3E17A

Crystal structure of the second pdz domain from human zona occludens-2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
b'MIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-2
publication title Structure of the second PDZ domain from human zonula occludens 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 13
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3e17A01
2AINA 4NMOA 2ZPLA 1LCYA 1VJ6A 2EEGA 2JREA 2JILA 3B76A 1UM7A 4HOPB 4UU6A 1TE0A 1MC7A 4PQWA 3DJ1A 2VSPA 2YUBA 1N6DA 3SUZA 5B6LA 3ID4A 1WI4A 2CS5A 1V5LA 3GGEA 2KOJA 4K72A 1U39A 4REYA 1XZ9A 2X7ZA 1WF8A 4WYTA 2EDVA 4JOJA 1N99A 3PV2A 2F5YA 1OZIA 2QKUA 3I4WA 2OPGA 3ID1A 3QDOA 2W7RA 3KHFA 2IWOA 1X5RA 2KOMA 4O06A 4NXQA 1Q3OA 1RGRA 4OEOA 3I1EA 3LNYA 2KJKA 2OMJA 1NF3C 3CH8A 3VQGA 1UEZA 2Q9VA 4Q6SA 1UM1A 2KJPA 4H11A 3R69A 1Z87A 4Q2NA 1N6FA 4JOGA 2R3YA 1BE9A 2JINA 1UITA 3QJMA 3DIWA 5HF4A 3DJAA 3PV5A 1R6JA 2KL1A 5E21A 5GNDA 2FN5A 1SOTA 1I16A 3I18A 5D13A 4EDJA 1WIFA 2K20A 1Y8TA 2PKTA 1GM1A 2KJDA 2V90A 1RY4A 1B8QA 2DKRA 2AWWA 1N7TA 3EGGC 3NGHA 2DMZA 5E11A 1WF7A 2WL7A 2YT7A 2I6VA 5EZ0A 2M10A 3QE1A 3TSWA 2H2CA 1V5QA 2F0AA 2L4SA 2QG1A 4JOFA 2K1ZA 4L8NA 2VWRA 5HFFA 4NMSA 3WKMA 2KOHA 2Q3GA 4F8KA 3GJ9A 3RL8A 1X45A 4JL7A 2KBSA 4GVDA 2KRGA 3NFLA 2ENOA 4P2AB 5FB8C 4Q2OA 1QAUA 1TP3A 3E17A 4R2ZA 2HE4A 1WG6A 2EEHA 3QJNA 2CSSA 1GQ5A 2OCSA 1Q3PA 1WHDA 3GDUA 4E35A 3EGHC 3O5NA 3MH4A 2HGAA 4E3BA 2DB5A 2RCZA 1K32A 2EJYA 2QBWA 3TSVA 2KPLA 3OTPA 2DM8A 1TP5A 2YT8A 2I04A 2M0ZA 1QAVB 4MPAA 3L4FD 1BFEA 4Q2QA 1WH1A 1WFVA 2GZVA 2V1WA 2Z9IA 1GQ4A 3SHWA 1P1DA 4OAJA 3KZEA 4NMPA 2ZPMA 4XHVA 2EAQA 2VRFA 5HFCA 2KA9A 1P1EA 3VQFA 2JXOA 1IHJA 2IWPA 1WHAA 1UEPA 5HFDA 4NMRA 1FCFA 3AXAA 5HF1A 1X8SA 1UEQA 5G1DA 2EXGA 1T2MA 4Z8JA 2KYLA 1VCWA 5G1EA 2PZDA 1OBYA 2EGKA 5HEBA 4JOKA 2E7KA 2H2BA 2L97A 1UFXA 1V62A 4AMHA 2H3LA 4K6YA 1IU2A 4NMQA 2P3WA 3GDSA 4HOPA 2KAWA 3RLEA 2EDZA 2AWUA 4JOHA 2W4FA 1QLCA 4IC6A 2UZCA 1I92A 4K76A 5HJ1A 1SOZA 2OGPA 2MHOA 2CSJA 5GLJA 4YYXA 2AWXA 2M0UA 2M3MA 3MH6A 1NTEA 2IWNA 4NMVA 2KQFA 2REYA 2D90A 2LC7A 2O2TA 4JOEA 4Q3HA 1FC6A 5H3JA 2VSVA 2QT5A 1W9QA 2I1NA 3R68A 1UJDA 3QGLA 3GCOA 2YTWA 2FCFA 3ZRTA 2LC6A 3QO6A 1OBXA 4K75A 2KG2A 1N7FA 3PDVA 4P0CA 3TSZA 5E22A 3ID2A 4JORA 3DJ3A 5E6PB 2OS6A 5EYZA 2OZFA 1UF1A 5F67A 3K82A 3HVQC 3DORA 3K1RA 2OQSA 1G9OA 3FY5A 1YBOA 1UEWA 1ZOKA 2PA1A 1MFLA 5HEYA 4N6XA 2LUIA 1VA8A 2H3MA 1OBZA 4YDPA 4GVCA 2D92A 4E34A 4KFVA 1RGWA 3CBXA 3CC0A 3ID3A 1M5ZA 2G2LA 2KV8A 2JOAA 1KEFA 2EGNA 2JIKA 2EGOA 2EHRA 5A2PA 2VZ5A 4NNLA 2OSGA 5DTHA 1FC9A 4RI0A 5HDYA 2M0TA 1W9EA 3TMHA 1PDRA 1UHPA 3CBYA 1U38A 3GDVA 3NFKA 4KFWA 3HPKA 3CYYA 1W9OA 5HETA 2YUYA 3SOEA 3OU0A 2I0LA 2EEIA 3STJA 1IU0A 2L4TA 2EV8A 2PKUA 3R0HA 5HFBA 1Y7NA 3K50A 1KWAA 2PNTA 2FNEA 2M0VA 2DLUA 1RZXA 4NNMA 4OEPA 3RL7A 2VPHA 3CS0A 4JOPA 4Q2PA 2LA8A 3BPUA 3KZDA 4Q6HA 1Z86A 3MH7A 1MFGA 2EDPA 3PDZA 1WJLA 3GSLA 2DLSA 1N6EA 2D8IA 2PDZA 2I0IA 2LOBA 3PS4A 5HEDA 2DAZA 4WYUA 5HFEA 2HE2A 2BYGA 2JWEA 1D5GA 1FC7A 3PV4A 1V6BA 4Z33A 3GCNA 2G5MB 4NXRA 3SFJA 2QKVA 1X5QA 2QKTA 2RRMA 3LNXA 3CBZA 1UJUA 5JXBA 1QAVA 1VAEA 2KPKA 2MX6A 1L6OA 1X5NA 1WI2A 1ZUBA 3QIKA 1V1TA 5E1YA 4UU5A 3O46A 2DJTA 2I4SA 3JXTA 5FHTA 4LMMA 1N7EA 1UJVA 4NMTA 1WFGA 2FE5A 1VB7A 5F3XA 2IWQA 2DC2A 2R4HA 4G69A 3HPMA 4K78A 3SHUA 1KY9A 3WKLA 4NXPA 4FGMA 2EEJA 2Z17A 4GHNA 1X6DA 5I7ZA 1TQ3A 1U3BA 1Q7XA 1U37A
chains in the Genus database with same CATH superfamily
2AINA 4NMOA 2ZPLA 1LCYA 1VJ6A 2EEGA 2JREA 2JILA 3B76A 1UM7A 4HOPB 4UU6A 1TE0A 1MC7A 4PQWA 3DJ1A 2VSPA 2YUBA 1N6DA 3SUZA 5B6LA 3ID4A 1WI4A 2CS5A 1V5LA 3GGEA 2KOJA 4K72A 1U39A 4REYA 1XZ9A 2X7ZA 1WF8A 4WYTA 2EDVA 4JOJA 1N99A 3PV2A 2F5YA 1OZIA 2QKUA 3I4WA 2OPGA 3ID1A 3QDOA 2W7RA 3KHFA 2IWOA 1X5RA 2KOMA 4O06A 4NXQA 1Q3OA 1RGRA 4OEOA 3I1EA 3LNYA 2KJKA 2OMJA 1NF3C 3CH8A 3VQGA 1UEZA 2Q9VA 4Q6SA 1UM1A 2KJPA 4H11A 3R69A 1Z87A 4Q2NA 1N6FA 4JOGA 2R3YA 1BE9A 2JINA 1UITA 3QJMA 3DIWA 5HF4A 3DJAA 3PV5A 1R6JA 2KL1A 5E21A 5GNDA 2FN5A 1SOTA 1I16A 3I18A 5D13A 4EDJA 4JJ0A 1WIFA 2K20A 1Y8TA 2PKTA 1GM1A 2KJDA 2V90A 1RY4A 1B8QA 2DKRA 2AWWA 1N7TA 3EGGC 3NGHA 2DMZA 5E11A 1WF7A 2WL7A 2YT7A 2I6VA 5EZ0A 2M10A 3QE1A 3TSWA 2H2CA 2GEFA 1V5QA 2F0AA 2L4SA 2QG1A 4JOFA 2K1ZA 4L8NA 2VWRA 5HFFA 4NMSA 3WKMA 2KOHA 2Q3GA 4F8KA 3GJ9A 3RL8A 1X45A 4JL7A 2KBSA 4GVDA 2KRGA 3NFLA 2ENOA 4P2AB 5FB8C 4Q2OA 1QAUA 1TP3A 3E17A 4R2ZA 2HE4A 1WG6A 2EEHA 3KDGA 3QJNA 2CSSA 1GQ5A 2OCSA 1Q3PA 5IL9A 1WHDA 3GDUA 4E35A 3EGHC 3O5NA 3MH4A 2HGAA 4E3BA 2DB5A 2RCZA 1K32A 2EJYA 2QBWA 3TSVA 2KPLA 3OTPA 2DM8A 1TP5A 2YT8A 2I04A 2M0ZA 1QAVB 4MPAA 3L4FD 1X9ZA 1BFEA 4Q2QA 1WH1A 1WFVA 2GZVA 2V1WA 2Z9IA 1GQ4A 3SHWA 1P1DA 4OAJA 3KZEA 4NMPA 2ZPMA 4XHVA 2EAQA 2VRFA 5HFCA 2KA9A 1P1EA 3VQFA 2JXOA 1IHJA 2IWPA 1WHAA 1UEPA 5HFDA 4NMRA 1FCFA 3AXAA 5HF1A 1X8SA 1UEQA 5G1DA 2EXGA 1T2MA 4Z8JA 2KYLA 1VCWA 5G1EA 2PZDA 1OBYA 2EGKA 5HEBA 4JOKA 2E7KA 2H2BA 2L97A 1UFXA 1V62A 4AMHA 2H3LA 4K6YA 1IU2A 4NMQA 2P3WA 3GDSA 4HOPA 2KAWA 3RLEA 2EDZA 2AWUA 4JOHA 2W4FA 1QLCA 4IC6A 2UZCA 1I92A 4K76A 5HJ1A 1SOZA 2OGPA 2MHOA 2CSJA 5GLJA 4YYXA 2AWXA 2M0UA 2M3MA 3MH6A 1NTEA 2IWNA 4NMVA 2KQFA 2REYA 2D90A 2LC7A 2O2TA 4JOEA 4Q3HA 1FC6A 4JJ3A 5H3JA 2VSVA 2QT5A 1W9QA 2I1NA 3R68A 1UJDA 3QGLA 3GCOA 2YTWA 2FCFA 3ZRTA 2LC6A 3QO6A 1OBXA 4K75A 2KG2A 1N7FA 3PDVA 4P0CA 3TSZA 5E22A 3ID2A 4JORA 3DJ3A 5E6PB 2OS6A 5EYZA 2OZFA 1UF1A 5F67A 3K82A 3HVQC 3DORA 2OQSA 1G9OA 3K1RA 3FY5A 1YBOA 1UEWA 1ZOKA 2PA1A 1MFLA 5HEYA 4N6XA 2LUIA 1VA8A 2H3MA 1OBZA 4YDPA 4GVCA 2D92A 4E34A 4KFVA 1RGWA 4FLNA 3CBXA 3CC0A 3ID3A 1M5ZA 2G2LA 2KV8A 2JOAA 1KEFA 2EGNA 2JIKA 2EGOA 2EHRA 5A2PA 2VZ5A 4NNLA 2OSGA 5DTHA 1FC9A 4RI0A 5HDYA 2M0TA 1W9EA 3TMHA 1PDRA 1UHPA 3CBYA 1U38A 3GDVA 3NFKA 4KFWA 3HPKA 3CYYA 1W9OA 5HETA 2YUYA 3SOEA 3OU0A 5B42A 2I0LA 2EEIA 3STJA 1IU0A 2L4TA 2EV8A 2PKUA 3R0HA 5HFBA 1Y7NA 3K50A 1KWAA 2PNTA 2FNEA 2M0VA 2DLUA 1RZXA 4NNMA 4OEPA 3RL7A 2VPHA 3CS0A 4JOPA 4Q2PA 2LA8A 3BPUA 3KZDA 4Q6HA 1Z86A 3MH7A 1MFGA 2EDPA 3PDZA 1WJLA 3GSLA 2DLSA 1N6EA 2D8IA 2PDZA 2I0IA 2LOBA 3PS4A 5HEDA 2DAZA 4WYUA 5HFEA 2HE2A 2BYGA 2JWEA 1D5GA 1FC7A 3PV4A 1V6BA 4Z33A 3GCNA 2G5MB 4NXRA 3SFJA 2QKVA 1X5QA 2QKTA 2RRMA 3LNXA 3CBZA 1UJUA 5JXBA 1QAVA 1VAEA 2KPKA 2MX6A 5ILBA 1L6OA 1X5NA 1WI2A 3NCVA 1ZUBA 3QIKA 1V1TA 5E1YA 4UU5A 3O46A 2DJTA 2I4SA 3GABA 2JSNA 3JXTA 3KDKA 5FHTA 4LMMA 1N7EA 1UJVA 4NMTA 1WFGA 2FE5A 1VB7A 5F3XA 2IWQA 2DC2A 2R4HA 4G69A 3HPMA 4K78A 3SHUA 1KY9A 3WKLA 4NXPA 4FGMA 2EEJA 2Z17A 4GHNA 1X6DA 5I7ZA 1TQ3A 1U3BA 1Q7XA 1U37A
chains in the Genus database with same CATH topology
2AINA 4NMOA 2ZPLA 1LCYA 1VJ6A 2EEGA 2JREA 2JILA 3B76A 1UM7A 4HOPB 4UU6A 1TE0A 1MC7A 4PQWA 3DJ1A 2VSPA 2YUBA 1N6DA 3SUZA 5B6LA 3ID4A 1WI4A 2CS5A 1V5LA 3GGEA 2KOJA 4K72A 1U39A 4REYA 1XZ9A 2X7ZA 1WF8A 4WYTA 2EDVA 4JOJA 1N99A 3PV2A 2F5YA 1OZIA 2QKUA 3I4WA 2OPGA 3ID1A 3QDOA 2W7RA 3KHFA 2IWOA 1X5RA 2KOMA 4O06A 4NXQA 1Q3OA 1RGRA 4OEOA 3I1EA 3LNYA 2KJKA 2OMJA 1NF3C 3CH8A 3VQGA 1UEZA 2Q9VA 4Q6SA 1UM1A 2KJPA 4H11A 3R69A 1Z87A 4Q2NA 1N6FA 4JOGA 2R3YA 1BE9A 2JINA 1UITA 3QJMA 3DIWA 5HF4A 3DJAA 3PV5A 1R6JA 2KL1A 5E21A 5GNDA 2FN5A 1SOTA 1I16A 3I18A 5D13A 4EDJA 4JJ0A 1WIFA 2K20A 1Y8TA 2PKTA 1GM1A 2KJDA 2V90A 1RY4A 1B8QA 2DKRA 2AWWA 1N7TA 3EGGC 3NGHA 2DMZA 5E11A 1WF7A 2WL7A 2YT7A 2I6VA 5EZ0A 2M10A 3QE1A 3TSWA 2H2CA 2GEFA 1V5QA 2F0AA 2L4SA 2QG1A 4JOFA 2K1ZA 4L8NA 2VWRA 5HFFA 4NMSA 3WKMA 2KOHA 2Q3GA 4F8KA 3GJ9A 3RL8A 1X45A 4JL7A 2KBSA 4GVDA 2KRGA 3NFLA 2ENOA 4P2AB 5FB8C 4Q2OA 1QAUA 1TP3A 3E17A 4R2ZA 2HE4A 1WG6A 2EEHA 3KDGA 3QJNA 2CSSA 1GQ5A 2OCSA 1Q3PA 5IL9A 1WHDA 3GDUA 4E35A 3EGHC 3O5NA 3MH4A 2HGAA 4E3BA 2DB5A 2RCZA 1K32A 2EJYA 2QBWA 3TSVA 2KPLA 3OTPA 2DM8A 1TP5A 2YT8A 2I04A 2M0ZA 1QAVB 4MPAA 3L4FD 1X9ZA 1BFEA 4Q2QA 1WH1A 1WFVA 2GZVA 2V1WA 2Z9IA 1GQ4A 3SHWA 1P1DA 4OAJA 3KZEA 4NMPA 2ZPMA 4XHVA 2EAQA 2VRFA 5HFCA 2KA9A 1P1EA 3VQFA 2JXOA 1IHJA 2IWPA 1WHAA 1UEPA 5HFDA 4NMRA 1FCFA 3AXAA 5HF1A 1X8SA 1UEQA 5G1DA 2EXGA 1T2MA 4Z8JA 2KYLA 1VCWA 5G1EA 2PZDA 1OBYA 2EGKA 5HEBA 4JOKA 2E7KA 2H2BA 2L97A 1UFXA 1V62A 4AMHA 2H3LA 4K6YA 1IU2A 4NMQA 2P3WA 3GDSA 4HOPA 2KAWA 3RLEA 2EDZA 2AWUA 4JOHA 2W4FA 1QLCA 4IC6A 2UZCA 1I92A 4K76A 5HJ1A 1SOZA 2OGPA 2MHOA 2CSJA 5GLJA 4YYXA 2AWXA 2M0UA 2M3MA 3MH6A 1NTEA 2IWNA 4NMVA 2KQFA 2REYA 2D90A 2LC7A 2O2TA 4JOEA 4Q3HA 1FC6A 4JJ3A 5H3JA 2VSVA 2QT5A 1W9QA 2I1NA 3R68A 1UJDA 3QGLA 3GCOA 2YTWA 2FCFA 3ZRTA 2LC6A 3QO6A 1OBXA 4K75A 2KG2A 1N7FA 3PDVA 4P0CA 3TSZA 5E22A 3ID2A 4JORA 3DJ3A 5E6PB 2OS6A 5EYZA 2OZFA 1UF1A 5F67A 3K82A 3HVQC 3DORA 2OQSA 1G9OA 3K1RA 3FY5A 1YBOA 1UEWA 1ZOKA 2PA1A 1MFLA 5HEYA 4N6XA 2LUIA 1VA8A 2H3MA 1OBZA 4YDPA 4GVCA 2D92A 4E34A 4KFVA 1RGWA 4FLNA 3CBXA 3CC0A 3ID3A 1M5ZA 2G2LA 2KV8A 2JOAA 1KEFA 2EGNA 2JIKA 2EGOA 2EHRA 5A2PA 2VZ5A 4NNLA 2OSGA 5DTHA 1FC9A 4RI0A 5HDYA 2M0TA 1W9EA 3TMHA 1PDRA 1UHPA 3CBYA 1U38A 3GDVA 3NFKA 4KFWA 3HPKA 3CYYA 1W9OA 5HETA 2YUYA 3SOEA 3OU0A 5B42A 2I0LA 2EEIA 3STJA 1IU0A 2L4TA 2EV8A 2PKUA 3R0HA 5HFBA 1Y7NA 3K50A 1KWAA 2PNTA 2FNEA 2M0VA 2DLUA 1RZXA 4NNMA 4OEPA 3RL7A 2VPHA 3CS0A 4JOPA 4Q2PA 2LA8A 3BPUA 3KZDA 4Q6HA 1Z86A 3MH7A 1MFGA 2EDPA 3PDZA 1WJLA 3GSLA 2DLSA 1N6EA 2D8IA 2PDZA 2I0IA 2LOBA 3PS4A 5HEDA 2DAZA 4WYUA 5HFEA 2HE2A 2BYGA 2JWEA 1D5GA 1FC7A 3PV4A 1V6BA 4Z33A 3GCNA 2G5MB 4NXRA 3SFJA 2QKVA 1X5QA 2QKTA 2RRMA 3LNXA 3CBZA 1UJUA 5JXBA 1QAVA 1VAEA 2KPKA 2MX6A 5ILBA 1L6OA 1X5NA 1WI2A 3NCVA 1ZUBA 3QIKA 1V1TA 5E1YA 4UU5A 3O46A 2DJTA 2I4SA 3GABA 2JSNA 3JXTA 3KDKA 5FHTA 4LMMA 1N7EA 1UJVA 4NMTA 1WFGA 2FE5A 1VB7A 5F3XA 2IWQA 2DC2A 2R4HA 4G69A 3HPMA 4K78A 3SHUA 1KY9A 3WKLA 4NXPA 4FGMA 2EEJA 2Z17A 4GHNA 1X6DA 5I7ZA 1TQ3A 1U3BA 1Q7XA 1U37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AIN A;  4NMO A;  2ZPL A;  1LCY A;  1VJ6 A;  2EEG A;  2JRE A;  2JIL A;  3B76 A;  1UM7 A;  4HOP B;  4UU6 A;  1TE0 A;  1MC7 A;  4PQW A;  3DJ1 A;  2VSP A;  2YUB A;  1N6D A;  3SUZ A;  5B6L A;  3ID4 A;  1WI4 A;  2CS5 A;  1V5L A;  3GGE A;  2KOJ A;  4K72 A;  1U39 A;  4REY A;  1XZ9 A;  2X7Z A;  1WF8 A;  4WYT A;  2EDV A;  4JOJ A;  1N99 A;  3PV2 A;  2F5Y A;  1OZI A;  2QKU A;  3I4W A;  2OPG A;  3ID1 A;  3QDO A;  2W7R A;  3KHF A;  2IWO A;  1X5R A;  2KOM A;  4O06 A;  4NXQ A;  1Q3O A;  1RGR A;  4OEO A;  3I1E A;  3LNY A;  2KJK A;  2OMJ A;  1NF3 C;  3CH8 A;  3VQG A;  1UEZ A;  2Q9V A;  4Q6S A;  1UM1 A;  2KJP A;  4H11 A;  3R69 A;  1Z87 A;  4Q2N A;  1N6F A;  4JOG A;  2R3Y A;  1BE9 A;  2JIN A;  1UIT A;  3QJM A;  3DIW A;  5HF4 A;  3DJA A;  3PV5 A;  1R6J A;  2KL1 A;  5E21 A;  5GND A;  2FN5 A;  1SOT A;  1I16 A;  3I18 A;  5D13 A;  4EDJ A;  1WIF A;  2K20 A;  1Y8T A;  2PKT A;  1GM1 A;  2KJD A;  2V90 A;  1RY4 A;  1B8Q A;  2DKR A;  2AWW A;  1N7T A;  3EGG C;  3NGH A;  2DMZ A;  5E11 A;  1WF7 A;  2WL7 A;  2YT7 A;  2I6V A;  5EZ0 A;  2M10 A;  3QE1 A;  3TSW A;  2H2C A;  1V5Q A;  2F0A A;  2L4S A;  2QG1 A;  4JOF A;  2K1Z A;  4L8N A;  2VWR A;  5HFF A;  4NMS A;  3WKM A;  2KOH A;  2Q3G A;  4F8K A;  3GJ9 A;  3RL8 A;  1X45 A;  4JL7 A;  2KBS A;  4GVD A;  2KRG A;  3NFL A;  2ENO A;  4P2A B;  5FB8 C;  4Q2O A;  1QAU A;  1TP3 A;  3E17 A;  4R2Z A;  2HE4 A;  1WG6 A;  2EEH A;  3QJN A;  2CSS A;  1GQ5 A;  2OCS A;  1Q3P A;  1WHD A;  3GDU A;  4E35 A;  3EGH C;  3O5N A;  3MH4 A;  2HGA A;  4E3B A;  2DB5 A;  2RCZ A;  1K32 A;  2EJY A;  2QBW A;  3TSV A;  2KPL A;  3OTP A;  2DM8 A;  1TP5 A;  2YT8 A;  2I04 A;  2M0Z A;  1QAV B;  4MPA A;  3L4F D;  1BFE A;  4Q2Q A;  1WH1 A;  1WFV A;  2GZV A;  2V1W A;  2Z9I A;  1GQ4 A;  3SHW A;  1P1D A;  4OAJ A;  3KZE A;  4NMP A;  2ZPM A;  4XHV A;  2EAQ A;  2VRF A;  5HFC A;  2KA9 A;  1P1E A;  3VQF A;  2JXO A;  1IHJ A;  2IWP A;  1WHA A;  1UEP A;  5HFD A;  4NMR A;  1FCF A;  3AXA A;  5HF1 A;  1X8S A;  1UEQ A;  5G1D A;  2EXG A;  1T2M A;  4Z8J A;  2KYL A;  1VCW A;  5G1E A;  2PZD A;  1OBY A;  2EGK A;  5HEB A;  4JOK A;  2E7K A;  2H2B A;  2L97 A;  1UFX A;  1V62 A;  4AMH A;  2H3L A;  4K6Y A;  1IU2 A;  4NMQ A;  2P3W A;  3GDS A;  4HOP A;  2KAW A;  3RLE A;  2EDZ A;  2AWU A;  4JOH A;  2W4F A;  1QLC A;  4IC6 A;  2UZC A;  1I92 A;  4K76 A;  5HJ1 A;  1SOZ A;  2OGP A;  2MHO A;  2CSJ A;  5GLJ A;  4YYX A;  2AWX A;  2M0U A;  2M3M A;  3MH6 A;  1NTE A;  2IWN A;  4NMV A;  2KQF A;  2REY A;  2D90 A;  2LC7 A;  2O2T A;  4JOE A;  4Q3H A;  1FC6 A;  5H3J A;  2VSV A;  2QT5 A;  1W9Q A;  2I1N A;  3R68 A;  1UJD A;  3QGL A;  3GCO A;  2YTW A;  2FCF A;  3ZRT A;  2LC6 A;  3QO6 A;  1OBX A;  4K75 A;  2KG2 A;  1N7F A;  3PDV A;  4P0C A;  3TSZ A;  5E22 A;  3ID2 A;  4JOR A;  3DJ3 A;  5E6P B;  2OS6 A;  5EYZ A;  2OZF A;  1UF1 A;  5F67 A;  3K82 A;  3HVQ C;  3DOR A;  3K1R A;  2OQS A;  1G9O A;  3FY5 A;  1YBO A;  1UEW A;  1ZOK A;  2PA1 A;  1MFL A;  5HEY A;  4N6X A;  2LUI A;  1VA8 A;  2H3M A;  1OBZ A;  4YDP A;  4GVC A;  2D92 A;  4E34 A;  4KFV A;  1RGW A;  3CBX A;  3CC0 A;  3ID3 A;  1M5Z A;  2G2L A;  2KV8 A;  2JOA A;  1KEF A;  2EGN A;  2JIK A;  2EGO A;  2EHR A;  5A2P A;  2VZ5 A;  4NNL A;  2OSG A;  5DTH A;  1FC9 A;  4RI0 A;  5HDY A;  2M0T A;  1W9E A;  3TMH A;  1PDR A;  1UHP A;  3CBY A;  1U38 A;  3GDV A;  3NFK A;  4KFW A;  3HPK A;  3CYY A;  1W9O A;  5HET A;  2YUY A;  3SOE A;  3OU0 A;  2I0L A;  2EEI A;  3STJ A;  1IU0 A;  2L4T A;  2EV8 A;  2PKU A;  3R0H A;  5HFB A;  1Y7N A;  3K50 A;  1KWA A;  2PNT A;  2FNE A;  2M0V A;  2DLU A;  1RZX A;  4NNM A;  4OEP A;  3RL7 A;  2VPH A;  3CS0 A;  4JOP A;  4Q2P A;  2LA8 A;  3BPU A;  3KZD A;  4Q6H A;  1Z86 A;  3MH7 A;  1MFG A;  2EDP A;  3PDZ A;  1WJL A;  3GSL A;  2DLS A;  1N6E A;  2D8I A;  2PDZ A;  2I0I A;  2LOB A;  3PS4 A;  5HED A;  2DAZ A;  4WYU A;  5HFE A;  2HE2 A;  2BYG A;  2JWE A;  1D5G A;  1FC7 A;  3PV4 A;  1V6B A;  4Z33 A;  3GCN A;  2G5M B;  4NXR A;  3SFJ A;  2QKV A;  1X5Q A;  2QKT A;  2RRM A;  3LNX A;  3CBZ A;  1UJU A;  5JXB A;  1QAV A;  1VAE A;  2KPK A;  2MX6 A;  1L6O A;  1X5N A;  1WI2 A;  1ZUB A;  3QIK A;  1V1T A;  5E1Y A;  4UU5 A;  3O46 A;  2DJT A;  2I4S A;  3JXT A;  5FHT A;  4LMM A;  1N7E A;  1UJV A;  4NMT A;  1WFG A;  2FE5 A;  1VB7 A;  5F3X A;  2IWQ A;  2DC2 A;  2R4H A;  4G69 A;  3HPM A;  4K78 A;  3SHU A;  1KY9 A;  3WKL A;  4NXP A;  4FGM A;  2EEJ A;  2Z17 A;  4GHN A;  1X6D A;  5I7Z A;  1TQ3 A;  1U3B A;  1Q7X A;  1U37 A; 
#chains in the Genus database with same CATH topology
 2AIN A;  4NMO A;  2ZPL A;  1LCY A;  1VJ6 A;  2EEG A;  2JRE A;  2JIL A;  3B76 A;  1UM7 A;  4HOP B;  4UU6 A;  1TE0 A;  1MC7 A;  4PQW A;  3DJ1 A;  2VSP A;  2YUB A;  1N6D A;  3SUZ A;  5B6L A;  3ID4 A;  1WI4 A;  2CS5 A;  1V5L A;  3GGE A;  2KOJ A;  4K72 A;  1U39 A;  4REY A;  1XZ9 A;  2X7Z A;  1WF8 A;  4WYT A;  2EDV A;  4JOJ A;  1N99 A;  3PV2 A;  2F5Y A;  1OZI A;  2QKU A;  3I4W A;  2OPG A;  3ID1 A;  3QDO A;  2W7R A;  3KHF A;  2IWO A;  1X5R A;  2KOM A;  4O06 A;  4NXQ A;  1Q3O A;  1RGR A;  4OEO A;  3I1E A;  3LNY A;  2KJK A;  2OMJ A;  1NF3 C;  3CH8 A;  3VQG A;  1UEZ A;  2Q9V A;  4Q6S A;  1UM1 A;  2KJP A;  4H11 A;  3R69 A;  1Z87 A;  4Q2N A;  1N6F A;  4JOG A;  2R3Y A;  1BE9 A;  2JIN A;  1UIT A;  3QJM A;  3DIW A;  5HF4 A;  3DJA A;  3PV5 A;  1R6J A;  2KL1 A;  5E21 A;  5GND A;  2FN5 A;  1SOT A;  1I16 A;  3I18 A;  5D13 A;  4EDJ A;  4JJ0 A;  1WIF A;  2K20 A;  1Y8T A;  2PKT A;  1GM1 A;  2KJD A;  2V90 A;  1RY4 A;  1B8Q A;  2DKR A;  2AWW A;  1N7T A;  3EGG C;  3NGH A;  2DMZ A;  5E11 A;  1WF7 A;  2WL7 A;  2YT7 A;  2I6V A;  5EZ0 A;  2M10 A;  3QE1 A;  3TSW A;  2H2C A;  2GEF A;  1V5Q A;  2F0A A;  2L4S A;  2QG1 A;  4JOF A;  2K1Z A;  4L8N A;  2VWR A;  5HFF A;  4NMS A;  3WKM A;  2KOH A;  2Q3G A;  4F8K A;  3GJ9 A;  3RL8 A;  1X45 A;  4JL7 A;  2KBS A;  4GVD A;  2KRG A;  3NFL A;  2ENO A;  4P2A B;  5FB8 C;  4Q2O A;  1QAU A;  1TP3 A;  3E17 A;  4R2Z A;  2HE4 A;  1WG6 A;  2EEH A;  3KDG A;  3QJN A;  2CSS A;  1GQ5 A;  2OCS A;  1Q3P A;  5IL9 A;  1WHD A;  3GDU A;  4E35 A;  3EGH C;  3O5N A;  3MH4 A;  2HGA A;  4E3B A;  2DB5 A;  2RCZ A;  1K32 A;  2EJY A;  2QBW A;  3TSV A;  2KPL A;  3OTP A;  2DM8 A;  1TP5 A;  2YT8 A;  2I04 A;  2M0Z A;  1QAV B;  4MPA A;  3L4F D;  1X9Z A;  1BFE A;  4Q2Q A;  1WH1 A;  1WFV A;  2GZV A;  2V1W A;  2Z9I A;  1GQ4 A;  3SHW A;  1P1D A;  4OAJ A;  3KZE A;  4NMP A;  2ZPM A;  4XHV A;  2EAQ A;  2VRF A;  5HFC A;  2KA9 A;  1P1E A;  3VQF A;  2JXO A;  1IHJ A;  2IWP A;  1WHA A;  1UEP A;  5HFD A;  4NMR A;  1FCF A;  3AXA A;  5HF1 A;  1X8S A;  1UEQ A;  5G1D A;  2EXG A;  1T2M A;  4Z8J A;  2KYL A;  1VCW A;  5G1E A;  2PZD A;  1OBY A;  2EGK A;  5HEB A;  4JOK A;  2E7K A;  2H2B A;  2L97 A;  1UFX A;  1V62 A;  4AMH A;  2H3L A;  4K6Y A;  1IU2 A;  4NMQ A;  2P3W A;  3GDS A;  4HOP A;  2KAW A;  3RLE A;  2EDZ A;  2AWU A;  4JOH A;  2W4F A;  1QLC A;  4IC6 A;  2UZC A;  1I92 A;  4K76 A;  5HJ1 A;  1SOZ A;  2OGP A;  2MHO A;  2CSJ A;  5GLJ A;  4YYX A;  2AWX A;  2M0U A;  2M3M A;  3MH6 A;  1NTE A;  2IWN A;  4NMV A;  2KQF A;  2REY A;  2D90 A;  2LC7 A;  2O2T A;  4JOE A;  4Q3H A;  1FC6 A;  4JJ3 A;  5H3J A;  2VSV A;  2QT5 A;  1W9Q A;  2I1N A;  3R68 A;  1UJD A;  3QGL A;  3GCO A;  2YTW A;  2FCF A;  3ZRT A;  2LC6 A;  3QO6 A;  1OBX A;  4K75 A;  2KG2 A;  1N7F A;  3PDV A;  4P0C A;  3TSZ A;  5E22 A;  3ID2 A;  4JOR A;  3DJ3 A;  5E6P B;  2OS6 A;  5EYZ A;  2OZF A;  1UF1 A;  5F67 A;  3K82 A;  3HVQ C;  3DOR A;  2OQS A;  1G9O A;  3K1R A;  3FY5 A;  1YBO A;  1UEW A;  1ZOK A;  2PA1 A;  1MFL A;  5HEY A;  4N6X A;  2LUI A;  1VA8 A;  2H3M A;  1OBZ A;  4YDP A;  4GVC A;  2D92 A;  4E34 A;  4KFV A;  1RGW A;  4FLN A;  3CBX A;  3CC0 A;  3ID3 A;  1M5Z A;  2G2L A;  2KV8 A;  2JOA A;  1KEF A;  2EGN A;  2JIK A;  2EGO A;  2EHR A;  5A2P A;  2VZ5 A;  4NNL A;  2OSG A;  5DTH A;  1FC9 A;  4RI0 A;  5HDY A;  2M0T A;  1W9E A;  3TMH A;  1PDR A;  1UHP A;  3CBY A;  1U38 A;  3GDV A;  3NFK A;  4KFW A;  3HPK A;  3CYY A;  1W9O A;  5HET A;  2YUY A;  3SOE A;  3OU0 A;  5B42 A;  2I0L A;  2EEI A;  3STJ A;  1IU0 A;  2L4T A;  2EV8 A;  2PKU A;  3R0H A;  5HFB A;  1Y7N A;  3K50 A;  1KWA A;  2PNT A;  2FNE A;  2M0V A;  2DLU A;  1RZX A;  4NNM A;  4OEP A;  3RL7 A;  2VPH A;  3CS0 A;  4JOP A;  4Q2P A;  2LA8 A;  3BPU A;  3KZD A;  4Q6H A;  1Z86 A;  3MH7 A;  1MFG A;  2EDP A;  3PDZ A;  1WJL A;  3GSL A;  2DLS A;  1N6E A;  2D8I A;  2PDZ A;  2I0I A;  2LOB A;  3PS4 A;  5HED A;  2DAZ A;  4WYU A;  5HFE A;  2HE2 A;  2BYG A;  2JWE A;  1D5G A;  1FC7 A;  3PV4 A;  1V6B A;  4Z33 A;  3GCN A;  2G5M B;  4NXR A;  3SFJ A;  2QKV A;  1X5Q A;  2QKT A;  2RRM A;  3LNX A;  3CBZ A;  1UJU A;  5JXB A;  1QAV A;  1VAE A;  2KPK A;  2MX6 A;  5ILB A;  1L6O A;  1X5N A;  1WI2 A;  3NCV A;  1ZUB A;  3QIK A;  1V1T A;  5E1Y A;  4UU5 A;  3O46 A;  2DJT A;  2I4S A;  3GAB A;  2JSN A;  3JXT A;  3KDK A;  5FHT A;  4LMM A;  1N7E A;  1UJV A;  4NMT A;  1WFG A;  2FE5 A;  1VB7 A;  5F3X A;  2IWQ A;  2DC2 A;  2R4H A;  4G69 A;  3HPM A;  4K78 A;  3SHU A;  1KY9 A;  3WKL A;  4NXP A;  4FGM A;  2EEJ A;  2Z17 A;  4GHN A;  1X6D A;  5I7Z A;  1TQ3 A;  1U3B A;  1Q7X A;  1U37 A; 
#chains in the Genus database with same CATH homology
 2AIN A;  4NMO A;  2ZPL A;  1LCY A;  1VJ6 A;  2EEG A;  2JRE A;  2JIL A;  3B76 A;  1UM7 A;  4HOP B;  4UU6 A;  1TE0 A;  1MC7 A;  4PQW A;  3DJ1 A;  2VSP A;  2YUB A;  1N6D A;  3SUZ A;  5B6L A;  3ID4 A;  1WI4 A;  2CS5 A;  1V5L A;  3GGE A;  2KOJ A;  4K72 A;  1U39 A;  4REY A;  1XZ9 A;  2X7Z A;  1WF8 A;  4WYT A;  2EDV A;  4JOJ A;  1N99 A;  3PV2 A;  2F5Y A;  1OZI A;  2QKU A;  3I4W A;  2OPG A;  3ID1 A;  3QDO A;  2W7R A;  3KHF A;  2IWO A;  1X5R A;  2KOM A;  4O06 A;  4NXQ A;  1Q3O A;  1RGR A;  4OEO A;  3I1E A;  3LNY A;  2KJK A;  2OMJ A;  1NF3 C;  3CH8 A;  3VQG A;  1UEZ A;  2Q9V A;  4Q6S A;  1UM1 A;  2KJP A;  4H11 A;  3R69 A;  1Z87 A;  4Q2N A;  1N6F A;  4JOG A;  2R3Y A;  1BE9 A;  2JIN A;  1UIT A;  3QJM A;  3DIW A;  5HF4 A;  3DJA A;  3PV5 A;  1R6J A;  2KL1 A;  5E21 A;  5GND A;  2FN5 A;  1SOT A;  1I16 A;  3I18 A;  5D13 A;  4EDJ A;  4JJ0 A;  1WIF A;  2K20 A;  1Y8T A;  2PKT A;  1GM1 A;  2KJD A;  2V90 A;  1RY4 A;  1B8Q A;  2DKR A;  2AWW A;  1N7T A;  3EGG C;  3NGH A;  2DMZ A;  5E11 A;  1WF7 A;  2WL7 A;  2YT7 A;  2I6V A;  5EZ0 A;  2M10 A;  3QE1 A;  3TSW A;  2H2C A;  2GEF A;  1V5Q A;  2F0A A;  2L4S A;  2QG1 A;  4JOF A;  2K1Z A;  4L8N A;  2VWR A;  5HFF A;  4NMS A;  3WKM A;  2KOH A;  2Q3G A;  4F8K A;  3GJ9 A;  3RL8 A;  1X45 A;  4JL7 A;  2KBS A;  4GVD A;  2KRG A;  3NFL A;  2ENO A;  4P2A B;  5FB8 C;  4Q2O A;  1QAU A;  1TP3 A;  3E17 A;  4R2Z A;  2HE4 A;  1WG6 A;  2EEH A;  3KDG A;  3QJN A;  2CSS A;  1GQ5 A;  2OCS A;  1Q3P A;  5IL9 A;  1WHD A;  3GDU A;  4E35 A;  3EGH C;  3O5N A;  3MH4 A;  2HGA A;  4E3B A;  2DB5 A;  2RCZ A;  1K32 A;  2EJY A;  2QBW A;  3TSV A;  2KPL A;  3OTP A;  2DM8 A;  1TP5 A;  2YT8 A;  2I04 A;  2M0Z A;  1QAV B;  4MPA A;  3L4F D;  1X9Z A;  1BFE A;  4Q2Q A;  1WH1 A;  1WFV A;  2GZV A;  2V1W A;  2Z9I A;  1GQ4 A;  3SHW A;  1P1D A;  4OAJ A;  3KZE A;  4NMP A;  2ZPM A;  4XHV A;  2EAQ A;  2VRF A;  5HFC A;  2KA9 A;  1P1E A;  3VQF A;  2JXO A;  1IHJ A;  2IWP A;  1WHA A;  1UEP A;  5HFD A;  4NMR A;  1FCF A;  3AXA A;  5HF1 A;  1X8S A;  1UEQ A;  5G1D A;  2EXG A;  1T2M A;  4Z8J A;  2KYL A;  1VCW A;  5G1E A;  2PZD A;  1OBY A;  2EGK A;  5HEB A;  4JOK A;  2E7K A;  2H2B A;  2L97 A;  1UFX A;  1V62 A;  4AMH A;  2H3L A;  4K6Y A;  1IU2 A;  4NMQ A;  2P3W A;  3GDS A;  4HOP A;  2KAW A;  3RLE A;  2EDZ A;  2AWU A;  4JOH A;  2W4F A;  1QLC A;  4IC6 A;  2UZC A;  1I92 A;  4K76 A;  5HJ1 A;  1SOZ A;  2OGP A;  2MHO A;  2CSJ A;  5GLJ A;  4YYX A;  2AWX A;  2M0U A;  2M3M A;  3MH6 A;  1NTE A;  2IWN A;  4NMV A;  2KQF A;  2REY A;  2D90 A;  2LC7 A;  2O2T A;  4JOE A;  4Q3H A;  1FC6 A;  4JJ3 A;  5H3J A;  2VSV A;  2QT5 A;  1W9Q A;  2I1N A;  3R68 A;  1UJD A;  3QGL A;  3GCO A;  2YTW A;  2FCF A;  3ZRT A;  2LC6 A;  3QO6 A;  1OBX A;  4K75 A;  2KG2 A;  1N7F A;  3PDV A;  4P0C A;  3TSZ A;  5E22 A;  3ID2 A;  4JOR A;  3DJ3 A;  5E6P B;  2OS6 A;  5EYZ A;  2OZF A;  1UF1 A;  5F67 A;  3K82 A;  3HVQ C;  3DOR A;  2OQS A;  1G9O A;  3K1R A;  3FY5 A;  1YBO A;  1UEW A;  1ZOK A;  2PA1 A;  1MFL A;  5HEY A;  4N6X A;  2LUI A;  1VA8 A;  2H3M A;  1OBZ A;  4YDP A;  4GVC A;  2D92 A;  4E34 A;  4KFV A;  1RGW A;  4FLN A;  3CBX A;  3CC0 A;  3ID3 A;  1M5Z A;  2G2L A;  2KV8 A;  2JOA A;  1KEF A;  2EGN A;  2JIK A;  2EGO A;  2EHR A;  5A2P A;  2VZ5 A;  4NNL A;  2OSG A;  5DTH A;  1FC9 A;  4RI0 A;  5HDY A;  2M0T A;  1W9E A;  3TMH A;  1PDR A;  1UHP A;  3CBY A;  1U38 A;  3GDV A;  3NFK A;  4KFW A;  3HPK A;  3CYY A;  1W9O A;  5HET A;  2YUY A;  3SOE A;  3OU0 A;  5B42 A;  2I0L A;  2EEI A;  3STJ A;  1IU0 A;  2L4T A;  2EV8 A;  2PKU A;  3R0H A;  5HFB A;  1Y7N A;  3K50 A;  1KWA A;  2PNT A;  2FNE A;  2M0V A;  2DLU A;  1RZX A;  4NNM A;  4OEP A;  3RL7 A;  2VPH A;  3CS0 A;  4JOP A;  4Q2P A;  2LA8 A;  3BPU A;  3KZD A;  4Q6H A;  1Z86 A;  3MH7 A;  1MFG A;  2EDP A;  3PDZ A;  1WJL A;  3GSL A;  2DLS A;  1N6E A;  2D8I A;  2PDZ A;  2I0I A;  2LOB A;  3PS4 A;  5HED A;  2DAZ A;  4WYU A;  5HFE A;  2HE2 A;  2BYG A;  2JWE A;  1D5G A;  1FC7 A;  3PV4 A;  1V6B A;  4Z33 A;  3GCN A;  2G5M B;  4NXR A;  3SFJ A;  2QKV A;  1X5Q A;  2QKT A;  2RRM A;  3LNX A;  3CBZ A;  1UJU A;  5JXB A;  1QAV A;  1VAE A;  2KPK A;  2MX6 A;  5ILB A;  1L6O A;  1X5N A;  1WI2 A;  3NCV A;  1ZUB A;  3QIK A;  1V1T A;  5E1Y A;  4UU5 A;  3O46 A;  2DJT A;  2I4S A;  3GAB A;  2JSN A;  3JXT A;  3KDK A;  5FHT A;  4LMM A;  1N7E A;  1UJV A;  4NMT A;  1WFG A;  2FE5 A;  1VB7 A;  5F3X A;  2IWQ A;  2DC2 A;  2R4H A;  4G69 A;  3HPM A;  4K78 A;  3SHU A;  1KY9 A;  3WKL A;  4NXP A;  4FGM A;  2EEJ A;  2Z17 A;  4GHN A;  1X6D A;  5I7Z A;  1TQ3 A;  1U3B A;  1Q7X A;  1U37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...