3MH7A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease do
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
total genus 86
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh7A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh7A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh7A01
3SU0A 1ZUBA 1KXDA 1UCYH 3VB7A 2OSGA 1HCGA 1ZTKA 1WOFA 1YPHE 1X45A 1J17T 3E1XB 1TNIA 1AIXH 3LH1A 1GDQA 3HGPA 1ZMJA 3BV9B 3ODFA 3W94A 1SFIA 4X1QU 1EZUC 1ELFA 2M0ZA 1BCUH 2AWUA 1GGDB 2EC9H 1UFXA 2G00A 3M5MA 4ZXYH 3PLKA 2H2BA 1TP5A 2YUYA 1G36A 4Y10E 1KEFA 3GJ9A 2V35A 1C2GA 2PDZA 1ESBA 1K1LA 3SU1A 2VIDA 1A0JA 3ATWA 4NZLA 2GZ7A 3Q3KA 1N6FA 1N7FA 2BD5A 3GOVB 2O8UA 4A5TS 1O34A 4YLQH 4DW2U 4BAQB 3KNXA 1WBGB 2JOAA 1GHXH 3U98H 3GY2A 1AFQC 1C2KA 1PJPA 2OS6A 2QXHA 3I29A 1L0ZA 2R2MB 1DOJA 2TPIZ 2RRMA 4F8KA 1P9UA 1F0SA 1TAWA 1Z87A 4A1XA 4GCHG 1ZSKA 4NA8A 4Z0KA 1S0QA 3DHKH 2V3OH 3RXSA 2BDCA 2W3IA 3EDXB 1C2EA 2ESTE 3AAUA 2FI5E 3ZYDA 1WG6A 1V6BA 1SOTA 2VGCB 3ZZ5A 1L4DA 1GI2A 2FP7B 1OZIA 2YT7A 4AG2A 3QDZB 3AAVA 1TQ7B 1W7XH 3E6PH 3LGIA 3TK6A 1EPTC 1A4WH 2R3UA 3F6UH 4X1SU 1WQSA 3ZZ4A 1W8BH 1H1BA 2WV4A 1O5CB 1O2WA 6CHAB 1ZOMA 2BY5X 2XBVA 2FYQA 1UJDA 3A80A 3RMMH 1KTSB 1Q31A 1TRYA 1E0FD 3F1SB 1MFGA 1SR5C 4WXIA 2O8LA 1IU0A 4JMYA 1V2KT 4XBCA 1V2OT 2TRMA 2XTTB 3SN8A 3SORA 7GCHF 4K1SA 4AB9A 1HIAB 2G5NA 1O3GA 1GG6B 1QAVB 2PUXB 4ZMAH 3O5NA 2JETB 3BTGE 4HZHA 3A8BA 1NZQH 5HFDA 1MAYA 1MBMA 1GJAB 1OWIA 1NTEA 1QURH 2A32A 3ENSB 1DFPA 4JYUH 1GBFA 2OPGA 4AYYB 1C1SA 1PYTD 2EEKA 4WY3A 1UVUH 2F9BH 1G9OA 2UUFB 5E0GA 2UUJB 4MLFB 4BXSA 1UO6A 5EQSA 1OWDA 2A7HA 1O2ZA 1IQFA 1GWAA 2F9OA 1TMBH 2F9NA 4J1YA 3KEEA 1LMWB 3ZV8A 2AWWA 1OYTH 3SQHE 1EJAA 1XXFA 2HNTC 3ZZCA 3PYHA 3RLYH 1MTNC 2G4UA 2F3CE 1TGNA 4R0IA 2ZECA 3LNXA 2LOBA 4NXQA 3SJIA 1OP2A 4CBOA 5E6PB 2IN2A 2P59A 4JOGA 3SNDA 1WHAA 1FIWA 2Q1JA 4WMDA 1GMCG 2GGVB 3ZVCA 4MNVA 1P1EA 3NXPA 2JIKA 2EHRA 3RXQA 2EEGA 8GCHF 4INLA 1AVXA 3RXCA 3SGAE 2HNTF 2BOKA 1HAOH 1PPCE 3SQEE 1TB6H 2VIQA 3AW1A 2H6MA 1OWEA 1TBZH 2ZDVH 1IQMA 2CHAC 3M36A 4RKOB 2ZGHA 4YT7H 1IU2A 1TNLA 1BRCE 1BOQA 5I25A 2CGAA 2VWNA 2V1WA 2OUAA 3O8RA 1SQAA 3SHUA 1T8OA 2KL1A 4RI0A 5IYTA 3RXKA 5A0AE 3CYYA 1O2UA 1V2VT 1GI5A 4NSYA 3T2NA 4DG4A 5GXPA 2VWOA 1XMNB 5HM2A 2PKAB 5GIBA 2TGPZ 2FO9A 1K1IA 3MOCA 2CSJA 4YT6H 1OWHA 3M61U 1UJ1A 2EDZA 4I32A 2J92A 2WINI 3CS7A 1ZYOA 1UITA 1H9IE 3ZZAA 1Y3YA 4U32A 1X6DA 1AMHA 2DLUA 1S6HA 3UR6A 4ZKOU 2D1JA 1SHHB 1NFXA 1BQYA 1HXFH 3I78A 1MZAA 5HDYA 2VRFA 4X6MA 2ZU4A 4AFSA 2ILNA 2XWAA 3KGPA 1UTOA 4JCNA 4F49A 3VXEH 1CT0E 2PSYA 3C27B 4TYDA 1UEZA 1Y3WA 1FPCH 2EJYA 1YM0A 5A0CA 1LQEA 4Q6HA 2EEHA 1UEWA 2A45B 4ISLA 2BY7X 4JYVH 3R3GB 3B76A 1O3FA 1RD3B 1TX7A 3LONA 3JZ1B 5GWZA 4WF8A 1FN6A 4AFZA 2H5DA 4XHVA 4MNYA 3Q3YA 4ABEA 1L6OA 5C3NA 4IBLH 1KLTA 4KFVA 1ABJH 4IMZA 4O9VA 1C1QA 4I8LA 3SI3H 1DWDH 4CH2B 1GBHA 2AIQA 2JH6D 4Y0ZE 4HFPB 4ZHLU 1CSOE 1KYNA 1ZHRA 2KJKA 1CHOG 1W3CA 1K1PA 2FPZA 5A2MH 3LGYA 1HAXB 2WUCA 5EXLA 3LC3A 3KQCA 3OU0A 1UVTH 4WH8A 1AB9C 1GMHF 2KV8A 3BEIB 1ANBA 3MU1A 3OSYA 3RXOA 3SGQE 3SU3A 2BX4A 4NNMA 2IWPA 2LC7A 1P9SA 3KQDA 1O5AB 1O5BB 2DB5A 1BMLA 1ZMLA 1ELAA 1XZ9A 1V2RT 2BVRH 4Q2NA 1Y3UA 1D3TB 4IS5A 3CP7A 1PQ8A 1TOMH 1P2IA 1CGHA 1P12E 3H7TA 1G32B 2UUKB 4K8BA 3RXGA 2GZVA 4DY7B 2ALVA 1GPZA 1FJSA 3RXVA 3ZZDA 2ZFSA 1GHZA 1SMFE 1WIFA 4NMSA 1GHBG 1IHJA 3M7TA 1NO9H 3VB6A 4UU5A 1CGIE 2RG3A 4X1NU 2Y82A 1L1JA 1GJ6A 1O3KA 1OP0A 3RMOH 1FY3A 4XSKU 1TRMA 2RA3A 1LVYA 5E8EH 5BPEA 1WF8A 1Y8TA 1A61H 2HE4A 3GCNA 4YYXA 5L2YH 3DJ3A 1GMDF 3SU5A 2FI3E 3E8LA 1PPBH 3UPEA 1IQLA 1BRAA 1SSXA 1W0YH 1GJ4H 1DLKB 3SOEA 2QCYA 3B23B 1P03A 2I6SA 1SGTA 1HJAC 1UEPA 2OCSA 2BX3A 3VEQB 2ZHQH 1JIRA 2EV8A 2BDIA 2Z3DA 2ZQ1A 2MHOA 4ISNA 5ETXA 4ZROA 6GCHF 3SUGA 5DO4H 2I4SA 4YESB 3SBKA 5HFCA 2IWOA 2H3MA 3GCOA 1TGTA 1UJUA 1A2CH 4U30A 3ZVGA 3MU8A 2G4TA 3DUXH 1V3XA 2OMJA 1GBDA 4X8UH 2OCVB 1TP3A 1C5ZB 2Y5GA 2ZU5A 1V2PT 1FAKH 3M7UA 2QF3A 2PW8H 1LVMA 4AB8A 3FFGA 2DJTA 4KFWA 3MO9A 2EXGA 2BD3A 5DP4A 3OTPA 3TLOA 1AFEH 1YLDA 1TNHA 1TMTH 2CF9H 1AVWA 4AORA 1KIGH 2PGQB 1V2QT 1Z8GA 1KXFA 1V5LA 1G30B 2CF8H 1X5RA 1BTPA 3U1JB 1ARCA 2AMQA 4U2WA 2XYAA 4R8TB 4NWKA 1ANCA 1QFKH 2R3YA 1QIXB 3T28A 1IQGA 3BG4B 5AF9H 5E2PA 4ABHA 2FX6A 4Y71A 2D8IA 1O31A 2KOJA 3LDXH 1O2JA 1UCYE 5TCCA 2FOMB 5F8XA 2FZZA 3S9CA 1EZSC 1OYQA 2ZHFH 4I8GA 1MTVA 5AVDA 5HM9A 1FC6A 1UK4A 1ELVA 1Q7XA 2ZDNA 1KSNA 3GSLA 3O8CA 1AUTC 4B2BA 4IN1A 5HEYA 2ZF0H 2SNWA 3ZZ8A 1P3EA 1YCPM 2R0LA 1WUNH 3R0HA 4MPWA 1J8AA 1B7XB 1JRSA 4JZIA 3QE1A 1CO7E 3K6YA 2VWLA 4NXRA 4AZ2B 3SHWA 1SQOA 4NNLA 1YYY1 4DCDA 3PMHB 1G9IE 1V62A 1VJ6A 3F9FA 2HNTE 2FWWA 4K75A 1BTYA 2OD3B 1QQ4A 3STJA 4Y6DA 4B76A 7GCHG 4CRGA 1LPKB 1C1PA 3QN7A 2ZFTA 1NFWA 2VJ1A 1O3DA 3CH8A 3BTFE 2AGEX 1F5RA 3G01A 1HLTH 4K8YA 2EGOA 2ZDLA 5E0JA 5C5NA 1U6QA 1C9TA 3Q3XA 3S69A 4KTCA 1GI7B 1Y5AT 3RXAA 1MZDA 1HAVB 4OS7A 3TPIZ 1O3MA 1SLVB 4A7IB 2ZCKP 9LPRA 5J4SA 1ZLRA 1C5QA 1H9HE 4FVBA 3PM3A 4NMQA 2PA1A 1P1DA 1PDRA 1JIMA 1C5XB 1P04A 3PDZA 1Y59T 4ISIH 1EP6A 4AX9H 4DVAU 2AGIX 4FXGH 1RRKA 1N6XA 1RTFB 2R0KA 1QNJA 1JBUH 2TBSA 2ZDKA 1ZR0A 2FNEA 1YGCH 2LUIA 1FIZA 1EB1H 1O3AA 2FN5A 4ABBA 1CHGA 2QY0B 5G4BA 1DICA 5A2PA 1V2LT 1MBQA 1W12U 4Y8YA 2VNTA 4GAWA 2AH4X 2J9NA 1FZZA 5HEDA 1QL8A 3NGHA 2GCTC 4NGAH 3S9AA 1UTLM 1ELBA 2F91A 2XC5A 3FANA 3VB3A 2FLBH 1UHBA 1TWXB 3EA8A 1O3BA 1SVPA 3QZQA 1HV7A 2R4HA 1GHVH 2A7JA 1DWBH 2HOBA 1PQAA 1UJVA 1UF1A 4X1PU 3SHCH 2ULLA 1A5HA 2XNIA 2ZPLA 1NPMA 1S85A 3D65E 2FE5A 2ZGXH 3MU4A 1MFLA 2H9TH 1CU1A 4CBNA 1MU8B 1G3EA 3GY5A 5DP6A 3L3TA 1QY6A 1T8MA 1C2MA 3HPTB 4ASHA 3F9EA 2G52A 1C5SA 2NU2E 4XOJA 2Z9LA 1V2UT 4JOJA 1TX6A 1CGJE 1BIOA 1DXPA 1YPKH 3TVJB 3VB4A 3ZZ6A 1DSTA 1H8DH 3LIWA 4X0WU 4R2ZA 2GT7A 3N7OA 2GCHF 1P57B 1O5EH 3SU6A 3UREA 1UVSH 1MAXA 2C8YB 4TY7A 2PZDA 2KOHA 4AG1A 2FIRH 2IWQA 1TLDA 1FPHH 2FS9A 2VB0A 3NCLA 4CR9A 1YBOA 3U69H 4M7GA 3ID1A 1DSUA 4ZHAA 4UONA 1GCTC 1UVOA 5ABWA 1NM6A 4K78A 4UFGH 1G37A 4MDSA 1EZQA 3LJJA 1C5TA 3BTHE 2WYJA 4JZDH 4NG9H 1LVOA 5AFYH 5JB8S 2LNCA 2GCTB 1PFXC 6ESTA 1HPGA 3GGEA 1LHDH 1VA8A 4Y8XA 3SV2H 2IOTA 4HOPB 5CE1A 1JOUB 1TRNA 2Z9JA 3RXHA 4X1RU 3TH2H 2O9QA 3RXPA 1O3JA 2WYGA 5GJ4B 4NMVA 2L4SA 2EEJA 2EDVA 1QHRB 1TNGA 2OP9A 4TWYA 3EA7A 5JYIA 2JREA 6CHAC 2VVVA 1C5WB 1AD8H 2PNTA 1W9EA 1WFGA 2ZCHP 2HRVA 2OC7A 2STBE 2P3TB 1VITF 4Q7YA 4ZKNU 4LK4A 2PKTA 1LPZB 1DVAH 2BDHA 3M7QA 2J94A 2C4FH 1EQ9A 3HATH 4JK5A 1V6DA 3TGIE 1C5MD 3O8BA 1UTPA 4RKJB 3H7OA 1GG6C 3LJOA 4Z6AH 2A4GA 1AKSA 1C5LH 1MCVA 2JETC 2Y7ZA 2BXUH 2F9VA 2ZFPH 1GJCB 2A5KA 1WQVH 3BTQE 1J15A 1G3CA 1NRRH 2C8WB 3GYLB 4INKA 1ARBA 1O2GH 3UWIA 2YOLA 3NWUA 2P3UB 5J4QA 2XWBI 1YF4A 4L8NA 3S7HB 1EZXC 1MD7A 2F9PA 3LGTA 3QIKA 1R6JA 3UUZA 2V3HH 4OS2A 1V2WT 4YOIA 4ABDA 3LGWA 1DLEA 4K5ZA 2AIPA 1LCYA 2ZCLP 1OSSA 3BTME 1O38A 1RJXB 1GCTB 5C67A 2ZHDA 3GY4A 4HGCA 4I31A 2BD4A 4CRFA 2GZ9A 1LHEH 1O3EA 3V0XA 5A8ZA 1BHXB 5TCAA 1O2MA 4MQAA 4FGMA 1PPFE 2VWMA 1WI4A 2XCNA 4I8KA 2OTVA 1QRZA 1ZJDA 1OS8A 2QAAA 1T4UH 3RC5A 2SGQE 2W4FA 1TA6A 1Z8JB 1D6RA 1FDPA 2DAZA 2DC2A 2ANMH 2PGBB 1N6DA 2K20A 1MQ5A 4Y79A 1C9PA 1LHFH 3SZNA 1S6FA 1ZSJA 1FXYA 1EAUA 2XCFA 1IQJA 3QJMA 3NZIA 1C2FA 1EKBB 1OPHB 5A8XA 3RL8A 3K9XB 6GCHG 3FP8E 1D5GA 2Y6TA 1C1RA 1K9OE 1QB1A 1CE5A 2B0FA 3MWIU 1U37A 5FCRA 4Q7XA 1SGQE 4E34A 1WU1A 1QLCA 2VSPA 1GQ4A 4PROA 1HAZB 3QO6A 3KL6A 1A1RA 1DS2E 4WH6A 2FM2A 1MUEB 1BJUA 3BIUH 1P05A 1TIOA 4GHTA 4TPIZ 1O35A 2BZAA 5BRRE 2OBQA 2A5IA 1QCPA 2A2XH 1BBRE 4GPGA 3LC5A 5I46H 3A82A 1FC9A 4H11A 3A86A 1UTJA 1IHTH 1TX8A 1HAVA 1RIWC 3QUMP 4AYVB 2BHGA 1J16A 1GBLA 3ZZBA 2XXLA 3A81A 1KXCA 4Q7ZA 4F4OC 1OOKB 2KQFA 2M0UA 1AE5A 1OBYA 4K6YA 1B0EA 4JOFA 1W7GH 9ESTA 3I4WA 3RMLH 1XUKA 1QJ6B 2B8OH 5DPAA 4AOQA 4CH8B 1O2YA 1UMAH 3BTDE 1VCPA 4ABJA 1C2LA 4GVDA 4NWLA 3LT3A 1GJ7B 1IQEA 3QZRA 1GI8B 1K32A 1AUJA 2QV1A 1SLWB 2K1ZA 4LOYH 1ANEA 5DP3A 3RDZA 4YM9A 3SUZA 5H3JA 1KXEA 4MVNA 2DMZA 5FCKA 1UTKA 4JOEA 1SLUB 2BMGB 1NC6A 3A7ZA 1ELCA 1TONA 2BTCE 3P6ZB 3SNEA 1S83A 3GDSA 3PTBA 1Q3OA 1GHAF 2OGPA 1FY4A 4JK6A 1EXFA 1L4ZA 1V2MT 4J2YB 4FUCA 5L6NH 1N6YA 2BLOA 1SQTA 1F2SE 4LMMA 1XVOA 4OS4A 2F9UA 1O2XA 1D4PB 2FDAA 1ANDA 3WY8A 3GICB 1WSSH 4YOJA 1QAUA 5GCHG 3GCTF 4Q2OA 2KBSA 1A0LA 1ABIH 4GHQA 1O5GH 3DFLA 2ZHWH 5E22A 1GL0E 3SV9A 2G51A 2QGRA 3WKLA 3P92A 2ZPQA 1OWKA 2TIOA 3RXEA 2RCZA 4YZUA 1EUFA 1N7TA 1AY6H 1GJBB 3VQFA 1BMNH 2C8ZB 1RIWB 1W9QA 2DLSA 1TBQH 1NROH 1GVKB 1OBXA 1EP5A 3E91A 3KN2A 1GI3A 2QXIA 2SGFE 4E05H 4E7RG 1SBWA 3K65B 3SU2A 5EPYA 3DT0H 4ISHH 4JZEH 3D62A 5C1YA 3NFKA 1C2DA 4QT8C 4K72A 3DFJA 3TJOA 1SGYE 3HVQC 4H6TA 5C5OA 3I18A 2QBWA 1P2KA 2BDYA 2W7SA 1Y5UT 3U8OH 4WMEA 3ELAH 1Z1JA 3FZZA 2GVFA 1QJ1B 3SO3A 1AE8H 1GI9B 3IITA 2QKUA 2Z6BD 3TK5A 2ANYA 1BT7A 1GI6A 4KELA 3TSWA 1DWEH 5H4IB 2D92A 4E06H 2WV5A 1T7CA 4G69A 1K1NA 2QF0A 3SJ9A 1P11E 3AASA 3LKWA 4WVPE 3HK3B 3TNSA 1GBKA 2XBXA 4Q6SA 1W2KH 1X8SA 5HGGA 1G3DA 1OXGA 5DTHA 1SGFG 3LPRA 4K60A 2I1NA 4SGBE 1FMGA 2I6VA 1MMJN 2ZGCA 2GKVE 1K2I1 2NU1E 1MKWK 1CA8B 4HOPA 1UHBB 3AXAA 3GY8A 4BAOB 2ZP0H 1D3PB 5FHTA 1SGDE 4FUJA 4TPYA 2G55A 2B5TB 3EGKH 1Z8IB 2C8XB 1MKWH 1GJ9B 1SFQB 2JKHA 2BQWB 1O30A 1GHWH 2GDEH 2TGTA 1HAYB 4NA7A 4UU6A 1EAXA 1JMOH 2VH0A 2TGDA 1BRBE 1F0UA 1BTHH 4THNH 3DIWA 1NT1A 4MTBA 1W14U 1A46H 2A5AA 2SFAA 1RGQA 2KG2A 3PROA 3SV6A 4KGAA 4NMOA 1O2QA 3C1KA 2E7KA 3BTEE 4JOKA 1IQIA 2EI8A 4UFDH 3H5CB 1C1VH 5CMXH 4IMQA 3F68H 3IWMA 2L4TA 3S7KB 5EGMA 5DP7A 2GCHG 1P8VC 3DJ1A 1N6EA 1ESTA 4A92A 4BOHA 1QA7A 3ZZ7A 3SV7A 1IQKA 4OEPA 5HFFA 3CC0A 3MNSA 3SW2B 3OY6U 2Z3EA 5FAHA 1WF7A 8ESTE 1O2SA 2C93B 1SLXB 7KMEH 1D6WA 1P2OA 3BG4C 3A8AA 3RC4A 1NRSH 1BTXA 4NCYA 2O2TA 1RXPA 1EJNA 3EGGC 2PHBA 2BB4A 1NRNH 3I77A 1V2JT 4GCHF 1T32A 2FOHA 5TJXA 3PV4A 1CBWB 1BB0B 2Q6DA 4K1EA 3T29A 2KJPA 1QB6A 3SUDA 2PTNA 3P70B 4ZUHA 5A8YA 3T26A 5C1UA 3VGCB 3T25A 2GV7A 3SNCA 2O8MA 3TJUA 1UTMA 1IQNA 1ZRBA 1DM4B 1KXAA 1A5GH 4INHA 1GM1A 3DORA 2O8TA 2H2CA 1UM1A 2BVXH 1LQDB 1XM1A 3UQVA 2FTMA 2KPKA 2Z9IA 1AKSB 1I16A 1BJVA 3A83A 4MPVA 5JBAS 3QX5H 1RTKA 1Y3XA 4ZKRU 1YPLH 4B2AA 1GJ5H 1TQ0B 3RXIA 2VU8E 1XX9A 3SUEA 2ZHEH 1BTZA 1DT2A 2BOHB 1C5VA 2ZNKH 3B9FH 1EB2A 1GVZA 1O3PB 4OS1A 3T62A 4BTTB 4E7NA 2JXOA 1XXDA 3A7YA 1T31A 1O2PA 1ZPCA 1O3CA 1FONA 4Q2KA 4YO9A 1HB0B 1SGIB 3U9AH 2ZU3A 2ALPA 1FV9A 4Q80A 1YPMH 2BM2A 3ZVEA 4OEOA 1VR1H 2HVXA 1O2OA 1O5FH 4WYTA 3OX7U 2JILA 1B8QA 2OQSA 3ATIA 1PQ7A 2KOMA 1P10A 3E16B 5LPEA 3PLBA 1A0HB 2BLQA 1IHSH 1FNIA 1HJ8A 2VIVA 2A7CA 2CXVA 1B5GH 2D2DA 3QTOH 4H6SB 1PQ5A 4Y8ZA 1EASA 2CMYA 2KRGA 1V2NT 4D9RA 3TGJE 4Z8JA 5DG6A 5EU8A 2B7DH 1OKXA 1RS0A 5EXMA 1ID5H 1DY8A 1THRH 4D8NA 1TNKA 2UWLA 2HE2A 3V13A 2YNAA 5F8ZA 2OBOA 7LPRA 1T8LA 2BQ7B 3RXFA 1DDJA 5DGJA 1KWAA 1C5RA 1QR3E 5F8TA 3LU9B 3T5FH 2ANWA 3MFJA 2KAIA 3PMAB 1TFXA 4FVDA 1C1UH 1GMCF 2B9LA 4REYA 3M3VA 5CHAB 1O2KA 1DE7H 1OBZA 2NU0E 3QGJA 4P0CA 2D8WA 3PV2A 3ZVAA 3P8FA 5JBBS 3GISB 1AU8A 1VJAU 2DE9A 5HMAA 4DGJA 1P06A 4E35A 2Z7FE 4HTCH 4KKDA 4AGJA 1G3BA 1WTGH 1VGCC 2PKSB 2I04A 5EQQA 1Z86A 3FVFB 1SGNE 4GSOA 2RCEA 1P3CA 1K1OA 2DKRA 2HLCA 5DP8A 5HJ1A 4B75A 3URCA 1THSH 1DWCH 2WPLS 2ZPMA 5HETA 2ZTXA 3P8OA 4UEHH 2JINA 1MTWA 4CHAC 5EG4A 5G1DA 4AMHA 1ZOKA 1HNEE 3MI4A 1GI1A 1O5DH 1K28D 2K1QA 2W5EA 4NZQA 3RP2A 1MTSA 5DP9A 1YCPK 3ZV9A 2Z9KA 4OS5A 2THFB 2ZEBA 3BEFB 3EQ0H 4X8TH 3E0PB 5D13A 4CREA 5DK1A 2QYIA 1VZQH 1NY22 2Y5FA 1W13U 4DIIH 2L97A 4SGAE 3NUMA 1Q2WA 2SGAA 5EYZA 1XKAC 3RXTA 3SOSA 1QGFA 5EPNA 3PWBA 4NIXA 4B73A 1VITH 1NESE 2IJOB 2PSXA 2A4OA 2WPHS 3Q76A 1TGBA 2REYA 1S81A 1XVMA 5F03A 2QG1A 3TMHA 1GCDA 2BD8A 2I6QA 2J38A 4K3JA 1KLJH 2XRCA 3TJNA 2P3WA 4ABFA 5HFEA 4IN2A 3CBZA 5T6FA 3A8CA 1W9OA 8GCHG 3OYPA 3TNTA 2EGKA 2UZCA 4NMTA 1QBNA 1N7EA 1TGSZ 2FOEA 2FCFA 2O8WA 2NU4E 2CS5A 2BDBA 1O3IA 1ZPZA 3A8DA 3A7WA 1DY9A 2A0QB 1I92A 1GHAG 5FPTA 1S84A 1RY4A 2XBYA 2G2LA 3TU7H 1M9UA 2FOAA 1ZGVA 1VGCB 2ZFQH 4GUXA 2VWRA 2Y80A 1V1TA 4IW4E 1CA0B 3SHAH 4JZ1A 1LDTT 3LH3A 2NWNA 3MNBA 1CHOF 3SGBE 1X5NA 3MU0A 1O32A 4CHAB 2PKUA 4GVUA 2QT5A 2GD4B 4TY6A 1BMAA 2ZU2A 3RLWH 1TMUH 4CR5A 1LVBA 2ZZUH 3VFEA 4FUFA 3FY5A 1AVGH 1BA8B 4U01A 2BYAX 4BNRA 1O37A 1TOCB 2G5VA 3OTJE 4NA9H 3PB1E 3U8TH 3RL7A 1W0ZU 4NFFA 3M3SA 2VVCA 3ATLA 1EOLA 1HXEH 4JYTA 1DXWA 2MX6A 1NS3A 1GDUA 1TPSA 2ANKH 3GDVA 4VGCB 1X7AC 1M5ZA 4MPAA 1QBOA 4A1VA 3S0NA 3S9BA 1ZJKA 5LH8A 3KHVA 3BG8A 4X8SH 1HRTH 1T8NA 2G81E 4H4FA 1JXPA 3V3MA 1EJMA 2TGAA 1MD8A 3SJOA 2A2QH 1TABE 3U1IB 1SGRE 4PQWA 1N8OC 1SPJA 1MTUA 3TK9A 3QK1A 3GYMA 5EW1H 3GCHB 4D9QA 4Z33A 1FUJA 1TE0A 3DA9B 4IGDA 2I0IA 1VB7A 5EXNA 1YPJH 1FY5A 4XDEA 3ZVBA 1A3EH 2EEIA 1FC7A 3RU4T 1L1GA 3A7VA 2VZ5A 1DUEA 1IOEA 2GP9B 3R0FA 2BYGA 2QXGA 3QWCH 1WTHD 1A5IA 1G2MA 1C1WH 1GBJA 3E3TA 1FN8A 5JXBA 1FY8E 3AVZA 3D23A 2M5TA 3DJAA 1BHXF 1A7SA 1C1TA 3PV5A 2P94A 2DUCA 1GMHG 1ZZZA 2ZC9H 3RM0H 2PWXA 1P2MA 4Q2QA 1QL9A 3UY9A 1SB1H 1TYNA 2A1DB 5JB9S 1X5QA 1MQ6A 5JBCS 1NF3C 1BITA 1MKXK 1U39A 2OC8A 3MO6A 2V0BA 4YTAA 6LPRA 4KP0A 1QB9A 2OXSA 1GQ5A 1UTQA 4B1TA 4B74A 1WHDA 5AHGH 3A7XA 1E38B 3RXRA 1ZHPA 1BFEA 2CJIA 4XBDA 1P01A 2KAWA 2SNVA 3STIA 1Y5BT 3NPSA 1MKXH 2H1UA 4WMFA 3U8RH 4ZH8A 1KDQA 2R2WU 5IDKA 1EAWA 3MH4A 1HAPH 3KQEA 1SOZA 4X6OA 3MH7A 3D49H 4GVCA 1N8OB 2AEIH 2W7UA 3K2UA 4OGYA 2BY9X 1C5NH 4MG3A 1QRXA 2R9PA 4FUDA 3MH5A 3A89A 2A31A 2ZDAH 1GMDG 2P8OB 4ESTE 2EAQA 2WL7A 4OAJA 1HYLA 1LKBA 2V90A 4NMPA 4DJZB 1L2EA 2SGPE 2IWNA 2XW9A 3UR9A 2FMJA 1Z6EA 2ZGBH 3FP7E 3TIUA 3QLPH 2BD7A 3R68A 5JDUB 3FAOA 4AGKA 2HGTH 1EX3A 1EOJA 3UFAA 2FOFA 2LC6A 1C5OH 3K1RA 1PPHE 2WPMS 1ACBE 1TPAE 5FXLA 1S82A 5C20A 1BTUA 1N99A 5SGAE 1INCA 1RTLA 2YNBA 1DITH 1YKTA 2ZTZA 1TBRH 2HALA 2VPHA 1AWHB 3PO1C 3LNYA 2PTCE 3LGUA 1GBEA 1GBIA 3QDOA 1QQUA 2ODPA 1H4WA 2BD2A 2Q6GA 3PS4A 4DOQA 2BDGA 2Q3GA 1GBBA 4RSPA 3B8JA 4AFQA 3TJVA 5EOKA 4I8JA 3PLPA 1ETTH 1ORFA 1JRTA 5EZ0A 3BTTE 4YDPA 2V6NA 1RFNA 2ZU1A 1NU9A 3ID2A 5A09A 2M10A 5I7ZA 3HGNA 5E1YA 3URDA 2BQ6B 3M5LA 1NU7B 1UTNA 3RM2H 3E17A 3VB5A 2YTWA 2A4QA 3EA9A 1HAIH 3Q77A 2FOGA 3PDVA 4O06A 2Z3CA 1YC0A 2H9HA 3RXLA 1O0DH 2JWEA 3SFJA 1AFQB 2FYRA 2QC2A 4BAHB 1XUHA 1W11U 2I0LA 1AZZA 2C90B 2ODQA 1T4VH 1FAXA 2UWPA 5FX6A 2AMDA 2M0VA 4O03A 1F0TA 4NMRA 5FPSA 1GBCA 1PYTC 2KAIB 1MC7A 1SGPE 3HPMA 1SL3A 2D26C 3KQBA 1YLCA 4EDJA 3K82A 1C1OA 3F9HA 2LPRA 3MO3A 1TA2A 4HI3A 1EPTB 2CN0H 3RMNH 3KZEA 1UVPA 4O3UA 3PO1B 4IC5A 2OZFA 1H8IH 4X2XA 4Q3HA 8LPRA 3ESTA 2AMPA 4FU9A 2QA9E 1ESAA 2P93A 3RU4E 1K1JA 3UOPA 4UFFH 3KZDA 3ATMA 1AGJA 2ENOA 1BZXE 2XBWA 2AWXA 4FUHA 2ZG0H 1KLIH 1ZTJA 4GLYA 1NFUA 4ISOA 1XUJA 5DJ7A 4ZAEA 3V7TA 2ZIQH 3V12A 2BLVA 1K22H 3UNQA 5EQRA 3ITIA 2ZDMA 2KA9A 3L6PA 4DT7B 1UM7A 5ESTE 3SJKA 5K7RA 3RXUA 1KTTB 1D3QB 5F6MA 4NSVA 2FLRH 4FUGA 1VCQA 2GV6A 3DD2H 1NRPH 3A84A 3QJNA 1TGCA 5LPFA 2FOCA 4A6LA 2VSVA 2EGNA 2GMTC 3MYWA 2AYWA 4KTSA 5G1EA 1K1MA 1BDAA 1V5QA 2FESH 1DUAA 1SGFA 1C4Y2 2HPPH 3HK6B 5FPYA 3ZZ3A 1U38A 3W95A 4D7GA 1MTNB 1Y3VA 2AFQB 3GY7A 3NK8A 4TWWA 2BLWA 2FXRA 2CSSA 1F92A 1HAGE 2ZPSA 4CRDA 1IQHA 3ODDA 1O3OA 2HGAA 2YT8A 1D3DB 5L2ZH 3RUOA 1QL7A 2VVUA 4JL7A 2GT8A 5JBTA 3ZYEA 1CBWC 1YBWA 3RLEA 1ZRKA 1PPEE 3IG6B 1TALA 4YLUA 4FU8A 2G5MB 4K1TA 3VGCC 1WJLA 1WCZA 5FX5A 1C4V2 3K50A 1PPZA 3RC6A 5JPMH 3M5NA 4X8VH 1BUIA 1P2JA 1ETSH 3PMBB 1GI4A 2CHAB 2RDLA 5A0BA 3ZVDA 2F0AA 2H9EH 1C2HA 1O3HA 2EI7A 4ABAA 1O3LA 1LHGH 2QIQA 1SGCA 1F5KU 3GY6A 4X2VA 3GY3A 1PPGE 2P95A 1SHYA 3PWCA 1Z8RA 3SNBA 2QN5T 3VPKA 3OY5U 1NTPA 2ZA5A 2VIPA 4WXVA 4A1TA 1GJ8B 4O3TA 4Y7AA 4LXBH 3P17H 3HKIB 5C1XA 4BANB 3LGVA 3RXMA 1E37B 1V2TT 1ZHMA 2AS9A 3QGNB 5GLJA 4NFEA 1E34B 1TNJA 1ETRH 1C2IA 2ZO3H 4FUEA 5B6LA 1F5LA 5PTPA 2WUBA 1BE9A 1GBAA 3CENA 4WYUA 2GMTB 3JZ2B 2X7ZA 1U3BA 1F0RA 1P09A 1HDTH 4UE7H 3T27A 2ZWLH 2PR3A 5EW2H 3MTYA 1NRQH 1QJ7B 3ZRTA 3TGKE 5HEBA 2Y5HA 1GJDB 4X6PA 1FCFA 5FB8C 2XC4A 4K69A 5AFZH 5GNDA 2ASUB 1THPB 1CT2E 2JH5D 1WV7H 2D90A 2C3SA 2JH0D 1J14A 4MPUA 1LPGB 4NIWA 1BBRK 1TPPA 1RGRA 5HF1A 1YPHC 1UK2A 2Z9GA 2ZI2H 3RXJA 3RXBA 5EODA 3SV8A 1XKBC 2AINA 2FI4E 1GBTA 2ZPRA 2KPLA 4CRAA 1QBVH 1AWFH 1MCTA 5HXFA 2FOBA 1C4U2 1P2NA 2H5CA 1DPOA 4GHNA 1AZ8A 3M35A 2Q9VA 1BBRH 2PLXA 2ZQ2A 5E0HA 3TSZA 5CHAC 5GPIB 4JOPA 1P02A 2PUQH 4JOHA 1SI5H 2BVSH 3HKJB 5E2OA 1Z7KA 2VIOA 4ABIA 2QKVA 2M3MA 1J9CH 1VITG 4DURA 1DX5M 3CBXA 2HWLB 4NIYA 1ZMNA 4K2YA 1AN1E 3BF6H 1C1MA 5HF4A 1AB9B 1E36B 4FUIA 5C2ZA 2PKSC 4BTUB 4FU7A 2NU3E 3NFLA 2WPIS 1A3BH 1L1NA 1O33A 3P8GA 3MH6A 4I33A 3VXFH 2BD9A 1GVLA 4AN7A 2RA0A 4BAMB 3TH3H 2BXTH 1WYKA 2CV3A 3TH4H 4NXPA 1HIAA 1LHCH 2F5YA 4X2YA 5B6OA 4H42U 5DP5A 1QAVA 1KDQB 1YP9A 3MMGA 1RGWA 3UWJH 3BPUA 1HBTH 3QGLA 4Y0YE 3PTNA 3O46A 1F7ZA 4LZ4B 1GHYH 2OQUA 2KJDA 1FQ3A 2STAE 4BAKB 1XUFA 1UK3A 1O39A 1S5SA 1OP8A 1HFDA 7ESTE 1XUIA 1EAIA 1HJ9A 3NKKA 1ELEE 1XUGA 3RXDA 1WH1A 1W10U 3P8NA 1BTWA 3MHWU 3EGHC 1ZPBA 3E0NB 2PV9B 3EYDA 2FODA 3A87A 5F3XA 1AO5A 1SG8B 1KXBA 2GTBA 1S0RA 3A7TA 1BMMH 3SNAA 4D76A 1C5UA 1HJAB 2FS8A 4JORA 2UWOA 4JZFH 4XFQA 3UNSA 1LTOA 3KIDU 2FX4A 3P95A 3FZDA 4O97A 1TQ3A 1EPTA 5GDSH 2BY8X 1GDNA 3E90B 3EAJA 3HPKA 3L4FD 2H3LA 1WI2A 4KTUA 1ELDE 1RZXA 1FY1A 1ZGIA 4I8HA 1CA0C 3KCGH 3TSVA 2QKTA 2ODYB 4X6NA 2FEQH 1Z71A 3M37A 2J34A 1IAUA 3RU4D 1YPEH 1TPOA 1LKAA 2H2ZA 1Q3XA 2W7RA 4WWYA 4DIHH 3BSQA 2IPHA 4NIVA 2G8TA 4ABGA 5L30H 3K6ZA 1NFYA 1O36A 3QTVH 5GCHF 2A4RA 1HUTH 2J2UA 2PFEA 1VJ9U 3L33A 2SGDE 1AHTH 3F9GA 1KY9A 4ZXXH 2PKAA 3A85A 5DKMA 1Y7NA 2UUYA 2W26A 2Z94A 1QA0A 2DM8A 4VGCC 5F67A 2Y81A 1H9LB 1OX1A 2WPJS 5T6DA 3Q00A 3SU4A 4BXWA 4N6XA 1YCPH 1EATA 3MNXA 4Q2PA 2OINA 4BTIB 2YUBA 1CT4E 1O3NA 1VAEA 3FP6E 2FTLE 1K21H 1WAYB 1ZTLA 1C5YB 3BEUA 3GCHC 4OS6A 5E11A 2LA8A 3SUFA 2GZ8A 2GX4A 2VINA 1UEQA 3BN9A 4Y11E 3M5OA 1HGTH 2ZKSA 4XE4A 1ELTA 4MNWA 3O8DA 1ELGA 2ZFFH 5FBEA 3BTWE 4YOGA 4P2AB 2P3FH 1AI8H 2Y7XA 4B71A 2XC0A 1O2IA 3ID4A 3KHFA 2BZ6H 2BDAA 4ZKSU 1E35B 4B2CA 3SI4H 4FUBA 1MH0A 2AGGX 4ZHMU 2OC1A 4CRCA 5LPRA 1GL1A 2W3KA 3GCTG 2J95A 4D7FA 2SGEE 3R69A 2KYLA 1FLEE 2AERH 5T6GA 1BRUP 1O2VA 1OWJA 1P0SH 2F83A 2ZFRH 4Y76A 4X2WA 3BIVH 2EA3A 1GBMA 5LGOA 1WFVA 1AQ7A 2WPKS 3VQGA 5HFBA 1C5PA 1O2TA 4AFUA 2ZGJA 3BTKE 1D9IA 4OGXA 4I7YH 3PMJA 3ID3A 3I1EA 1GI0A 3EE0B 4UDWH 2ZTYA 3ZVFA 1Q3PA 1GGDC 3ZZ9A 1C1NA 1SGEE 1CQQA 5HYOA 4RN6A 4UD9H 2OQ5A 2VH6A 5E21A 1VCWA 1HAHH 1QTFA 1T2MA 1GHBF 2GDDA 2EDPA 1O2NA 3MU5A 4K76A 1QRWA 3CBYA 4UFEH 2OC0A 3UNRA 3TITA 5K0HA 1Z6JH 2OLGA 3M3TA 4E3BA 1G2LA 8KME2 3UIRA 3WKMA 5T3HA 4LZ1H 2P16A 1CVWH 3LOXA 1B0FA 2P8OC 4MNXA 4IC6A 1MU6B 1JWTA 1O2RA 1O2HA 1P2QA 3A88A 5FBIA 2EI6A 1Z1IA 2Z17A 1V2ST 3GDUA 1O2LA 2VIWA 5ESBA 4Y7BA 1SC8U 3AW0A 2QXJA 4MPXA 1N1LA 2M0TA 3UTUH 1UCYK 2HPQH 1DANH 1FI8A 1YPGH 1ZSLA 3MNCA 1C2JA 2VGCC 4WJG2 2J4IA 1NN6A 2Q6FA 1UHPA 3JXTA 1LO6A 2BY6X 3SJ8A 3KF2A 4XBBA 3ATKA 3UOUA 2DE8A 3CS0A 3UQOA 4CRBA
chains in the Genus database with same CATH superfamily
3SU0A 1ZUBA 1KXDA 1UCYH 3VB7A 2OSGA 1HCGA 1ZTKA 1WOFA 1YPHE 1X45A 1J17T 3E1XB 1TNIA 1AIXH 3LH1A 1GDQA 3HGPA 1ZMJA 3BV9B 3ODFA 3W94A 1SFIA 4X1QU 1EZUC 1ELFA 2M0ZA 1BCUH 2AWUA 1GGDB 2EC9H 1UFXA 2G00A 3M5MA 4ZXYH 3PLKA 2H2BA 1TP5A 2YUYA 1G36A 4Y10E 1KEFA 3GJ9A 2V35A 1C2GA 2PDZA 1ESBA 1K1LA 3SU1A 2VIDA 1A0JA 3ATWA 4NZLA 2GZ7A 3Q3KA 1N6FA 1N7FA 2BD5A 2K8IA 3GOVB 2HVYB 1S6LA 2O8UA 4A5TS 1O34A 4YLQH 4DW2U 4BAQB 3KNXA 1WBGB 2JOAA 1GHXH 3U98H 3GY2A 1AFQC 1C2KA 1PJPA 2OS6A 2QXHA 2WPDD 3I29A 1L0ZA 2R2MB 1DOJA 2TPIZ 2RRMA 4F8KA 1P9UA 1F0SA 1TAWA 1Z87A 4A1XA 4GCHG 1ZSKA 4NA8A 4Z0KA 1S0QA 3DHKH 2V3OH 3RXSA 2BDCA 2W3IA 3EDXB 4RT1A 1C2EA 2ESTE 3AAUA 2FI5E 3ZYDA 1WG6A 1V6BA 1SOTA 2VGCB 3ZZ5A 1L4DA 1GI2A 2FP7B 1OZIA 2YT7A 4AG2A 3QDZB 3AAVA 1TQ7B 1W7XH 3E6PH 3LGIA 3TK6A 1EPTC 1A4WH 2R3UA 3F6UH 5KECA 4X1SU 1WQSA 3ZZ4A 2YMSD 2QE7D 1W8BH 1H1BA 2WV4A 1O5CB 1O2WA 3DCLA 6CHAB 1ZOMA 2BY5X 2XBVA 2FYQA 1UJDA 3A80A 2KCPA 3RMMH 1KTSB 1Q31A 1TRYA 1E0FD 3F1SB 1MFGA 1SR5C 4WXIA 2O8LA 1IU0A 4JMYA 1V2KT 4XBCA 1V2OT 2TRMA 2XTTB 3SN8A 3SORA 7GCHF 4K1SA 4AB9A 1HIAB 2G5NA 1O3GA 1GG6B 1QAVB 2PUXB 4ZMAH 3O5NA 2JETB 3BTGE 4HZHA 3A8BA 1NZQH 5HFDA 1MAYA 1MBMA 1GJAB 1OWIA 1NTEA 1QURH 2A32A 3ENSB 1DFPA 4JYUH 1GBFA 2OPGA 4AYYB 1C1SA 1PYTD 2EEKA 4WY3A 1UVUH 2F9BH 1G9OA 2UUFB 5E0GA 2UUJB 4MLFB 4BXSA 1UO6A 5EQSA 1OWDA 2A7HA 1O2ZA 1IQFA 1GWAA 2V3MA 2F9OA 1TMBH 2F9NA 4J1YA 3KEEA 1LMWB 3ZV8A 2AWWA 1OYTH 3SQHE 1EJAA 1XXFA 2HNTC 3ZZCA 3PYHA 3RLYH 1MTNC 2G4UA 3NRLA 2F3CE 1TGNA 4R0IA 2ZECA 3LNXA 2LOBA 4NXQA 3SJIA 1OP2A 4CBOA 5E6PB 2IN2A 2P59A 4JOGA 3SNDA 1WHAA 1FIWA 2Q1JA 4WMDA 4Q63A 1GMCG 2GGVB 3ZVCA 4MNVA 1P1EA 3NXPA 2JIKA 2EHRA 3RXQA 2EEGA 8GCHF 4INLA 1AVXA 3RXCA 3SGAE 2HNTF 2BOKA 1HAOH 1PPCE 3SQEE 1TB6H 2VIQA 3AW1A 2H6MA 1OWEA 1TBZH 2ZDVH 1IQMA 2CHAC 3M36A 3FN8A 4OM9A 4RKOB 2ZGHA 4YT7H 2WSSD 1IU2A 1TNLA 1BRCE 1BOQA 5I25A 2CGAA 2VWNA 2V1WA 2OUAA 3O8RA 1SQAA 3SHUA 1T8OA 2KL1A 4RI0A 5IYTA 3RXKA 5A0AE 3CNRA 3CYYA 1O2UA 1V2VT 1GI5A 4NSYA 3T2NA 4DG4A 5GXPA 2VWOA 1H8HD 1XMNB 5HM2A 2PKAB 5GIBA 2TGPZ 2FO9A 1K1IA 3MOCA 2CSJA 4YT6H 1OWHA 3M61U 1UJ1A 2EDZA 4I32A 2J92A 2L74A 2WINI 3CS7A 2EY4C 1ZYOA 1UITA 1H9IE 3ZZAA 1Y3YA 4U32A 1X6DA 1AMHA 1NBME 2DLUA 1S6HA 3UR6A 4ZKOU 2D1JA 1SHHB 1NFXA 1BQYA 1HXFH 3I78A 1MZAA 5HDYA 2VRFA 4X6MA 2ZU4A 4AFSA 2ILNA 2XWAA 3KGPA 1UTOA 4JCNA 4F49A 3VXEH 1CT0E 2PSYA 3C27B 4TYDA 1UEZA 1Y3WA 1FPCH 2EJYA 1YM0A 5A0CA 1LQEA 4Q6HA 2KX4A 2EEHA 1UEWA 2A45B 4ISLA 2BY7X 4JYVH 3R3GB 5EIYA 3B76A 1O3FA 1RD3B 1TX7A 3LONA 3JZ1B 1EFRD 4WF8A 5GWZA 1FN6A 4AFZA 2H5DA 4XHVA 3F0PA 4MNYA 3Q3YA 4ABEA 1L6OA 5C3NA 4IBLH 1KLTA 4FETA 4KFVA 1ABJH 4IMZA 4O9VA 5HIZA 4ASUD 1C1QA 4I8LA 3SI3H 1DWDH 4CH2B 1GBHA 2AIQA 2JH6D 4Y0ZE 4HFPB 4ZHLU 3MQKC 1CSOE 1KYNA 1ZHRA 2KJKA 1CHOG 1W3CA 1K1PA 2FPZA 5A2MH 3LGYA 1UW7A 1HAXB 2WUCA 5EXLA 3LC3A 3KQCA 3OU0A 1UVTH 5C17A 4WH8A 1AB9C 1GMHF 2KV8A 3BEIB 1ANBA 3MU1A 3OSYA 3RXOA 3SGQE 3SU3A 2BX4A 4NNMA 2IWPA 2LC7A 1P9SA 3KQDA 1O5AB 1O5BB 2DB5A 1BMLA 1ZMLA 1ELAA 1XZ9A 1V2RT 2BVRH 4Q2NA 1Y3UA 1D3TB 4IS5A 3CP7A 1PQ8A 1TOMH 1P2IA 1CGHA 1P12E 3H7TA 1G32B 4P02A 2UUKB 4K8BA 3RXGA 2GZVA 4DY7B 2ALVA 1GPZA 1FJSA 3RXVA 3ZZDA 2ZFSA 1GHZA 1SMFE 1WIFA 4NMSA 1GHBG 1IHJA 3M7TA 1NO9H 3VB6A 4UU5A 1CGIE 2KCYA 2RG3A 4X1NU 2Y82A 1L1JA 1GJ6A 1O3KA 1OP0A 3RMOH 1FY3A 4XSKU 1TRMA 2RA3A 1LVYA 5E8EH 5BPEA 4B6FA 1WF8A 1Y8TA 1A61H 2HE4A 3GCNA 4YYXA 5L2YH 3DJ3A 1GMDF 3SU5A 2FI3E 3E8LA 1PPBH 3UPEA 1IQLA 1BRAA 1SSXA 1W0YH 1GJ4H 1DLKB 3SOEA 2QCYA 3B23B 1P03A 2I6SA 1SGTA 1HJAC 1UEPA 2OCSA 5CHBA 2BX3A 3VEQB 2ZHQH 1JIRA 2EV8A 2BDIA 2Z3DA 2ZQ1A 4FOUC 2MHOA 4ISNA 5ETXA 4ZROA 6GCHF 3SUGA 5DO4H 2I4SA 4YESB 3SBKA 3SZEA 5HFCA 2IWOA 2H3MA 3GCOA 1TGTA 1UJUA 1A2CH 4U30A 3ZVGA 3MU8A 2G4TA 3DUXH 1V3XA 2OMJA 1GBDA 4X8UH 2OCVB 1TP3A 1C5ZB 2Y5GA 2ZU5A 1V2PT 1FAKH 3M7UA 2QF3A 2PW8H 1LVMA 4AB8A 3FFGA 2DJTA 4KFWA 4AC9A 3MO9A 2EXGA 2BD3A 5DP4A 2RFKC 3OTPA 3TLOA 1AFEH 1YLDA 1TNHA 1TMTH 2CF9H 1AVWA 4AORA 1KIGH 2PGQB 1V2QT 4TT3D 1Z8GA 4HG6A 1KXFA 1V5LA 1G30B 2CF8H 5HIYA 1X5RA 1BTPA 3U1JB 1ARCA 2AMQA 4U2WA 2XYAA 4R8TB 4NWKA 1ANCA 1QFKH 2R3YA 1QIXB 3T28A 1IQGA 3BG4B 5AF9H 5E2PA 4ABHA 2FX6A 4Y71A 2D8IA 1O31A 2KOJA 3LDXH 1O2JA 1UCYE 5TCCA 2FOMB 5F8XA 2FZZA 3S9CA 1EZSC 1OYQA 2ZHFH 4I8GA 1MTVA 5AVDA 5HM9A 1FC6A 1UK4A 1ELVA 1Q7XA 2VBCA 2ZDNA 1KSNA 3GSLA 3O8CA 2XNDD 1AUTC 4B2BA 4IN1A 5HEYA 2ZF0H 2SNWA 3F2FA 1P3EA 1YCPM 2R0LA 3ZZ8A 1WUNH 4ZCNA 3R0HA 4MPWA 1J8AA 1B7XB 1JRSA 4JZIA 3QE1A 1CO7E 3K6YA 2VWLA 4NXRA 4AZ2B 1BMFD 3SHWA 3KYGA 1SQOA 4NNLA 1YYY1 4DCDA 3PMHB 1G9IE 1V62A 1VJ6A 3F9FA 2HNTE 2FWWA 4K75A 1BTYA 2OD3B 1QQ4A 3STJA 4Y6DA 4B76A 7GCHG 4CRGA 1LPKB 1C1PA 5ILBA 3QN7A 2ZFTA 1NFWA 2VJ1A 1O3DA 3CH8A 3BTFE 2AGEX 1F5RA 3G01A 4I86A 1HLTH 4K8YA 2EGOA 2ZDLA 2IJD1 5E0JA 5C5NA 1U6QA 1C9TA 3Q3XA 3S69A 4KTCA 1GI7B 1Y5AT 3RXAA 1MZDA 1HAVB 4OS7A 3TPIZ 1O3MA 1SLVB 4A7IB 2ZCKP 9LPRA 5J4SA 1ZLRA 1C5QA 1H9HE 4FVBA 3PM3A 4NMQA 2PA1A 3DSOA 1P1DA 1PDRA 1JIMA 1C5XB 1P04A 3PDZA 1Y59T 4ISIH 1EP6A 4AX9H 4DVAU 2AGIX 4FXGH 1RRKA 1N6XA 1RTFB 2R0KA 1QNJA 1JBUH 2TBSA 2ZDKA 1ZR0A 2FNEA 1YGCH 2LUIA 1FIZA 1EB1H 1O3AA 2FN5A 4ABBA 1CHGA 2QY0B 5G4BA 1DICA 5A2PA 1V2LT 1KMHB 2WV9A 1MBQA 1W12U 4Y8YA 2VNTA 4GAWA 4XRNA 2AH4X 2J9NA 1FZZA 5HEDA 1QL8A 3NGHA 2GCTC 3H09A 4NGAH 3S9AA 1UTLM 1ELBA 2F91A 2XC5A 3FANA 3VB3A 2FLBH 1SQRA 1UHBA 1TWXB 3EA8A 1O3BA 1SVPA 3QZQA 1HV7A 2R4HA 1GHVH 2A7JA 1DWBH 2HOBA 1PQAA 1UJVA 1UF1A 4X1PU 3SHCH 2ULLA 1A5HA 2XNIA 2ZPLA 1NPMA 1S85A 3D65E 2FE5A 2ZGXH 3MU4A 1MFLA 2H9TH 1CU1A 4CBNA 2K0QA 3KDKA 1MU8B 1G3EA 3GY5A 5DP6A 3L3TA 1QY6A 1T8MA 1C2MA 3HPTB 4ASHA 3F9EA 2LP6A 2G52A 1C5SA 2NU2E 4XOJA 2Z9LA 1V2UT 4JOJA 1TX6A 1CGJE 1BIOA 1DXPA 1YPKH 3TVJB 3VB4A 2J97A 3ZZ6A 1DSTA 1H8DH 3LIWA 4X0WU 4R2ZA 2GT7A 3N7OA 2GCHF 1P57B 1O5EH 3SU6A 3UREA 1UVSH 1MAXA 2C8YB 4TY7A 2PZDA 2KOHA 4AG1A 4ACAA 2FIRH 2IWQA 1TLDA 1FPHH 2FS9A 2VB0A 3NCLA 4CR9A 1YBOA 3U69H 4M7GA 3ID1A 1DSUA 4ZHAA 4UONA 1GCTC 1UVOA 5ABWA 1NM6A 4K78A 4UFGH 1G37A 4MDSA 1EZQA 4F48B 3LJJA 1C5TA 3BTHE 5T1VA 2WYJA 4JZDH 4NG9H 1LVOA 5AFYH 5JB8S 2LNCA 2GCTB 1PFXC 6ESTA 1HPGA 3GGEA 1LHDH 1VA8A 4Y8XA 3SV2H 2IOTA 4HOPB 5CE1A 1JOUB 1TRNA 2Z9JA 3RXHA 4X1RU 3TH2H 2O9QA 3RXPA 1O3JA 2WYGA 5GJ4B 4NMVA 2L4SA 2EEJA 2EDVA 1QHRB 1TNGA 2OP9A 4TWYA 3EA7A 5JYIA 2JREA 6CHAC 2VVVA 1C5WB 1AD8H 2PNTA 1W9EA 1WFGA 2ZCHP 2HRVA 2OC7A 2STBE 2P3TB 1VITF 4Q7YA 4ZKNU 4LK4A 2PKTA 1LPZB 1DVAH 2BDHA 3M7QA 2J94A 2C4FH 3UAIC 1EQ9A 3HATH 4JK5A 1V6DA 5FL7D 3TGIE 1C5MD 3O8BA 1UTPA 4RKJB 3H7OA 1GG6C 3LJOA 5IL9A 2A4GA 4Z6AH 1AKSA 1C5LH 1MCVA 2JETC 2Y7ZA 2BXUH 2F9VA 2ZFPH 3WWBA 1GJCB 2A5KA 1W0JD 1WQVH 3BTQE 1J15A 1G3CA 1NRRH 2C8WB 3GYLB 4INKA 1ARBA 1O2GH 3UWIA 2YOLA 3NWUA 2P3UB 2JIZD 5J4QA 2XWBI 4DT4A 1YF4A 4Z1MD 4L8NA 3S7HB 1EZXC 1MD7A 2F9PA 3LGTA 3QIKA 1R6JA 3UUZA 2V3HH 4OS2A 1V2WT 4YOIA 4ABDA 3LGWA 1DLEA 4K5ZA 2AIPA 1LCYA 2ZCLP 1OSSA 3BTME 1O38A 1RJXB 1GCTB 5C67A 2ZHDA 3GY4A 4HGCA 4I31A 2BD4A 4CRFA 2GZ9A 1LHEH 1O3EA 5KGOA 3V0XA 1BHXB 5A8ZA 5TCAA 1O2MA 3OAAD 4MQAA 4FGMA 1PPFE 2VWMA 1WI4A 2XCNA 4I8KA 2OTVA 1QRZA 1ZJDA 1OS8A 2QAAA 1T4UH 3RC5A 2SGQE 2W4FA 1TA6A 1Z8JB 1D6RA 1FDPA 2DAZA 2DC2A 2ANMH 2PGBB 1N6DA 2K20A 1MQ5A 4Y79A 1C9PA 1LHFH 3SZNA 1S6FA 1ZSJA 1FXYA 1EAUA 2XCFA 1IQJA 3QJMA 3NZIA 1C2FA 1EKBB 1OPHB 5A8XA 3RL8A 3K9XB 6GCHG 3FP8E 1D5GA 2Y6TA 1C1RA 1K9OE 1QB1A 1CE5A 2B0FA 3MWIU 1U37A 5FCRA 4Q7XA 1SGQE 4E34A 1WU1A 1QLCA 2VSPA 1GQ4A 4PROA 1HAZB 3QO6A 3KL6A 1A1RA 1DS2E 4WH6A 2FM2A 1MUEB 1BJUA 3BIUH 1P05A 1TIOA 4GHTA 4TPIZ 1O35A 2BZAA 5BRRE 2OBQA 2A5IA 1QCPA 2A2XH 1BBRE 4GPGA 3LC5A 5I46H 3A82A 1FC9A 4H11A 3A86A 1UTJA 1IHTH 1TX8A 1HAVA 1RIWC 3QUMP 4AYVB 2BHGA 1J16A 3GABA 1GBLA 3ZZBA 2XXLA 3A81A 1KXCA 5B42A 4Q7ZA 4F4OC 3KYFA 1K0HA 1OOKB 2KQFA 2M0UA 1AE5A 1OBYA 4K6YA 1B0EA 4JOFA 1W7GH 9ESTA 3I4WA 3RMLH 1XUKA 1QJ6B 2B8OH 5DPAA 4AOQA 4CH8B 1O2YA 1UMAH 3BTDE 1VCPA 4ABJA 1C2LA 4GVDA 4NWLA 3LT3A 1GJ7B 1IQEA 3QZRA 1GI8B 1K32A 1AUJA 2QV1A 1SLWB 2K1ZA 4LOYH 1ANEA 5DP3A 3RDZA 4YM9A 3SUZA 5H3JA 1KXEA 4MVNA 2DMZA 5FCKA 1UTKA 4JOEA 1SLUB 2BMGB 1NC6A 3A7ZA 1ELCA 1TONA 2BTCE 3P6ZB 3SNEA 2GJGA 1S83A 3GDSA 3PTBA 1Q3OA 1GHAF 5C94A 2OGPA 1FY4A 4JK6A 1W0KD 1EXFA 1L4ZA 1V2MT 4J2YB 4FUCA 5L6NH 1N6YA 2BLOA 2KCAA 1SQTA 1F2SE 4LMMA 1XVOA 4OS4A 2F9UA 1O2XA 1D4PB 2FDAA 1ANDA 3WY8A 3GICB 1WSSH 4YOJA 1QAUA 5GCHG 1YY3A 3GCTF 4Q2OA 2KBSA 1A0LA 1ABIH 4GHQA 1O5GH 3DFLA 1E1QD 4P00A 2ZHWH 5E22A 1GL0E 3SV9A 2G51A 2QGRA 3WKLA 3P92A 2ZPQA 1OWKA 2TIOA 3RXEA 2RCZA 4YZUA 1EUFA 1N7TA 1AY6H 1GJBB 3VQFA 1BMNH 2C8ZB 1RIWB 1W9QA 2DLSA 1TBQH 1NROH 1GVKB 2YMSB 1OBXA 1EP5A 3E91A 3KN2A 1GI3A 2QXIA 2SGFE 4E05H 4E7RG 1SBWA 3K65B 3SU2A 5EPYA 3DT0H 4ISHH 4JZEH 3D62A 5C1YA 3NFKA 1C2DA 3OEED 4QT8C 4K72A 3DFJA 3TJOA 1SGYE 3HVQC 4H6TA 5C5OA 3I18A 2QBWA 1P2KA 2BDYA 2W7SA 1Y5UT 3U8OH 4Q4LA 3ELAH 1Z1JA 4WMEA 3FZZA 2GVFA 3F0OA 1QJ1B 3SO3A 1AE8H 1GI9B 3IITA 2QKUA 2Z6BD 3TK5A 2ANYA 1BT7A 1GI6A 4KELA 3TSWA 1DWEH 5H4IB 2D92A 4E06H 2WV5A 1T7CA 4G69A 1K1NA 2QF0A 3SJ9A 1P11E 3AASA 3LKWA 4WVPE 3HK3B 3TNSA 1GBKA 2XBXA 2KCOA 4Q6SA 1W2KH 1X8SA 5HGGA 1G3DA 1OXGA 5DTHA 1SGFG 3LPRA 4K60A 2I1NA 4SGBE 1FMGA 2I6VA 1MMJN 2ZGCA 2GKVE 1K2I1 2NU1E 1MKWK 1CA8B 4HOPA 1UHBB 3AXAA 3GY8A 4BAOB 2ZP0H 1E79D 1D3PB 5FHTA 1SGDE 4FUJA 4TPYA 2G55A 2B5TB 3EGKH 1Z8IB 2C8XB 1MKWH 1GJ9B 1SFQB 2JKHA 2BQWB 1O30A 1GHWH 2GDEH 2TGTA 1HAYB 4NA7A 4UU6A 1EAXA 1JMOH 2VH0A 2TGDA 1BRBE 1F0UA 1BTHH 4THNH 3DIWA 1NT1A 4MTBA 4F55A 1W14U 1A46H 2A5AA 2SFAA 1RGQA 2KG2A 3PROA 3SV6A 4KGAA 4NMOA 1O2QA 3C1KA 3NCVA 2E7KA 3BTEE 4JOKA 1IQIA 2EI8A 4UFDH 3H5CB 1C1VH 5CMXH 4IMQA 3F68H 3IWMA 2L4TA 3S7KB 5EGMA 5DP7A 2GCHG 3ZIAD 1P8VC 3FOAA 3DJ1A 1N6EA 1ESTA 4A92A 4BOHA 1QA7A 3ZZ7A 3SV7A 1IQKA 4OEPA 5HFFA 3CC0A 3MNSA 3SW2B 3OY6U 2Z3EA 5FAHA 1WF7A 8ESTE 1O2SA 2C93B 1SLXB 7KMEH 1D6WA 1P2OA 3BG4C 3A8AA 3RC4A 1NRSH 1BTXA 4NCYA 2O2TA 1RXPA 1EJNA 3EGGC 2PHBA 2BB4A 1NRNH 3I77A 1V2JT 4GCHF 1T32A 2FOHA 5TJXA 3PV4A 1CBWB 5DN6D 1BB0B 2Q6DA 4K1EA 4RT0A 3T29A 2KJPA 1QB6A 3SUDA 2PTNA 3P70B 4ZUHA 5A8YA 3T26A 5C1UA 3VGCB 1YLNA 3T25A 2GV7A 3SNCA 2O8MA 3TJUA 1UTMA 1IQNA 2KR7A 1ZRBA 1DM4B 1KXAA 2WHXA 1A5GH 4INHA 1GM1A 3DORA 2O8TA 2H2CA 1UM1A 2BVXH 1LQDB 1XM1A 3UQVA 2FTMA 2KPKA 2Z9IA 1AKSB 1I16A 1BJVA 3A83A 4MPVA 5JBAS 3QX5H 1RTKA 1Y3XA 4ZKRU 1YPLH 4B2AA 3FKSD 1GJ5H 1TQ0B 3RXIA 2VU8E 1XX9A 3SUEA 2ZHEH 1BTZA 1DT2A 2BOHB 1C5VA 2ZNKH 3B9FH 1EB2A 1GVZA 1O3PB 3F3BA 4OS1A 3T62A 4BTTB 2JXOA 4E7NA 1XXDA 3A7YA 1T31A 1O2PA 1ZPCA 1O3CA 3F2HA 1FONA 4Q2KA 4YO9A 1HB0B 1SGIB 3U9AH 2ZU3A 2ALPA 1FV9A 4Q80A 1YPMH 2BM2A 3ZVEA 4OEOA 1VR1H 2HVXA 5EJ1A 1O2OA 1O5FH 4WYTA 3OX7U 2JILA 1B8QA 2OQSA 3ATIA 1PQ7A 2KOMA 1P10A 3E16B 5LPEA 3PLBA 1A0HB 2BLQA 1IHSH 1FNIA 1HJ8A 2VIVA 2A7CA 2CXVA 1B5GH 2D2DA 3QTOH 4H6SB 1PQ5A 4Y8ZA 1EASA 2CMYA 2KRGA 1V2NT 4D9RA 3TGJE 4Z8JA 2W6ID 5DG6A 5EU8A 2B7DH 1OKXA 1RS0A 5EXMA 3DSPA 1ID5H 1DY8A 1THRH 4D8NA 1TNKA 2UWLA 2HE2A 3V13A 2YNAA 5F8ZA 2OBOA 7LPRA 1T8LA 2BQ7B 4XD7D 3RXFA 1DDJA 5DGJA 1KWAA 1C5RA 1QR3E 5F8TA 3LU9B 3T5FH 2ANWA 3MFJA 2KAIA 3PMAB 1TFXA 4FVDA 1C1UH 1GMCF 2B9LA 4REYA 3M3VA 5CHAB 1O2KA 1DE7H 4B6EA 3EE7A 1OBZA 2NU0E 3QGJA 4P0CA 2D8WA 3PV2A 3ZVAA 3P8FA 5JBBS 3GISB 1AU8A 1VJAU 2DE9A 5HMAA 2L6OA 4DGJA 1P06A 4E35A 2Z7FE 4HTCH 4KKDA 4AGJA 1G3BA 1WTGH 1VGCC 2PKSB 2I04A 5EQQA 1Z86A 3FVFB 1SGNE 4GSOA 2RCEA 1P3CA 1K1OA 2DKRA 2HLCA 5DP8A 5HJ1A 4B75A 3URCA 1THSH 1DWCH 2WPLS 2ZPMA 5HETA 2ZTXA 3P8OA 4UEHH 4M9FA 2JINA 1MTWA 4CHAC 5EG4A 5G1DA 4AMHA 1WXRA 1ZOKA 1HNEE 3MI4A 1OHHD 1GI1A 1O5DH 1K28D 2K1QA 2W5EA 4NZQA 3RP2A 1MTSA 5DP9A 1YCPK 3ZV9A 2Z9KA 1NBMD 4OS5A 2THFB 2ZEBA 3BEFB 3EQ0H 4X8TH 3U28C 3E0PB 5D13A 4CREA 5DK1A 2QYIA 1VZQH 1NY22 2Y5FA 1W13U 4DIIH 2L97A 4SGAE 3NUMA 1Q2WA 2SGAA 5EYZA 1XKAC 3RXTA 3SOSA 1QGFA 5EPNA 3PWBA 5C0UA 4NIXA 4B73A 1VITH 1NESE 2IJOB 2PSXA 2A4OA 2WPHS 3Q76A 1TGBA 2REYA 1FX0B 1S81A 1XVMA 2QG1A 3TMHA 1GCDA 2BD8A 5F03A 2I6QA 2J38A 4K3JA 1KLJH 2XRCA 3TJNA 2P3WA 4ABFA 5HFEA 4IN2A 3CBZA 5T6FA 3A8CA 1W9OA 8GCHG 3OYPA 3TNTA 2EGKA 2UZCA 4NMTA 1QBNA 1N7EA 1TGSZ 2FOEA 2FCFA 2J98A 2O8WA 2NU4E 2CS5A 2BDBA 1O3IA 1ZPZA 3A8DA 3A7WA 1DY9A 2A0QB 1I92A 1GHAG 5FPTA 1S84A 1RY4A 2IPQX 3OEHD 2XBYA 2G2LA 3TU7H 1YWUA 1M9UA 2FOAA 1ZGVA 1VGCB 2ZFQH 4GUXA 2VWRA 2Y80A 1V1TA 4IW4E 1CA0B 3SHAH 4JZ1A 1LDTT 3LH3A 2NWNA 3MNBA 1CHOF 3SGBE 1X5NA 3MU0A 1O32A 4CHAB 2PKUA 4GVUA 2QT5A 2GD4B 4TY6A 1BMAA 2ZU2A 3RLWH 1TMUH 4CR5A 1LVBA 2ZZUH 3VFEA 4FUFA 3FY5A 1AVGH 1BA8B 2LELA 4U01A 2BYAX 4BNRA 1O37A 1TOCB 2G5VA 3OTJE 4NA9H 3PB1E 3U8TH 3RL7A 1W0ZU 4NFFA 3M3SA 2VVCA 3ATLA 1EOLA 5DSFA 1HXEH 4JYTA 1DXWA 2MX6A 1NS3A 1GDUA 1TPSA 2ANKH 3GDVA 4VGCB 1X7AC 1M5ZA 4MPAA 1QBOA 4A1VA 4ACBA 4TSFD 3S0NA 3S9BA 1ZJKA 5LH8A 3KHVA 3BG8A 4X8SH 1HRTH 1T8NA 2G81E 4H4FA 1JXPA 3V3MA 1EJMA 2TGAA 1MD8A 3SJOA 2A2QH 1TABE 3U1IB 1SGRE 4PQWA 1N8OC 1SPJA 1MTUA 3TK9A 3QK1A 3GYMA 5EW1H 5KEDA 3GCHB 4D9QA 4Z33A 3AK5A 1FUJA 1TE0A 3DA9B 4IGDA 5HKKD 2I0IA 1VB7A 5EXNA 1YPJH 1FY5A 4XDEA 3ZVBA 1A3EH 2EEIA 1FC7A 3RU4T 1L1GA 3A7VA 2VZ5A 1DUEA 1IOEA 2GP9B 3R0FA 2BYGA 2QXGA 3QWCH 1WTHD 1A5IA 1G2MA 1C1WH 1GBJA 2M2AA 3E3TA 1FN8A 5JXBA 1FY8E 3AVZA 3D23A 2M5TA 3DJAA 1BHXF 1A7SA 2KZ4A 1C1TA 3PV5A 2P94A 3OFND 3W1EA 2DUCA 1GMHG 1ZZZA 2ZC9H 3RM0H 2PWXA 1P2MA 4Q2QA 1QL9A 3UY9A 1SB1H 1TYNA 2A1DB 5JB9S 1X5QA 1MQ6A 5JBCS 1NF3C 1BITA 1MKXK 1U39A 2OC8A 3MO6A 2V0BA 4YTAA 6LPRA 4KP0A 1QB9A 3WWFA 2OXSA 1GQ5A 1UTQA 4B1TA 4B74A 1WHDA 5AHGH 3A7XA 1E38B 3RXRA 3VG8A 1ZHPA 1BFEA 2CJIA 2F43B 4XBDA 1P01A 2KAWA 2SNVA 3STIA 1Y5BT 3NPSA 1MKXH 2H1UA 4WMFA 3U8RH 2EQNA 4ZH8A 1KDQA 2R2WU 5IDKA 1EAWA 3MH4A 1HAPH 3KQEA 1SOZA 4X6OA 3MH7A 3D49H 4GVCA 1N8OB 2AEIH 2W7UA 3K2UA 4OGYA 2BY9X 1C5NH 4MG3A 1QRXA 2R9PA 2J5UA 4FUDA 3MH5A 3A89A 2A31A 2ZDAH 1GMDG 2P8OB 4ESTE 2EAQA 2WL7A 4OAJA 1HYLA 1LKBA 2V90A 4NMPA 4DJZB 1L2EA 2SGPE 2IWNA 2XW9A 3UR9A 2FMJA 1Z6EA 2ZGBH 3FP7E 3TIUA 3QLPH 2BD7A 3R68A 5JDUB 2AHME 3FAOA 4AGKA 2HGTH 1EX3A 1EOJA 3UFAA 2FOFA 2LC6A 1C5OH 3K1RA 1PPHE 2WPMS 4D76A 1ACBE 1TPAE 5FXLA 1S82A 5C20A 1BTUA 1N99A 5SGAE 1INCA 1RTLA 2YNBA 1DITH 1YKTA 2ZTZA 1TBRH 2HALA 2VPHA 1AWHB 3PO1C 3LNYA 2PTCE 3LGUA 1GBEA 1GBIA 3QDOA 1QQUA 2V7QD 2ODPA 1H4WA 2BD2A 2Q6GA 3PS4A 4DOQA 2BDGA 2Q3GA 1GBBA 4RSPA 3B8JA 4AFQA 3TJVA 5EOKA 4I8JA 3PLPA 1ETTH 1ORFA 1JRTA 5EZ0A 3BTTE 4YDPA 2V6NA 1RFNA 2ZU1A 2YMSC 1NU9A 3ID2A 5A09A 2M10A 5I7ZA 3HGNA 5E1YA 3URDA 2BQ6B 3M5LA 1NU7B 1UTNA 3RM2H 3E17A 3VB5A 2YTWA 2A4QA 3EA9A 1HAIH 3Q77A 2FOGA 3PDVA 4O06A 2Z3CA 1YC0A 2H9HA 3RXLA 1O0DH 2JWEA 3SFJA 1AFQB 1VKYA 1X9ZA 2FYRA 2QC2A 4BAHB 1XUHA 1W11U 2I0LA 1AZZA 2C90B 2ODQA 2QF5A 1T4VH 1FAXA 2UWPA 5FX6A 2AMDA 2M0VA 4O03A 1F0TA 4NMRA 5FPSA 1GBCA 1PYTC 2KAIB 1MC7A 1SGPE 3HPMA 3N7EA 1SL3A 2D26C 3KQBA 2JDID 1YLCA 4EDJA 3KQ5A 3K82A 1C1OA 3F9HA 2LPRA 3MO3A 1TA2A 4HI3A 1EPTB 2CN0H 3RMNH 3KZEA 1UVPA 4O3UA 3PO1B 4IC5A 2OZFA 1H8IH 4X2XA 4Q3HA 8LPRA 3ESTA 2AMPA 4FU9A 2QA9E 1ESAA 2P93A 3RU4E 1K1JA 3UOPA 4UFFH 3KZDA 3ATMA 1AGJA 2ENOA 1BZXE 2XBWA 2AWXA 3PRDA 4FUHA 2ZG0H 1KLIH 1ZTJA 4GLYA 1NFUA 4ISOA 1XUJA 5DJ7A 4ZAEA 3V7TA 2ZIQH 3V12A 2BLVA 1K22H 3UNQA 5EQRA 3ITIA 2ZDMA 2KA9A 3L6PA 4DT7B 1UM7A 5ESTE 3SJKA 5K7RA 3RXUA 1KTTB 1D3QB 4FLNA 5F6MA 4NSVA 2FLRH 4FUGA 1VCQA 2GV6A 3DD2H 1NRPH 3A84A 3QJNA 1TGCA 2WZQA 5LPFA 2FOCA 4A6LA 2VSVA 2EGNA 2XOKD 2GMTC 3MYWA 2AYWA 4KTSA 5G1EA 1K1MA 1BDAA 1V5QA 2FESH 1DUAA 1SGFA 1C4Y2 2HPPH 3HK6B 3F2GA 5FPYA 3ZZ3A 1U38A 4JJ0A 3W95A 4D7GA 1MTNB 1Y3VA 2AFQB 3GY7A 3NK8A 4TWWA 2BLWA 2FXRA 2CSSA 1F92A 1HAGE 2ZPSA 4CRDA 5EJZA 1IQHA 3ODDA 2J98B 1O3OA 5C0TA 2HGAA 2YT8A 1D3DB 5L2ZH 3RUOA 1QL7A 2VVUA 4JL7A 2GT8A 3SYJA 5JBTA 3ZYEA 1CBWC 1YBWA 3RLEA 1ZRKA 1PPEE 3IG6B 1TALA 4YLUA 4FU8A 2G5MB 4K1TA 3VGCC 1WJLA 1WCZA 5FX5A 1C4V2 3K50A 1PPZA 3RC6A 5JPMH 3M5NA 4X8VH 1BUIA 1P2JA 1ETSH 3PMBB 1GI4A 2CHAB 2RDLA 5A0BA 3ZVDA 2F0AA 2H9EH 1C2HA 1O3HA 2EI7A 4ABAA 1O3LA 1LHGH 2QIQA 1SGCA 1F5KU 3GY6A 4X2VA 3GY3A 1PPGE 3PRBA 2P95A 1SHYA 3PWCA 1Z8RA 3SNBA 2QN5T 3VPKA 3OY5U 1NTPA 2ZA5A 2VIPA 4WXVA 4A1TA 1GJ8B 4O3TA 4Y7AA 4LXBH 3P17H 3HKIB 5C1XA 4BANB 3LGVA 3RXMA 1E37B 1V2TT 1ZHMA 2AS9A 2QF4A 3QGNB 5GLJA 4NFEA 1E34B 1TNJA 1ETRH 1C2IA 2ZO3H 4FUEA 5B6LA 1F5LA 5PTPA 2WUBA 1BE9A 1GBAA 3CENA 4WYUA 2GMTB 3JZ2B 2X7ZA 1U3BA 1F0RA 1P09A 1HDTH 4UE7H 3T27A 2ZWLH 2PR3A 5EW2H 3MTYA 5IK2D 1NRQH 1QJ7B 3ZRTA 3TGKE 5HEBA 2Y5HA 1GJDB 4X6PA 1FCFA 5FB8C 2XC4A 4K69A 5AFZH 5GNDA 2ASUB 1THPB 1CT2E 2JH5D 1WV7H 2D90A 2C3SA 2JH0D 1J14A 4MPUA 1LPGB 2GEFA 1BBRK 1TPPA 4NIWA 1RGRA 5HF1A 1YPHC 1UK2A 2Z9GA 2ZI2H 2W6JD 3RXJA 3RXBA 5EODA 3SV8A 1XKBC 2AINA 2FI4E 1GBTA 2ZPRA 2KPLA 3DSGA 1QBVH 4CRAA 1AWFH 1MCTA 5HXFA 2FOBA 1C4U2 1P2NA 2H5CA 1DPOA 4GHNA 1AZ8A 3M35A 2Q9VA 1BBRH 2PLXA 2ZQ2A 5E0HA 3TSZA 5CHAC 5GPIB 4JOPA 1P02A 2PUQH 4JOHA 1SI5H 2BVSH 3HKJB 5E2OA 1Z7KA 2VIOA 4ABIA 2QKVA 2M3MA 1J9CH 1VITG 2JJ2D 1DX5M 3CBXA 2HWLB 4DURA 2KM0A 4NIYA 1ZMNA 4K2YA 1AN1E 3BF6H 1C1MA 5HF4A 1AB9B 1E36B 4FUIA 5C2ZA 2PKSC 4BTUB 4FU7A 2NU3E 3NFLA 2WPIS 1A3BH 1L1NA 1O33A 3P8GA 3MH6A 4I33A 3VXFH 2BD9A 1GVLA 4YXWD 4AN7A 2RA0A 4BAMB 3TH3H 2BXTH 1WYKA 2CV3A 3TH4H 4NXPA 1HIAA 1LHCH 2F5YA 4X2YA 5B6OA 4H42U 5DP5A 1QAVA 1KDQB 1YP9A 3MMGA 1RGWA 3UWJH 3BPUA 1HBTH 3QGLA 4Y0YE 3PTNA 3O46A 1F7ZA 4LZ4B 1GHYH 2OQUA 2KJDA 1FQ3A 2STAE 4BAKB 1XUFA 1UK3A 2RDEA 3UB0A 1O39A 1S5SA 1OP8A 1HFDA 7ESTE 1XUIA 2KFWA 1EAIA 1HJ9A 3NKKA 1ELEE 1XUGA 3RXDA 1WH1A 1W10U 3P8NA 1BTWA 3MHWU 3EGHC 1ZPBA 3E0NB 2CK3D 2PV9B 1MABB 3EYDA 2FODA 3A87A 5F3XA 1AO5A 1SG8B 1KXBA 2GTBA 1S0RA 3A7TA 1BMMH 1E1RD 3SNAA 1C5UA 1HJAB 2FS8A 4JORA 2UWOA 4JZFH 4XFQA 3UNSA 1LTOA 3KIDU 2FX4A 3P95A 3FZDA 4O97A 1TQ3A 1EPTA 5GDSH 2BY8X 1GDNA 3E90B 3EAJA 3HPKA 3L4FD 2H3LA 1WI2A 4KTUA 1ELDE 1RZXA 1FY1A 1ZGIA 2F4LA 4I8HA 1CA0C 3KCGH 3TSVA 2QKTA 2ODYB 4X6NA 2FEQH 1Z71A 3M37A 2J34A 3KDGA 1IAUA 3RU4D 1YPEH 1TPOA 1LKAA 2H2ZA 2JJ1D 1Q3XA 5F53A 3WW7A 2W7RA 2HLDD 4WWYA 4DIHH 3BSQA 2IPHA 4NIVA 2G8TA 4ABGA 5L30H 3K6ZA 1NFYA 1O36A 3QTVH 5GCHF 2A4RA 1HUTH 2J2UA 2PFEA 1VJ9U 3L33A 2SGDE 1AHTH 3F9GA 1KY9A 4ZXXH 2PKAA 3A85A 5DKMA 1Y7NA 2UUYA 2W26A 2Z94A 1QA0A 2DM8A 2PP6A 4VGCC 5F67A 2Y81A 1H9LB 1OX1A 2WPJS 5T6DA 3Q00A 3SU4A 4BXWA 4N6XA 1YCPH 1EATA 3MNXA 4Q2PA 2OINA 4BTIB 2YUBA 1CT4E 1O3NA 1VAEA 3FP6E 2FTLE 1K21H 1WAYB 1ZTLA 1C5YB 3BEUA 3GCHC 4OS6A 5E11A 2LA8A 3SUFA 2GZ8A 2GX4A 2VINA 1UEQA 3BN9A 4Y11E 3M5OA 1HGTH 2ZKSA 4XE4A 1ELTA 4MNWA 3O8DA 1ELGA 2ZFFH 5FBEA 3GS9A 3BTWE 5EJLA 4YOGA 4P2AB 2P3FH 1AI8H 2Y7XA 1QZ8A 4B71A 2XC0A 1O2IA 3ID4A 3KHFA 2BZ6H 2BDAA 3FO8D 4ZKSU 1E35B 4B2CA 3SI4H 3N7DA 4FUBA 1MH0A 2AGGX 4ZHMU 2OC1A 4CRCA 5LPRA 1GL1A 2W3KA 3GCTG 2J95A 4D7FA 2SGEE 3R69A 2KYLA 1FLEE 2AERH 5T6GA 1BRUP 1O2VA 1OWJA 1P0SH 2F83A 1SKYE 2ZFRH 4X2WA 4Y76A 3BIVH 2EA3A 1GBMA 5LGOA 1WFVA 1AQ7A 2WPKS 3VQGA 5HFBA 1C5PA 1O2TA 4AFUA 2ZGJA 3BTKE 1D9IA 4OGXA 4I7YH 3PMJA 3ID3A 3I1EA 1GI0A 3EE0B 1WDIA 4UDWH 2ZTYA 3ZVFA 1Q3PA 1GGDC 3ZZ9A 1C1NA 1SGEE 1CQQA 5HYOA 4RN6A 4UD9H 2OQ5A 2VH6A 5E21A 1VCWA 1HAHH 1QTFA 1T2MA 1GHBF 2GDDA 2EDPA 1O2NA 3MU5A 4K76A 1QRWA 3CBYA 4UFEH 2OC0A 3UNRA 3TITA 5K0HA 1Z6JH 2OLGA 3M3TA 4E3BA 1G2LA 3OE7D 3UIRA 8KME2 3WKMA 1COWD 5T3HA 4LZ1H 2P16A 1CVWH 3LOXA 1B0FA 2P8OC 4MNXA 4IC6A 1MU6B 1H8ED 1JWTA 1O2RA 1O2HA 1P2QA 3A88A 5FBIA 2EI6A 1Z1IA 5CDFE 2OK5A 2Z17A 1V2ST 3GDUA 1O2LA 2VIWA 5ESBA 4Y7BA 1SC8U 3AW0A 2QXJA 4MPXA 1N1LA 2M0TA 3UTUH 1UCYK 2HPQH 1DANH 1FI8A 1YPGH 1ZSLA 3MNCA 1C2JA 2VGCC 4WJG2 2J4IA 1NN6A 2Q6FA 1UHPA 3JXTA 1LO6A 2BY6X 3SJ8A 3N99A 3KF2A 4JJ3A 4XBBA 3ATKA 3UOUA 2DE8A 3CS0A 3UQOA 4CRBA 2JSNA
chains in the Genus database with same CATH topology
3SU0A 1ZUBA 1KXDA 1UCYH 3VB7A 2OSGA 1HCGA 1ZTKA 1WOFA 1YPHE 1X45A 1J17T 3E1XB 1TNIA 1AIXH 3LH1A 1GDQA 3HGPA 1ZMJA 3BV9B 3ODFA 3W94A 1SFIA 4X1QU 1EZUC 1ELFA 2M0ZA 1BCUH 2AWUA 1GGDB 2EC9H 1UFXA 2G00A 3M5MA 4ZXYH 3PLKA 2H2BA 1TP5A 2YUYA 1G36A 4Y10E 1KEFA 3GJ9A 2V35A 1C2GA 2PDZA 1ESBA 1K1LA 3SU1A 2VIDA 1A0JA 3ATWA 4NZLA 2GZ7A 3Q3KA 1N6FA 1N7FA 2BD5A 3GOVB 2O8UA 4A5TS 1O34A 4YLQH 4DW2U 4BAQB 3KNXA 1WBGB 2JOAA 1GHXH 3U98H 3GY2A 1AFQC 1C2KA 1PJPA 2OS6A 2QXHA 3I29A 1L0ZA 2R2MB 1DOJA 2TPIZ 2RRMA 4F8KA 1P9UA 1F0SA 1TAWA 1Z87A 4A1XA 4GCHG 1ZSKA 4NA8A 4Z0KA 1S0QA 3DHKH 2V3OH 3RXSA 2BDCA 2W3IA 3EDXB 1C2EA 2ESTE 3AAUA 2FI5E 3ZYDA 1WG6A 1V6BA 1SOTA 2VGCB 3ZZ5A 1L4DA 1GI2A 2FP7B 1OZIA 2YT7A 4AG2A 3QDZB 3AAVA 1TQ7B 1W7XH 3E6PH 3LGIA 3TK6A 1EPTC 1A4WH 2R3UA 3F6UH 4X1SU 1WQSA 3ZZ4A 1W8BH 1H1BA 2WV4A 1O5CB 1O2WA 6CHAB 1ZOMA 2BY5X 2XBVA 2FYQA 1UJDA 3A80A 3RMMH 1KTSB 1Q31A 1TRYA 1E0FD 3F1SB 1MFGA 1SR5C 4WXIA 2O8LA 1IU0A 4JMYA 1V2KT 4XBCA 1V2OT 2TRMA 2XTTB 3SN8A 3SORA 7GCHF 4K1SA 4AB9A 1HIAB 2G5NA 1O3GA 1GG6B 1QAVB 2PUXB 4ZMAH 3O5NA 2JETB 3BTGE 4HZHA 3A8BA 1NZQH 5HFDA 1MAYA 1MBMA 1GJAB 1OWIA 1NTEA 1QURH 2A32A 3ENSB 1DFPA 4JYUH 1GBFA 2OPGA 4AYYB 1C1SA 1PYTD 2EEKA 4WY3A 1UVUH 2F9BH 1G9OA 2UUFB 5E0GA 2UUJB 4MLFB 4BXSA 1UO6A 5EQSA 1OWDA 2A7HA 1O2ZA 1IQFA 1GWAA 2F9OA 1TMBH 2F9NA 4J1YA 3KEEA 1LMWB 3ZV8A 2AWWA 1OYTH 3SQHE 1EJAA 1XXFA 2HNTC 3ZZCA 3PYHA 3RLYH 1MTNC 2G4UA 2F3CE 1TGNA 4R0IA 2ZECA 3LNXA 2LOBA 4NXQA 3SJIA 1OP2A 4CBOA 5E6PB 2IN2A 2P59A 4JOGA 3SNDA 1WHAA 1FIWA 2Q1JA 4WMDA 1GMCG 2GGVB 3ZVCA 4MNVA 1P1EA 3NXPA 2JIKA 2EHRA 3RXQA 2EEGA 8GCHF 4INLA 1AVXA 3RXCA 3SGAE 2HNTF 2BOKA 1HAOH 1PPCE 3SQEE 1TB6H 2VIQA 3AW1A 2H6MA 1OWEA 1TBZH 2ZDVH 1IQMA 2CHAC 3M36A 4RKOB 2ZGHA 4YT7H 1IU2A 1TNLA 1BRCE 1BOQA 5I25A 2CGAA 2VWNA 2V1WA 2OUAA 3O8RA 1SQAA 3SHUA 1T8OA 2KL1A 4RI0A 5IYTA 3RXKA 5A0AE 3CYYA 1O2UA 1V2VT 1GI5A 4NSYA 3T2NA 4DG4A 5GXPA 2VWOA 1XMNB 5HM2A 2PKAB 5GIBA 2TGPZ 2FO9A 1K1IA 3MOCA 2CSJA 4YT6H 1OWHA 3M61U 1UJ1A 2EDZA 4I32A 2J92A 2WINI 3CS7A 1ZYOA 1UITA 1H9IE 3ZZAA 1Y3YA 4U32A 1X6DA 1AMHA 2DLUA 1S6H