4JOFA

Cftr associated ligand (cal) pdz domain bound to peptide l-ical36 (ansrlptsii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 22
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4jofA00
2ENOA 4RI0A 4Q2OA 2HE2A 3OTPA 1BE9A 5EYZA 2DAZA 1Q3PA 3SHWA 2EDPA 4G69A 5HEYA 3KHFA 4Q6HA 2LUIA 5E11A 3DORA 2PKTA 3CBYA 1Y8TA 2QKUA 2FCFA 3GSLA 2HGAA 5FB8C 3O46A 1WF7A 3QJNA 4H11A 4NXRA 4UU5A 1TP3A 5GNDA 4JOFA 2IWOA 1WJLA 4AMHA 3LNYA 2FNEA 1P1DA 1W9QA 2CS5A 2KPKA 5E1YA 4NXPA 1KWAA 4JOJA 5A2PA 3GDUA 1I92A 2L4SA 2REYA 2L97A 4NXQA 1RY4A 2DC2A 3GCOA 2CSSA 2I4SA 2M0VA 4KFWA 5D13A 3TMHA 2JWEA 2K1ZA 2KOJA 2KOMA 1QAVA 2I04A 3OU0A 1UEQA 4JOGA 2JXOA 5FHTA 3R69A 2AINA 3JXTA 1IHJA 2EEHA 5HETA 5EZ0A 2VSPA 1L6OA 2KOHA 3GCNA 4NNLA 3ID3A 2KBSA 2R3YA 4UU6A 1FCFA 2UZCA 1U37A 2OQSA 4K72A 2DB5A 2L4TA 3TSVA 3ZRTA 4GVCA 2K20A 2EV8A 4NNMA 4K76A 3CBZA 2EEIA 1OZIA 1GQ5A 4OAJA 4K6YA 1VA8A 2HE4A 4O06A 3SOEA 5HDYA 2QT5A 4Q2NA 3BPUA 1TQ3A 1U3BA 1R6JA 4P2AB 1UJDA 3FY5A 3GJ9A 1YBOA 1Y7NA 3STJA 3PV5A 3DJ3A 2DMZA 5G1DA 2BYGA 2D90A 1V5LA 1WHDA 1QLCA 3LNXA 1WHAA 1Z87A 2DJTA 4HOPB 3NFLA 2Z9IA 4N6XA 5I7ZA 1V1TA 3PDVA 1UFXA 1GM1A 1D5GA 4FGMA 1U39A 2QKTA 2DLSA 2KJPA 2VRFA 4JOHA 1B8QA 1UJUA 1UJVA 2OMJA 1PDRA 2KL1A 2KQFA 2VSVA 1WFVA 1WFGA 1FC6A 1UEWA 1MFGA 2AWWA 2Q3GA 2QKVA 1UM7A 2EHRA 2KG2A 5DTHA 4P0CA 2JIKA 3VQFA 1RGRA 2O2TA 2DKRA 3RL7A 2LC7A 1WI4A 2M0TA 2JINA 1RZXA 3ID2A 2Z17A 2H2CA 4R2ZA 3E17A 2Q9VA 4IC6A 4Q2QA 3MH4A 3KZEA 1M5ZA 2WL7A 3GDVA 2I1NA 3ID4A 2EGOA 3NGHA 1SOTA 4K78A 3I4WA 1ZOKA 2KV8A 3QE1A 4YDPA 3EGHC 3CS0A 2W7RA 1X5RA 2PKUA 3DJAA 2F5YA 5E22A 1UEZA 2QG1A 2MX6A 5F3XA 1WF8A 2OCSA 3R0HA 1N6DA 1X5QA 2CSJA 1MFLA 3GGEA 2EDZA 1I16A 1FC7A 2YUYA 2FN5A 2H2BA 3RLEA 2ZPLA 1N7FA 2FE5A 2OZFA 1XZ9A 2AWUA 2QBWA 1UEPA 3RL8A 2KPLA 3QJMA 2IWPA 1WI2A 2OSGA 3DIWA 1N7TA 3CBXA 5F67A 3PS4A 3HPKA 2EJYA 1W9OA 2IWQA 3WKMA 1Q7XA 5E21A 1IU2A 4XHVA 1W9EA 1VCWA 3KZDA 1WG6A 2X7ZA 2LC6A 4PQWA 1K32A 3PV2A 1GQ4A 5G1EA 3I18A 1NTEA 2OPGA 2JREA 3GDSA 2JOAA 3L4FD 1KEFA 4WYUA 4Q3HA 1U38A 5HFDA 1VAEA 4E34A 1SOZA 1OBXA 3SFJA 2M0ZA 5HF1A 2M0UA 2I0LA 2EXGA 3DJ1A 3NFKA 3TSWA 2D8IA 5B6LA 2RCZA 5E6PB 5HFCA 4NMSA 4JL7A 3SHUA 1UITA 2RRMA 4NMQA 5HEBA 1WIFA 4NMRA 2IWNA 2MHOA 2OGPA 2F0AA 1LCYA 4GHNA 5HFFA 2JILA 1G9OA 3HPMA 1UF1A 2YUBA 2EEGA 3VQGA 1P1EA 1BFEA 4GVDA 3AXAA 2LA8A 3WKLA 4Z33A 4NMTA 5H3JA 1OBYA 1N6FA 4HOPA 5GLJA 1OBZA 3K50A 1QAVB 3CH8A 3CYYA 2H3MA 1VB7A 1UHPA 1V6BA 2D92A 4WYTA 1N6EA 1X6DA 4Z8JA 2KA9A 3ID1A 3K1RA 1FC9A 4JORA 2V1WA 2PZDA 1N7EA 4REYA 2I6VA 2PA1A 1MC7A 3SUZA 2KJKA 5HF4A 1V5QA 2DM8A 1IU0A 2V90A 2H3LA 1VJ6A 3QIKA 5HFEA 3PV4A 3MH7A 2G2LA 2G5MB 2YTWA 2P3WA 2YT7A 2DLUA 1WH1A 3B76A 1KY9A 2PDZA 1T2MA 2EGNA 5HFBA 5JXBA 1RGWA 4NMPA 2EEJA 4Q6SA 1X45A 3R68A 4KFVA 1TE0A 3PDZA 2EDVA 1X5NA 2M3MA 3TSZA 3MH6A 1QAUA 3QDOA 4MPAA 3K82A 2ZPMA 5HEDA 3EGGC 2R4HA 2E7KA 2VZ5A 4JOKA 1N99A 1X8SA 2KYLA 3O5NA 4EDJA 2LOBA 1Z86A 1V62A 2M10A 4OEPA 4OEOA 3HVQC 4E35A 1TP5A 2KRGA 4Q2PA 2AWXA 1NF3C 4YYXA 2VWRA 4F8KA 4L8NA 2GZVA 3CC0A 4K75A 4JOEA 4LMMA 2KAWA 5HJ1A 1UM1A 4NMOA 1ZUBA 2OS6A 2I0IA 2KJDA 2VPHA 2YT8A 2EGKA 3QGLA 2PNTA 1Q3OA 2EAQA 3I1EA 4E3BA 2W4FA 4NMVA 3QO6A 4JOPA
chains in the Genus database with same CATH superfamily
2ENOA 4RI0A 4Q2OA 2HE2A 3OTPA 1BE9A 5EYZA 2DAZA 1Q3PA 3SHWA 2EDPA 4G69A 5HEYA 3KHFA 4Q6HA 2LUIA 5E11A 3DORA 2PKTA 3CBYA 1Y8TA 2QKUA 2FCFA 3GSLA 2HGAA 5FB8C 3O46A 1WF7A 3QJNA 4H11A 4NXRA 4UU5A 1TP3A 5GNDA 4JOFA 2IWOA 1WJLA 4AMHA 3LNYA 2FNEA 1P1DA 1W9QA 2CS5A 2KPKA 5E1YA 4NXPA 1KWAA 4JOJA 5A2PA 3GDUA 1I92A 2L4SA 2REYA 2L97A 4NXQA 1RY4A 2DC2A 3GABA 3GCOA 2CSSA 2I4SA 2M0VA 4KFWA 5D13A 3TMHA 2JWEA 2K1ZA 2KOJA 2KOMA 1QAVA 2I04A 3OU0A 1UEQA 4JOGA 2JXOA 5FHTA 3R69A 2AINA 3JXTA 1IHJA 2EEHA 5HETA 5EZ0A 2VSPA 1L6OA 2KOHA 3GCNA 4NNLA 3ID3A 2KBSA 2R3YA 4UU6A 1FCFA 2UZCA 1U37A 2OQSA 4K72A 2DB5A 2L4TA 3TSVA 3ZRTA 4GVCA 4JJ0A 2K20A 2EV8A 4NNMA 4K76A 3CBZA 2EEIA 1OZIA 1GQ5A 4OAJA 4K6YA 1VA8A 2HE4A 4FLNA 4O06A 3SOEA 5HDYA 2QT5A 4Q2NA 3BPUA 1TQ3A 1U3BA 1R6JA 4P2AB 5IL9A 1UJDA 3FY5A 3GJ9A 1YBOA 1Y7NA 3STJA 3PV5A 3DJ3A 2DMZA 3NCVA 5G1DA 2BYGA 2D90A 1V5LA 1WHDA 1QLCA 3LNXA 3KDKA 1WHAA 1Z87A 2DJTA 4HOPB 3NFLA 2Z9IA 4N6XA 5I7ZA 1V1TA 3PDVA 1UFXA 1GM1A 1D5GA 4FGMA 1U39A 2QKTA 2DLSA 2KJPA 2VRFA 4JOHA 1B8QA 1UJUA 1UJVA 2OMJA 1PDRA 2KL1A 2KQFA 2VSVA 1WFVA 1WFGA 1FC6A 1UEWA 1MFGA 2AWWA 2Q3GA 2QKVA 1UM7A 2EHRA 2KG2A 5DTHA 4P0CA 2JIKA 3VQFA 1RGRA 2O2TA 2DKRA 3RL7A 2LC7A 1WI4A 2M0TA 2JINA 1RZXA 3ID2A 2Z17A 2H2CA 4R2ZA 3E17A 2Q9VA 4IC6A 4Q2QA 3MH4A 3KZEA 1M5ZA 2WL7A 3GDVA 2I1NA 3ID4A 2EGOA 3NGHA 1SOTA 4K78A 3I4WA 1ZOKA 2KV8A 3QE1A 4YDPA 3EGHC 3CS0A 2W7RA 1X5RA 2PKUA 3DJAA 2F5YA 5E22A 1UEZA 2QG1A 2MX6A 5F3XA 1X9ZA 1WF8A 2OCSA 4JJ3A 3R0HA 1N6DA 1X5QA 2CSJA 1MFLA 3GGEA 2EDZA 1I16A 1FC7A 2YUYA 2FN5A 2H2BA 3RLEA 2ZPLA 1N7FA 2FE5A 2OZFA 1XZ9A 2AWUA 2QBWA 1UEPA 3RL8A 2KPLA 3QJMA 2IWPA 1WI2A 2OSGA 3DIWA 1N7TA 3CBXA 5F67A 3PS4A 3HPKA 2EJYA 1W9OA 2IWQA 3WKMA 1Q7XA 5E21A 1IU2A 4XHVA 1W9EA 1VCWA 3KZDA 1WG6A 2X7ZA 2LC6A 4PQWA 1K32A 3PV2A 1GQ4A 5G1EA 3I18A 1NTEA 2OPGA 2JREA 3GDSA 2JOAA 3L4FD 1KEFA 4WYUA 4Q3HA 1U38A 5HFDA 1VAEA 4E34A 1SOZA 1OBXA 3SFJA 2M0ZA 5HF1A 2M0UA 2I0LA 2EXGA 3DJ1A 3NFKA 3TSWA 2D8IA 5B6LA 2RCZA 5E6PB 5HFCA 4NMSA 4JL7A 3SHUA 1UITA 2RRMA 4NMQA 5HEBA 1WIFA 4NMRA 2IWNA 2MHOA 2OGPA 2F0AA 1LCYA 4GHNA 5HFFA 2JILA 1G9OA 3HPMA 1UF1A 2YUBA 2EEGA 3VQGA 1P1EA 1BFEA 4GVDA 3AXAA 2LA8A 3WKLA 4Z33A 4NMTA 5H3JA 1OBYA 1N6FA 4HOPA 5GLJA 1OBZA 3K50A 1QAVB 2JSNA 3CH8A 3CYYA 2H3MA 1VB7A 5B42A 1UHPA 1V6BA 2D92A 4WYTA 1N6EA 1X6DA 2GEFA 4Z8JA 2KA9A 3ID1A 3K1RA 1FC9A 4JORA 2V1WA 2PZDA 1N7EA 4REYA 2I6VA 2PA1A 1MC7A 3SUZA 2KJKA 5HF4A 1V5QA 2DM8A 1IU0A 2V90A 2H3LA 1VJ6A 3QIKA 5HFEA 3PV4A 3MH7A 2G2LA 2G5MB 2YTWA 2P3WA 2YT7A 2DLUA 1WH1A 3B76A 1KY9A 2PDZA 1T2MA 2EGNA 5HFBA 5JXBA 1RGWA 4NMPA 2EEJA 4Q6SA 1X45A 3R68A 4KFVA 1TE0A 3PDZA 2EDVA 1X5NA 2M3MA 3TSZA 3KDGA 3MH6A 1QAUA 3QDOA 4MPAA 5ILBA 3K82A 2ZPMA 5HEDA 3EGGC 2R4HA 2E7KA 2VZ5A 4JOKA 1N99A 1X8SA 2KYLA 3O5NA 4EDJA 2LOBA 1Z86A 1V62A 2M10A 4OEPA 4OEOA 3HVQC 4E35A 1TP5A 2KRGA 4Q2PA 2AWXA 1NF3C 4YYXA 2VWRA 4F8KA 4L8NA 2GZVA 3CC0A 4K75A 4JOEA 4LMMA 2KAWA 5HJ1A 1UM1A 4NMOA 1ZUBA 2OS6A 2I0IA 2KJDA 2VPHA 2YT8A 2EGKA 3QGLA 2PNTA 1Q3OA 2EAQA 3I1EA 4E3BA 2W4FA 4NMVA 3QO6A 4JOPA
chains in the Genus database with same CATH topology
2ENOA 4RI0A 4Q2OA 2HE2A 3OTPA 1BE9A 5EYZA 2DAZA 1Q3PA 3SHWA 2EDPA 4G69A 5HEYA 3KHFA 4Q6HA 2LUIA 5E11A 3DORA 2PKTA 3CBYA 1Y8TA 2QKUA 2FCFA 3GSLA 2HGAA 5FB8C 3O46A 1WF7A 3QJNA 4H11A 4NXRA 4UU5A 1TP3A 5GNDA 4JOFA 2IWOA 1WJLA 4AMHA 3LNYA 2FNEA 1P1DA 1W9QA 2CS5A 2KPKA 5E1YA 4NXPA 1KWAA 4JOJA 5A2PA 3GDUA 1I92A 2L4SA 2REYA 2L97A 4NXQA 1RY4A 2DC2A 3GABA 3GCOA 2CSSA 2I4SA 2M0VA 4KFWA 5D13A 3TMHA 2JWEA 2K1ZA 2KOJA 2KOMA 1QAVA 2I04A 3OU0A 1UEQA 4JOGA 2JXOA 5FHTA 3R69A 2AINA 3JXTA 1IHJA 2EEHA 5HETA 5EZ0A 2VSPA 1L6OA 2KOHA 3GCNA 4NNLA 3ID3A 2KBSA 2R3YA 4UU6A 1FCFA 2UZCA 1U37A 2OQSA 4K72A 2DB5A 2L4TA 3TSVA 3ZRTA 4GVCA 4JJ0A 2K20A 2EV8A 4NNMA 4K76A 3CBZA 2EEIA 1OZIA 1GQ5A 4OAJA 4K6YA 1VA8A 2HE4A 4FLNA 4O06A 3SOEA 5HDYA 2QT5A 4Q2NA 3BPUA 1TQ3A 1U3BA 1R6JA 4P2AB 5IL9A 1UJDA 3FY5A 3GJ9A 1YBOA 1Y7NA 3STJA 3PV5A 3DJ3A 2DMZA 3NCVA 5G1DA 2BYGA 2D90A 1V5LA 1WHDA 1QLCA 3LNXA 3KDKA 1WHAA 1Z87A 2DJTA 4HOPB 3NFLA 2Z9IA 4N6XA 5I7ZA 1V1TA 3PDVA 1UFXA 1GM1A 1D5GA 4FGMA 1U39A 2QKTA 2DLSA 2KJPA 2VRFA 4JOHA 1B8QA 1UJUA 1UJVA 2OMJA 1PDRA 2KL1A 2KQFA 2VSVA 1WFVA 1WFGA 1FC6A 1UEWA 1MFGA 2AWWA 2Q3GA 2QKVA 1UM7A 2EHRA 2KG2A 5DTHA 4P0CA 2JIKA 3VQFA 1RGRA 2O2TA 2DKRA 3RL7A 2LC7A 1WI4A 2M0TA 2JINA 1RZXA 3ID2A 2Z17A 2H2CA 4R2ZA 3E17A 2Q9VA 4IC6A 4Q2QA 3MH4A 3KZEA 1M5ZA 2WL7A 3GDVA 2I1NA 3ID4A 2EGOA 3NGHA 1SOTA 4K78A 3I4WA 1ZOKA 2KV8A 3QE1A 4YDPA 3EGHC 3CS0A 2W7RA 1X5RA 2PKUA 3DJAA 2F5YA 5E22A 1UEZA 2QG1A 2MX6A 5F3XA 1X9ZA 1WF8A 2OCSA 4JJ3A 3R0HA 1N6DA 1X5QA 2CSJA 1MFLA 3GGEA 2EDZA 1I16A 1FC7A 2YUYA 2FN5A 2H2BA 3RLEA 2ZPLA 1N7FA 2FE5A 2OZFA 1XZ9A 2AWUA 2QBWA 1UEPA 3RL8A 2KPLA 3QJMA 2IWPA 1WI2A 2OSGA 3DIWA 1N7TA 3CBXA 5F67A 3PS4A 3HPKA 2EJYA 1W9OA 2IWQA 3WKMA 1Q7XA 5E21A 1IU2A 4XHVA 1W9EA 1VCWA 3KZDA 1WG6A 2X7ZA 2LC6A 4PQWA 1K32A 3PV2A 1GQ4A 5G1EA 3I18A 1NTEA 2OPGA 2JREA 3GDSA 2JOAA 3L4FD 1KEFA 4WYUA 4Q3HA 1U38A 5HFDA 1VAEA 4E34A 1SOZA 1OBXA 3SFJA 2M0ZA 5HF1A 2M0UA 2I0LA 2EXGA 3DJ1A 3NFKA 3TSWA 2D8IA 5B6LA 2RCZA 5E6PB 5HFCA 4NMSA 4JL7A 3SHUA 1UITA 2RRMA 4NMQA 5HEBA 1WIFA 4NMRA 2IWNA 2MHOA 2OGPA 2F0AA 1LCYA 4GHNA 5HFFA 2JILA 1G9OA 3HPMA 1UF1A 2YUBA 2EEGA 3VQGA 1P1EA 1BFEA 4GVDA 3AXAA 2LA8A 3WKLA 4Z33A 4NMTA 5H3JA 1OBYA 1N6FA 4HOPA 5GLJA 1OBZA 3K50A 1QAVB 2JSNA 3CH8A 3CYYA 2H3MA 1VB7A 5B42A 1UHPA 1V6BA 2D92A 4WYTA 1N6EA 1X6DA 2GEFA 4Z8JA 2KA9A 3ID1A 3K1RA 1FC9A 4JORA 2V1WA 2PZDA 1N7EA 4REYA 2I6VA 2PA1A 1MC7A 3SUZA 2KJKA 5HF4A 1V5QA 2DM8A 1IU0A 2V90A 2H3LA 1VJ6A 3QIKA 5HFEA 3PV4A 3MH7A 2G2LA 2G5MB 2YTWA 2P3WA 2YT7A 2DLUA 1WH1A 3B76A 1KY9A 2PDZA 1T2MA 2EGNA 5HFBA 5JXBA 1RGWA 4NMPA 2EEJA 4Q6SA 1X45A 3R68A 4KFVA 1TE0A 3PDZA 2EDVA 1X5NA 2M3MA 3TSZA 3KDGA 3MH6A 1QAUA 3QDOA 4MPAA 5ILBA 3K82A 2ZPMA 5HEDA 3EGGC 2R4HA 2E7KA 2VZ5A 4JOKA 1N99A 1X8SA 2KYLA 3O5NA 4EDJA 2LOBA 1Z86A 1V62A 2M10A 4OEPA 4OEOA 3HVQC 4E35A 1TP5A 2KRGA 4Q2PA 2AWXA 1NF3C 4YYXA 2VWRA 4F8KA 4L8NA 2GZVA 3CC0A 4K75A 4JOEA 4LMMA 2KAWA 5HJ1A 1UM1A 4NMOA 1ZUBA 2OS6A 2I0IA 2KJDA 2VPHA 2YT8A 2EGKA 3QGLA 2PNTA 1Q3OA 2EAQA 3I1EA 4E3BA 2W4FA 4NMVA 3QO6A 4JOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENO A;  4RI0 A;  4Q2O A;  2HE2 A;  3OTP A;  1BE9 A;  5EYZ A;  2DAZ A;  1Q3P A;  3SHW A;  2EDP A;  4G69 A;  5HEY A;  3KHF A;  4Q6H A;  2LUI A;  5E11 A;  3DOR A;  2PKT A;  3CBY A;  1Y8T A;  2QKU A;  2FCF A;  3GSL A;  2HGA A;  5FB8 C;  3O46 A;  1WF7 A;  3QJN A;  4H11 A;  4NXR A;  4UU5 A;  1TP3 A;  5GND A;  4JOF A;  2IWO A;  1WJL A;  4AMH A;  3LNY A;  2FNE A;  1P1D A;  1W9Q A;  2CS5 A;  2KPK A;  5E1Y A;  4NXP A;  1KWA A;  4JOJ A;  5A2P A;  3GDU A;  1I92 A;  2L4S A;  2REY A;  2L97 A;  4NXQ A;  1RY4 A;  2DC2 A;  3GCO A;  2CSS A;  2I4S A;  2M0V A;  4KFW A;  5D13 A;  3TMH A;  2JWE A;  2K1Z A;  2KOJ A;  2KOM A;  1QAV A;  2I04 A;  3OU0 A;  1UEQ A;  4JOG A;  2JXO A;  5FHT A;  3R69 A;  2AIN A;  3JXT A;  1IHJ A;  2EEH A;  5HET A;  5EZ0 A;  2VSP A;  1L6O A;  2KOH A;  3GCN A;  4NNL A;  3ID3 A;  2KBS A;  2R3Y A;  4UU6 A;  1FCF A;  2UZC A;  1U37 A;  2OQS A;  4K72 A;  2DB5 A;  2L4T A;  3TSV A;  3ZRT A;  4GVC A;  2K20 A;  2EV8 A;  4NNM A;  4K76 A;  3CBZ A;  2EEI A;  1OZI A;  1GQ5 A;  4OAJ A;  4K6Y A;  1VA8 A;  2HE4 A;  4O06 A;  3SOE A;  5HDY A;  2QT5 A;  4Q2N A;  3BPU A;  1TQ3 A;  1U3B A;  1R6J A;  4P2A B;  1UJD A;  3FY5 A;  3GJ9 A;  1YBO A;  1Y7N A;  3STJ A;  3PV5 A;  3DJ3 A;  2DMZ A;  5G1D A;  2BYG A;  2D90 A;  1V5L A;  1WHD A;  1QLC A;  3LNX A;  1WHA A;  1Z87 A;  2DJT A;  4HOP B;  3NFL A;  2Z9I A;  4N6X A;  5I7Z A;  1V1T A;  3PDV A;  1UFX A;  1GM1 A;  1D5G A;  4FGM A;  1U39 A;  2QKT A;  2DLS A;  2KJP A;  2VRF A;  4JOH A;  1B8Q A;  1UJU A;  1UJV A;  2OMJ A;  1PDR A;  2KL1 A;  2KQF A;  2VSV A;  1WFV A;  1WFG A;  1FC6 A;  1UEW A;  1MFG A;  2AWW A;  2Q3G A;  2QKV A;  1UM7 A;  2EHR A;  2KG2 A;  5DTH A;  4P0C A;  2JIK A;  3VQF A;  1RGR A;  2O2T A;  2DKR A;  3RL7 A;  2LC7 A;  1WI4 A;  2M0T A;  2JIN A;  1RZX A;  3ID2 A;  2Z17 A;  2H2C A;  4R2Z A;  3E17 A;  2Q9V A;  4IC6 A;  4Q2Q A;  3MH4 A;  3KZE A;  1M5Z A;  2WL7 A;  3GDV A;  2I1N A;  3ID4 A;  2EGO A;  3NGH A;  1SOT A;  4K78 A;  3I4W A;  1ZOK A;  2KV8 A;  3QE1 A;  4YDP A;  3EGH C;  3CS0 A;  2W7R A;  1X5R A;  2PKU A;  3DJA A;  2F5Y A;  5E22 A;  1UEZ A;  2QG1 A;  2MX6 A;  5F3X A;  1WF8 A;  2OCS A;  3R0H A;  1N6D A;  1X5Q A;  2CSJ A;  1MFL A;  3GGE A;  2EDZ A;  1I16 A;  1FC7 A;  2YUY A;  2FN5 A;  2H2B A;  3RLE A;  2ZPL A;  1N7F A;  2FE5 A;  2OZF A;  1XZ9 A;  2AWU A;  2QBW A;  1UEP A;  3RL8 A;  2KPL A;  3QJM A;  2IWP A;  1WI2 A;  2OSG A;  3DIW A;  1N7T A;  3CBX A;  5F67 A;  3PS4 A;  3HPK A;  2EJY A;  1W9O A;  2IWQ A;  3WKM A;  1Q7X A;  5E21 A;  1IU2 A;  4XHV A;  1W9E A;  1VCW A;  3KZD A;  1WG6 A;  2X7Z A;  2LC6 A;  4PQW A;  1K32 A;  3PV2 A;  1GQ4 A;  5G1E A;  3I18 A;  1NTE A;  2OPG A;  2JRE A;  3GDS A;  2JOA A;  3L4F D;  1KEF A;  4WYU A;  4Q3H A;  1U38 A;  5HFD A;  1VAE A;  4E34 A;  1SOZ A;  1OBX A;  3SFJ A;  2M0Z A;  5HF1 A;  2M0U A;  2I0L A;  2EXG A;  3DJ1 A;  3NFK A;  3TSW A;  2D8I A;  5B6L A;  2RCZ A;  5E6P B;  5HFC A;  4NMS A;  4JL7 A;  3SHU A;  1UIT A;  2RRM A;  4NMQ A;  5HEB A;  1WIF A;  4NMR A;  2IWN A;  2MHO A;  2OGP A;  2F0A A;  1LCY A;  4GHN A;  5HFF A;  2JIL A;  1G9O A;  3HPM A;  1UF1 A;  2YUB A;  2EEG A;  3VQG A;  1P1E A;  1BFE A;  4GVD A;  3AXA A;  2LA8 A;  3WKL A;  4Z33 A;  4NMT A;  5H3J A;  1OBY A;  1N6F A;  4HOP A;  5GLJ A;  1OBZ A;  3K50 A;  1QAV B;  3CH8 A;  3CYY A;  2H3M A;  1VB7 A;  1UHP A;  1V6B A;  2D92 A;  4WYT A;  1N6E A;  1X6D A;  4Z8J A;  2KA9 A;  3ID1 A;  3K1R A;  1FC9 A;  4JOR A;  2V1W A;  2PZD A;  1N7E A;  4REY A;  2I6V A;  2PA1 A;  1MC7 A;  3SUZ A;  2KJK A;  5HF4 A;  1V5Q A;  2DM8 A;  1IU0 A;  2V90 A;  2H3L A;  1VJ6 A;  3QIK A;  5HFE A;  3PV4 A;  3MH7 A;  2G2L A;  2G5M B;  2YTW A;  2P3W A;  2YT7 A;  2DLU A;  1WH1 A;  3B76 A;  1KY9 A;  2PDZ A;  1T2M A;  2EGN A;  5HFB A;  5JXB A;  1RGW A;  4NMP A;  2EEJ A;  4Q6S A;  1X45 A;  3R68 A;  4KFV A;  1TE0 A;  3PDZ A;  2EDV A;  1X5N A;  2M3M A;  3TSZ A;  3MH6 A;  1QAU A;  3QDO A;  4MPA A;  3K82 A;  2ZPM A;  5HED A;  3EGG C;  2R4H A;  2E7K A;  2VZ5 A;  4JOK A;  1N99 A;  1X8S A;  2KYL A;  3O5N A;  4EDJ A;  2LOB A;  1Z86 A;  1V62 A;  2M10 A;  4OEP A;  4OEO A;  3HVQ C;  4E35 A;  1TP5 A;  2KRG A;  4Q2P A;  2AWX A;  1NF3 C;  4YYX A;  2VWR A;  4F8K A;  4L8N A;  2GZV A;  3CC0 A;  4K75 A;  4JOE A;  4LMM A;  2KAW A;  5HJ1 A;  1UM1 A;  4NMO A;  1ZUB A;  2OS6 A;  2I0I A;  2KJD A;  2VPH A;  2YT8 A;  2EGK A;  3QGL A;  2PNT A;  1Q3O A;  2EAQ A;  3I1E A;  4E3B A;  2W4F A;  4NMV A;  3QO6 A;  4JOP A; 
#chains in the Genus database with same CATH topology
 2ENO A;  4RI0 A;  4Q2O A;  2HE2 A;  3OTP A;  1BE9 A;  5EYZ A;  2DAZ A;  1Q3P A;  3SHW A;  2EDP A;  4G69 A;  5HEY A;  3KHF A;  4Q6H A;  2LUI A;  5E11 A;  3DOR A;  2PKT A;  3CBY A;  1Y8T A;  2QKU A;  2FCF A;  3GSL A;  2HGA A;  5FB8 C;  3O46 A;  1WF7 A;  3QJN A;  4H11 A;  4NXR A;  4UU5 A;  1TP3 A;  5GND A;  4JOF A;  2IWO A;  1WJL A;  4AMH A;  3LNY A;  2FNE A;  1P1D A;  1W9Q A;  2CS5 A;  2KPK A;  5E1Y A;  4NXP A;  1KWA A;  4JOJ A;  5A2P A;  3GDU A;  1I92 A;  2L4S A;  2REY A;  2L97 A;  4NXQ A;  1RY4 A;  2DC2 A;  3GAB A;  3GCO A;  2CSS A;  2I4S A;  2M0V A;  4KFW A;  5D13 A;  3TMH A;  2JWE A;  2K1Z A;  2KOJ A;  2KOM A;  1QAV A;  2I04 A;  3OU0 A;  1UEQ A;  4JOG A;  2JXO A;  5FHT A;  3R69 A;  2AIN A;  3JXT A;  1IHJ A;  2EEH A;  5HET A;  5EZ0 A;  2VSP A;  1L6O A;  2KOH A;  3GCN A;  4NNL A;  3ID3 A;  2KBS A;  2R3Y A;  4UU6 A;  1FCF A;  2UZC A;  1U37 A;  2OQS A;  4K72 A;  2DB5 A;  2L4T A;  3TSV A;  3ZRT A;  4GVC A;  4JJ0 A;  2K20 A;  2EV8 A;  4NNM A;  4K76 A;  3CBZ A;  2EEI A;  1OZI A;  1GQ5 A;  4OAJ A;  4K6Y A;  1VA8 A;  2HE4 A;  4FLN A;  4O06 A;  3SOE A;  5HDY A;  2QT5 A;  4Q2N A;  3BPU A;  1TQ3 A;  1U3B A;  1R6J A;  4P2A B;  5IL9 A;  1UJD A;  3FY5 A;  3GJ9 A;  1YBO A;  1Y7N A;  3STJ A;  3PV5 A;  3DJ3 A;  2DMZ A;  3NCV A;  5G1D A;  2BYG A;  2D90 A;  1V5L A;  1WHD A;  1QLC A;  3LNX A;  3KDK A;  1WHA A;  1Z87 A;  2DJT A;  4HOP B;  3NFL A;  2Z9I A;  4N6X A;  5I7Z A;  1V1T A;  3PDV A;  1UFX A;  1GM1 A;  1D5G A;  4FGM A;  1U39 A;  2QKT A;  2DLS A;  2KJP A;  2VRF A;  4JOH A;  1B8Q A;  1UJU A;  1UJV A;  2OMJ A;  1PDR A;  2KL1 A;  2KQF A;  2VSV A;  1WFV A;  1WFG A;  1FC6 A;  1UEW A;  1MFG A;  2AWW A;  2Q3G A;  2QKV A;  1UM7 A;  2EHR A;  2KG2 A;  5DTH A;  4P0C A;  2JIK A;  3VQF A;  1RGR A;  2O2T A;  2DKR A;  3RL7 A;  2LC7 A;  1WI4 A;  2M0T A;  2JIN A;  1RZX A;  3ID2 A;  2Z17 A;  2H2C A;  4R2Z A;  3E17 A;  2Q9V A;  4IC6 A;  4Q2Q A;  3MH4 A;  3KZE A;  1M5Z A;  2WL7 A;  3GDV A;  2I1N A;  3ID4 A;  2EGO A;  3NGH A;  1SOT A;  4K78 A;  3I4W A;  1ZOK A;  2KV8 A;  3QE1 A;  4YDP A;  3EGH C;  3CS0 A;  2W7R A;  1X5R A;  2PKU A;  3DJA A;  2F5Y A;  5E22 A;  1UEZ A;  2QG1 A;  2MX6 A;  5F3X A;  1X9Z A;  1WF8 A;  2OCS A;  4JJ3 A;  3R0H A;  1N6D A;  1X5Q A;  2CSJ A;  1MFL A;  3GGE A;  2EDZ A;  1I16 A;  1FC7 A;  2YUY A;  2FN5 A;  2H2B A;  3RLE A;  2ZPL A;  1N7F A;  2FE5 A;  2OZF A;  1XZ9 A;  2AWU A;  2QBW A;  1UEP A;  3RL8 A;  2KPL A;  3QJM A;  2IWP A;  1WI2 A;  2OSG A;  3DIW A;  1N7T A;  3CBX A;  5F67 A;  3PS4 A;  3HPK A;  2EJY A;  1W9O A;  2IWQ A;  3WKM A;  1Q7X A;  5E21 A;  1IU2 A;  4XHV A;  1W9E A;  1VCW A;  3KZD A;  1WG6 A;  2X7Z A;  2LC6 A;  4PQW A;  1K32 A;  3PV2 A;  1GQ4 A;  5G1E A;  3I18 A;  1NTE A;  2OPG A;  2JRE A;  3GDS A;  2JOA A;  3L4F D;  1KEF A;  4WYU A;  4Q3H A;  1U38 A;  5HFD A;  1VAE A;  4E34 A;  1SOZ A;  1OBX A;  3SFJ A;  2M0Z A;  5HF1 A;  2M0U A;  2I0L A;  2EXG A;  3DJ1 A;  3NFK A;  3TSW A;  2D8I A;  5B6L A;  2RCZ A;  5E6P B;  5HFC A;  4NMS A;  4JL7 A;  3SHU A;  1UIT A;  2RRM A;  4NMQ A;  5HEB A;  1WIF A;  4NMR A;  2IWN A;  2MHO A;  2OGP A;  2F0A A;  1LCY A;  4GHN A;  5HFF A;  2JIL A;  1G9O A;  3HPM A;  1UF1 A;  2YUB A;  2EEG A;  3VQG A;  1P1E A;  1BFE A;  4GVD A;  3AXA A;  2LA8 A;  3WKL A;  4Z33 A;  4NMT A;  5H3J A;  1OBY A;  1N6F A;  4HOP A;  5GLJ A;  1OBZ A;  3K50 A;  1QAV B;  2JSN A;  3CH8 A;  3CYY A;  2H3M A;  1VB7 A;  5B42 A;  1UHP A;  1V6B A;  2D92 A;  4WYT A;  1N6E A;  1X6D A;  2GEF A;  4Z8J A;  2KA9 A;  3ID1 A;  3K1R A;  1FC9 A;  4JOR A;  2V1W A;  2PZD A;  1N7E A;  4REY A;  2I6V A;  2PA1 A;  1MC7 A;  3SUZ A;  2KJK A;  5HF4 A;  1V5Q A;  2DM8 A;  1IU0 A;  2V90 A;  2H3L A;  1VJ6 A;  3QIK A;  5HFE A;  3PV4 A;  3MH7 A;  2G2L A;  2G5M B;  2YTW A;  2P3W A;  2YT7 A;  2DLU A;  1WH1 A;  3B76 A;  1KY9 A;  2PDZ A;  1T2M A;  2EGN A;  5HFB A;  5JXB A;  1RGW A;  4NMP A;  2EEJ A;  4Q6S A;  1X45 A;  3R68 A;  4KFV A;  1TE0 A;  3PDZ A;  2EDV A;  1X5N A;  2M3M A;  3TSZ A;  3KDG A;  3MH6 A;  1QAU A;  3QDO A;  4MPA A;  5ILB A;  3K82 A;  2ZPM A;  5HED A;  3EGG C;  2R4H A;  2E7K A;  2VZ5 A;  4JOK A;  1N99 A;  1X8S A;  2KYL A;  3O5N A;  4EDJ A;  2LOB A;  1Z86 A;  1V62 A;  2M10 A;  4OEP A;  4OEO A;  3HVQ C;  4E35 A;  1TP5 A;  2KRG A;  4Q2P A;  2AWX A;  1NF3 C;  4YYX A;  2VWR A;  4F8K A;  4L8N A;  2GZV A;  3CC0 A;  4K75 A;  4JOE A;  4LMM A;  2KAW A;  5HJ1 A;  1UM1 A;  4NMO A;  1ZUB A;  2OS6 A;  2I0I A;  2KJD A;  2VPH A;  2YT8 A;  2EGK A;  3QGL A;  2PNT A;  1Q3O A;  2EAQ A;  3I1E A;  4E3B A;  2W4F A;  4NMV A;  3QO6 A;  4JOP A; 
#chains in the Genus database with same CATH homology
 2ENO A;  4RI0 A;  4Q2O A;  2HE2 A;  3OTP A;  1BE9 A;  5EYZ A;  2DAZ A;  1Q3P A;  3SHW A;  2EDP A;  4G69 A;  5HEY A;  3KHF A;  4Q6H A;  2LUI A;  5E11 A;  3DOR A;  2PKT A;  3CBY A;  1Y8T A;  2QKU A;  2FCF A;  3GSL A;  2HGA A;  5FB8 C;  3O46 A;  1WF7 A;  3QJN A;  4H11 A;  4NXR A;  4UU5 A;  1TP3 A;  5GND A;  4JOF A;  2IWO A;  1WJL A;  4AMH A;  3LNY A;  2FNE A;  1P1D A;  1W9Q A;  2CS5 A;  2KPK A;  5E1Y A;  4NXP A;  1KWA A;  4JOJ A;  5A2P A;  3GDU A;  1I92 A;  2L4S A;  2REY A;  2L97 A;  4NXQ A;  1RY4 A;  2DC2 A;  3GAB A;  3GCO A;  2CSS A;  2I4S A;  2M0V A;  4KFW A;  5D13 A;  3TMH A;  2JWE A;  2K1Z A;  2KOJ A;  2KOM A;  1QAV A;  2I04 A;  3OU0 A;  1UEQ A;  4JOG A;  2JXO A;  5FHT A;  3R69 A;  2AIN A;  3JXT A;  1IHJ A;  2EEH A;  5HET A;  5EZ0 A;  2VSP A;  1L6O A;  2KOH A;  3GCN A;  4NNL A;  3ID3 A;  2KBS A;  2R3Y A;  4UU6 A;  1FCF A;  2UZC A;  1U37 A;  2OQS A;  4K72 A;  2DB5 A;  2L4T A;  3TSV A;  3ZRT A;  4GVC A;  4JJ0 A;  2K20 A;  2EV8 A;  4NNM A;  4K76 A;  3CBZ A;  2EEI A;  1OZI A;  1GQ5 A;  4OAJ A;  4K6Y A;  1VA8 A;  2HE4 A;  4FLN A;  4O06 A;  3SOE A;  5HDY A;  2QT5 A;  4Q2N A;  3BPU A;  1TQ3 A;  1U3B A;  1R6J A;  4P2A B;  5IL9 A;  1UJD A;  3FY5 A;  3GJ9 A;  1YBO A;  1Y7N A;  3STJ A;  3PV5 A;  3DJ3 A;  2DMZ A;  3NCV A;  5G1D A;  2BYG A;  2D90 A;  1V5L A;  1WHD A;  1QLC A;  3LNX A;  3KDK A;  1WHA A;  1Z87 A;  2DJT A;  4HOP B;  3NFL A;  2Z9I A;  4N6X A;  5I7Z A;  1V1T A;  3PDV A;  1UFX A;  1GM1 A;  1D5G A;  4FGM A;  1U39 A;  2QKT A;  2DLS A;  2KJP A;  2VRF A;  4JOH A;  1B8Q A;  1UJU A;  1UJV A;  2OMJ A;  1PDR A;  2KL1 A;  2KQF A;  2VSV A;  1WFV A;  1WFG A;  1FC6 A;  1UEW A;  1MFG A;  2AWW A;  2Q3G A;  2QKV A;  1UM7 A;  2EHR A;  2KG2 A;  5DTH A;  4P0C A;  2JIK A;  3VQF A;  1RGR A;  2O2T A;  2DKR A;  3RL7 A;  2LC7 A;  1WI4 A;  2M0T A;  2JIN A;  1RZX A;  3ID2 A;  2Z17 A;  2H2C A;  4R2Z A;  3E17 A;  2Q9V A;  4IC6 A;  4Q2Q A;  3MH4 A;  3KZE A;  1M5Z A;  2WL7 A;  3GDV A;  2I1N A;  3ID4 A;  2EGO A;  3NGH A;  1SOT A;  4K78 A;  3I4W A;  1ZOK A;  2KV8 A;  3QE1 A;  4YDP A;  3EGH C;  3CS0 A;  2W7R A;  1X5R A;  2PKU A;  3DJA A;  2F5Y A;  5E22 A;  1UEZ A;  2QG1 A;  2MX6 A;  5F3X A;  1X9Z A;  1WF8 A;  2OCS A;  4JJ3 A;  3R0H A;  1N6D A;  1X5Q A;  2CSJ A;  1MFL A;  3GGE A;  2EDZ A;  1I16 A;  1FC7 A;  2YUY A;  2FN5 A;  2H2B A;  3RLE A;  2ZPL A;  1N7F A;  2FE5 A;  2OZF A;  1XZ9 A;  2AWU A;  2QBW A;  1UEP A;  3RL8 A;  2KPL A;  3QJM A;  2IWP A;  1WI2 A;  2OSG A;  3DIW A;  1N7T A;  3CBX A;  5F67 A;  3PS4 A;  3HPK A;  2EJY A;  1W9O A;  2IWQ A;  3WKM A;  1Q7X A;  5E21 A;  1IU2 A;  4XHV A;  1W9E A;  1VCW A;  3KZD A;  1WG6 A;  2X7Z A;  2LC6 A;  4PQW A;  1K32 A;  3PV2 A;  1GQ4 A;  5G1E A;  3I18 A;  1NTE A;  2OPG A;  2JRE A;  3GDS A;  2JOA A;  3L4F D;  1KEF A;  4WYU A;  4Q3H A;  1U38 A;  5HFD A;  1VAE A;  4E34 A;  1SOZ A;  1OBX A;  3SFJ A;  2M0Z A;  5HF1 A;  2M0U A;  2I0L A;  2EXG A;  3DJ1 A;  3NFK A;  3TSW A;  2D8I A;  5B6L A;  2RCZ A;  5E6P B;  5HFC A;  4NMS A;  4JL7 A;  3SHU A;  1UIT A;  2RRM A;  4NMQ A;  5HEB A;  1WIF A;  4NMR A;  2IWN A;  2MHO A;  2OGP A;  2F0A A;  1LCY A;  4GHN A;  5HFF A;  2JIL A;  1G9O A;  3HPM A;  1UF1 A;  2YUB A;  2EEG A;  3VQG A;  1P1E A;  1BFE A;  4GVD A;  3AXA A;  2LA8 A;  3WKL A;  4Z33 A;  4NMT A;  5H3J A;  1OBY A;  1N6F A;  4HOP A;  5GLJ A;  1OBZ A;  3K50 A;  1QAV B;  2JSN A;  3CH8 A;  3CYY A;  2H3M A;  1VB7 A;  5B42 A;  1UHP A;  1V6B A;  2D92 A;  4WYT A;  1N6E A;  1X6D A;  2GEF A;  4Z8J A;  2KA9 A;  3ID1 A;  3K1R A;  1FC9 A;  4JOR A;  2V1W A;  2PZD A;  1N7E A;  4REY A;  2I6V A;  2PA1 A;  1MC7 A;  3SUZ A;  2KJK A;  5HF4 A;  1V5Q A;  2DM8 A;  1IU0 A;  2V90 A;  2H3L A;  1VJ6 A;  3QIK A;  5HFE A;  3PV4 A;  3MH7 A;  2G2L A;  2G5M B;  2YTW A;  2P3W A;  2YT7 A;  2DLU A;  1WH1 A;  3B76 A;  1KY9 A;  2PDZ A;  1T2M A;  2EGN A;  5HFB A;  5JXB A;  1RGW A;  4NMP A;  2EEJ A;  4Q6S A;  1X45 A;  3R68 A;  4KFV A;  1TE0 A;  3PDZ A;  2EDV A;  1X5N A;  2M3M A;  3TSZ A;  3KDG A;  3MH6 A;  1QAU A;  3QDO A;  4MPA A;  5ILB A;  3K82 A;  2ZPM A;  5HED A;  3EGG C;  2R4H A;  2E7K A;  2VZ5 A;  4JOK A;  1N99 A;  1X8S A;  2KYL A;  3O5N A;  4EDJ A;  2LOB A;  1Z86 A;  1V62 A;  2M10 A;  4OEP A;  4OEO A;  3HVQ C;  4E35 A;  1TP5 A;  2KRG A;  4Q2P A;  2AWX A;  1NF3 C;  4YYX A;  2VWR A;  4F8K A;  4L8N A;  2GZV A;  3CC0 A;  4K75 A;  4JOE A;  4LMM A;  2KAW A;  5HJ1 A;  1UM1 A;  4NMO A;  1ZUB A;  2OS6 A;  2I0I A;  2KJD A;  2VPH A;  2YT8 A;  2EGK A;  3QGL A;  2PNT A;  1Q3O A;  2EAQ A;  3I1E A;  4E3B A;  2W4F A;  4NMV A;  3QO6 A;  4JOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...