  5E11 A;  2VZ5 A;  2DLU A;  3RLE A;  1X8S A;  1UM1 A;  1Q3P A;  1Z87 A;  1WFG A;  3EGG C;  2OZF A;  2DKR A;  2YUY A;  1TQ3 A;  2R3Y A;  5G1E A;  3K82 A;  3R0H A;  2F0A A;  1D5G A;  3GAB A;  5I7Z A;  1N7E A;  2EDZ A;  2X7Z A;  1OBX A;  3PS4 A;  2E7K A;  3WKL A;  1N99 A;  4UU6 A;  2AWW A;  3SOE A;  3KZD A;  4YDP A;  3ID3 A;  3E17 A;  2KPL A;  2OQS A;  4GVC A;  3GSL A;  3I4W A;  3OTP A;  3KDK A;  2AIN A;  4H11 A;  1UEZ A;  1V6B A;  2ZPL A;  3SFJ A;  2P3W A;  1I92 A;  2LC6 A;  2QT5 A;  3SHU A;  2EV8 A;  2ENO A;  1MFL A;  2EHR A;  2FCF A;  4NMS A;  1VJ6 A;  3RL7 A;  5A2P A;  2OPG A;  3MH6 A;  2I6V A;  4OEP A;  4JOJ A;  2KV8 A;  1IU0 A;  2FN5 A;  2KBS A;  3JXT A;  1GQ5 A;  3LNY A;  2O2T A;  4JOF A;  1G9O A;  1P1E A;  3NCV A;  1ZOK A;  4PQW A;  1WIF A;  2EGN A;  1UJV A;  1W9Q A;  4JOK A;  5HEY A;  1UJU A;  5G1D A;  4Q2N A;  4Q2O A;  2Q3G A;  3KHF A;  4L8N A;  5HFD A;  5ILB A;  2JRE A;  1VA8 A;  1UFX A;  2AWX A;  2ZPM A;  1WHA A;  2YTW A;  2W7R A;  3GDS A;  3O5N A;  2PKT A;  2IWQ A;  5H3J A;  3TSZ A;  1OBY A;  2QKV A;  2LUI A;  1UEW A;  5HET A;  2K20 A;  1SOZ A;  1WI4 A;  5HFF A;  1UEP A;  1VAE A;  5HF1 A;  4OEO A;  5HJ1 A;  2VSV A;  4JOE A;  1Y7N A;  5E1Y A;  3DJ3 A;  2Z17 A;  2Z9I A;  2OS6 A;  2R4H A;  1UIT A;  3NFK A;  1QLC A;  4O06 A;  1Q3O A;  2I04 A;  1LCY A;  1WH1 A;  4Q6S A;  2KPK A;  4E34 A;  1RY4 A;  1P1D A;  1QAV B;  2M3M A;  4NMP A;  2OMJ A;  2JIL A;  2PDZ A;  5JXB A;  3SUZ A;  2DLS A;  3DJ1 A;  4REY A;  2I4S A;  1WG6 A;  1X5Q A;  3QO6 A;  5HFB A;  2LOB A;  1Q7X A;  2VSP A;  3DJA A;  3QE1 A;  4KFV A;  3TSW A;  2RRM A;  3DOR A;  3KZE A;  5E6P B;  1N6D A;  2YT7 A;  4EDJ A;  2DC2 A;  2H3M A;  3GGE A;  2MX6 A;  4FGM A;  1RGW A;  1Z86 A;  4K76 A;  3GDU A;  1W9E A;  4NXQ A;  2K1Z A;  1WJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...