3MH7A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease do
total genus 86
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh7A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh7A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh7A01
1C2HA 1VJ9U 5F6MA 1QB9A 1MTWA 2FOEA 3ID3A 2FYRA 3UQOA 2OD3B 1A0HB 1FNIA 1LVYA 5JB9S 1FN8A 5C1XA 1FI8A 4H4FA 2A4QA 3UOUA 3LGTA 2CF9H 3BV9B 1GVZA 1J15A 3RXTA 1KXAA 3RXLA 1H8DH 4K60A 5SGAE 1PPFE 1JBUH 2MX6A 4R2ZA 5C67A 2HWLB 1RXPA 3SNDA 3RXGA 1GBIA 1U3BA 2ZFSA 1D6WA 1EJNA 4ZROA 1BE9A 2BDIA 1QQ4A 1XUGA 3Q00A 4JOFA 5GCHG 3S9AA 1YPHC 1UM1A 1V1TA 1FLEE 4Q2NA 1L2EA 2EJYA 4I8KA 3R68A 2FTLE 1AKSB 2ZQ2A 4WJG2 1ELGA 1DVAH 4NNMA 4UU5A 2JILA 3TIUA 1TP5A 2PFEA 1MAXA 2HOBA 1AUJA 4O03A 3T2NA 5LPRA 4FUCA 1SGRE 3P6ZB 3A89A 2BDGA 3HGPA 4F4OC 1NZQH 2KJDA 1VGCC 2K1QA 5LPEA 1OBYA 1QL9A 4SGBE 2EGOA 2A4RA 2GX4A 5E6PB 2ULLA 5A09A 3RC6A 1H9HE 2P95A 2CSJA 3T26A 2VGCB 3UUZA 3GOVB 2VIQA 1OKXA 5C2ZA 1D6RA 1RY4A 1GJ6A 1LQDB 1UTLM 4X6OA 1BA8B 3IITA 2ZPMA 1XKAC 1UVTH 3KEEA 2CS5A 1MUEB 1GBJA 2EC9H 2F9UA 2F9OA 2FS9A 1QAUA 1B8QA 1ZTJA 3CYYA 1T8LA 2FODA 2ZDLA 1RJXB 4B76A 5EU8A 1HAPH 1LVBA 3BTKE 2P3UB 3M3SA 4Q2PA 2H1UA 7GCHG 1FY5A 1GJAB 1NRNH 4FVBA 2RRMA 1QTFA 1TNJA 2OS6A 3A7XA 2AGIX 2ZGJA 3QTVH 8GCHG 2G8TA 3HVQC 5EQRA 2XYAA 1O2LA 4X8VH 1A46H 2SFAA 1ESAA 2GV6A 1Z87A 2ZFPH 3RMNH 1E35B 1VR1H 1ZSKA 2H2ZA 4K69A 2AMQA 5HMAA 5ABWA 1YPLH 2GDDA 2J95A 4TPIZ 2AMPA 2M10A 1JMOH 1B7XB 1QA0A 2C8ZB 2O8LA 4ISNA 5DK1A 5JYIA 1QLCA 1FY3A 2JETC 1TMTH 4JK5A 2AFQB 1BZXE 1PQ5A 1FZZA 5CE1A 1HCGA 1HDTH 1K1PA 1CE5A 3PTBA 4NIWA 4Y8YA 1F0RA 5FBEA 1D9IA 1H8IH 2JOAA 1AFQC 2VU8E 4CRGA 4AG2A 2GV7A 4JOPA 2C8YB 2ZNKH 4CBOA 1FY8E 4INLA 1UVOA 4ZXXH 2GZ7A 1XUIA 3TJUA 2XW9A 2M5TA 4UFEH 2QGRA 4TYDA 3UWJH 4Y0YE 4MLFB 1MQ6A 4KKDA 1W9EA 2AGEX 1QA7A 4GSOA 1TOCB 2ASUB 2PR3A 3E8LA 3SUDA 1V62A 4CREA 4BOHA 5AF9H 1MTNB 3K50A 1GHVH 4B2CA 4I32A 4CBNA 3SU3A 3MO6A 1DOJA 1A0JA 1OP0A 3AW0A 1G2MA 2D2DA 1YBWA 1ZTKA 3RXMA 3VQFA 4AORA 1KLJH 6CHAC 5JXBA 1DE7H 1O5GH 1P8VC 2BYGA 2O8UA 1IU0A 3OSYA 1V2LT 4B2BA 2J34A 1RFNA 1ANDA 1SGDE 3LPRA 2C8WB 1ANBA 2QF0A 2BY5X 2ZDVH 1AUTC 2ZGXH 1Q3OA 4K1TA 3BEFB 3DA9B 2R4HA 4JORA 1CT0E 3UFAA 4XE4A 1C5YB 2ZCLP 1YYY1 4NMPA 5E11A 1FC6A 1F5LA 2BDHA 2PWXA 3F9FA 2WPIS 3RXOA 4ABFA 1GMDF 3NFLA 4JZ1A 5EW2H 2EA3A 5GLJA 1ORFA 1UTMA 1QIXB 2W26A 3QTOH 1ARCA 5FCRA 3I78A 2FI3E 2H9TH 4ISHH 1HAZB 1YKTA 1GCDA 1TPOA 4AOQA 2Q6GA 5GDSH 2Z9JA 1SQOA 1DX5M 2QXHA 3BG4B 1GI8B 1HJ8A 3SV6A 4U01A 3CH8A 1Z7KA 1SGEE 2VVCA 5JBTA 2PKSC 3MNXA 5F8XA 5FX5A 4MQAA 3EGKH 5E2PA 1MBQA 4JYUH 2OC1A 1YPHE 1C9PA 1WYKA 7ESTE 2ZCHP 2Z6BD 5E22A 5GJ4B 2A31A 4R8TB 3QE1A 4B74A 2A4OA 4OEPA 2ZFTA 1GJDB 5GXPA 3UPEA 2Z94A 3RMLH 3RXPA 4NWLA 2DB5A 4I33A 1P03A 4ZAEA 1QL7A 1S84A 1F7ZA 1TGCA 2YNAA 1XXDA 2GTBA 3B8JA 1O3IA 1V6DA 6LPRA 1EAIA 2OBOA 1UJ1A 1PYTD 2WPHS 3N7OA 4NMOA 4RKJB 5ETXA 4X6MA 1BJVA 2P3WA 1L4DA 3P8FA 3SNBA 1FONA 4FUJA 1C5LH 1OWEA 1YF4A 2ZTZA 1PPCE 2FEQH 4UFDH 4REYA 3MFJA 4X6PA 4Y0ZE 4YM9A 1C2GA 1EB1H 4G69A 2OINA 1T8MA 1T2MA 1FC7A 1MTVA 3QGLA 3GCHB 1M5ZA 1WAYB 2EGKA 1V2PT 3TJVA 1N99A 2EEHA 2JH6D 1IQKA 3VEQB 3PV4A 3SUEA 1BRCE 4ZHAA 2ZA5A 3A8AA 2L97A 1BRBE 3SNCA 1QAVA 1C1TA 4J1YA 5JB8S 3DUXH 3E0PB 1AB9B 3R3GB 1G3EA 1ZOKA 1KXFA 2PSXA 1GJ7B 5DP8A 3CC0A 1UVSH 2VNTA 5DP5A 1P10A 4FU8A 3SV2H 5DP9A 7LPRA 1ZGIA 4AB9A 2W3IA 1S83A 2H2CA 2FPZA 2KPKA 1TNLA 3M7QA 3MO3A 3HK3B 1ARBA 1BTHH 1UTPA 4IS5A 3SV8A 1SFQB 5EG4A 4O9VA 2FX6A 3DHKH 1F0TA 1Z8RA 3ATLA 4TPYA 1V5QA 2WPLS 2J38A 3FP7E 5HF1A 2H5CA 4I8LA 1EPTC 2BDBA 2ZFRH 1V2WT 5C1YA 3PV2A 3SOEA 2SNVA 3SU6A 3I77A 3I4WA 1GJ8B 3EA8A 2ZFFH 1H9IE 3M35A 1S0RA 1EJMA 1TX6A 2GGVB 2DM8A 2XCNA 2OCVB 4BXSA 4HOPA 1LHEH 3EDXB 4TWYA 2PKUA 1GI5A 3QZRA 3P17H 1WI2A 1SGYE 3NKKA 1PFXC 4X8UH 4YZUA 3M5LA 3SHAH 2QIQA 3HATH 4JZFH 4MNYA 1SQTA 1O2XA 1KTSB 3GY2A 3SJOA 1NY22 1KTTB 5LH8A 2G4UA 1K1LA 2ODPA 3GCTG 1XMNB 4GVUA 1UF1A 4FXGH 4RSPA 4X1PU 2NU1E 3SUGA 1RTFB 3RP2A 3RU4E 3TH4H 1WI4A 1U38A 1T32A 2EEGA 5K0HA 3PV5A 1ELCA 3A88A 3GICB 2IWPA 3BTHE 4I31A 3GSLA 1XUKA 4JOKA 1O33A 1O2IA 1G3DA 1OWHA 2FN5A 1KXBA 1INCA 1O3DA 2KAIB 4MTBA 4OGXA 2ZPQA 2FCFA 1P06A 1ID5H 2GZ9A 1XZ9A 1DT2A 5FCKA 3LOXA 1YPMH 1CHOG 1O3MA 2BDYA 1AIXH 3VXFH 2J2UA 4FUBA 2CMYA 4A6LA 4INKA 1OS8A 1TOMH 5A8YA 3ZZ5A 1OYQA 1BHXF 1K32A 2HLCA 3DJAA 3HPTB 2ZDKA 3EA9A 1P57B 3TITA 1S0QA 1MQ5A 1K1MA 3OU0A 3GCTF 2F83A 2PV9B 4IW4E 1TA2A 1HUTH 1P11E 1YPKH 4D7FA 1P01A 2F9NA 1GVKB 2FOBA 4K75A 3H7OA 3R0HA 3RXRA 4XBDA 1PYTC 2HGAA 1K28D 2PKSB 5BPEA 3ZZCA 1G37A 1TQ0B 2Z3DA 2RCZA 1FXYA 2FOAA 1CGJE 3S9CA 2VVUA 2R2MB 2WYJA 3VB6A 2ZFQH 2ENOA 3C1KA 4ZKRU 1HIAA 1DPOA 2YUBA 1Q31A 3KZEA 1ZPZA 4WXIA 2Z17A 2VZ5A 3BTME 3VFEA 1RS0A 1C5PA 1UTNA 2A5IA 1AQ7A 1W13U 2A1DB 1GJ5H 4E05H 1A3BH 3S9BA 2XNIA 4AMHA 1YPGH 1J9CH 4LZ1H 2ZTXA 1CHGA 1UK3A 3AAVA 4WH6A 1BMNH 3KIDU 3PM3A 3PWBA 1PPZA 3TGJE 3SGBE 5TCAA 5JBCS 1T4UH 3KN2A 2BD8A 4BAQB 4IC5A 3NFKA 3TPIZ 2C90B 3KNXA 3A87A 1ZYOA 1O37A 1HB0B 4FU7A 1MCVA 3NPSA 1QJ1B 1GBMA 2Z3EA 3SJ8A 4JZEH 1DY9A 5GPIB 1QB1A 2QG1A 3LNYA 4NMRA 1CQQA 2G55A 3K9XB 3NWUA 4AG1A 1O2UA 3BPUA 3QLPH 2P93A 1AHTH 4NNLA 1GMCF 1SPJA 2BD5A 1WF8A 1IQIA 4X8TH 2UWLA 1OWJA 3ZVDA 3M3TA 4IN1A 3TH2H 4XDEA 1P05A 3UNRA 3SORA 1FPCH 3BTEE 2VSPA 2BY9X 1FN6A 3ZVFA 4DVAU 1X7AC 5GWZA 2DLSA 1QJ7B 4KTCA 2FOCA 1E37B 2KAIA 2P16A 1IQMA 1UM7A 1DM4B 4YOIA 5HFEA 1O3JA 1VGCB 1T8OA 2G00A 3CENA 1Q2WA 3MYWA 4K2YA 1K22H 1W11U 4XSKU 1LMWB 4NXPA 4ZHLU 1QRWA 2V90A 4JOHA 2G5NA 1N8OC 1O30A 2WINI 1TNKA 3S7HB 2EI8A 1FIZA 4Y71A 1WV7H 2BXTH 2BY7X 1IHJA 4CR9A 3RLEA 2Y5FA 2KA9A 3SUZA 3H5CB 3NCLA 1GJ9B 3GDUA 1EOLA 3LNXA 3LC5A 1UVPA 4NXQA 1JOUB 5DPAA 4AGJA 2J92A 3HPKA 1C2FA 1DICA 4X1RU 4DURA 1DDJA 4AB8A 4AYYB 5H3JA 4NA8A 1PPEE 2NU3E 2Q6FA 3MU1A 4WMFA 1BTXA 2ZPSA 4U30A 1LPZB 1MD8A 1JXPA 2AIQA 4U32A 2D26C 2ZO3H 5EZ0A 1TGTA 2I4SA 3ZYEA 2QN5T 1AWHB 1ZJDA 4JL7A 4GCHG 4I8GA 1VJAU 3E91A 1Z8GA 1G9OA 2AYWA 3ATKA 5EOKA 1HGTH 4AX9H 4X2VA 3AASA 1IQJA 1C1VH 1QFKH 2M3MA 2FOHA 1CBWB 2DC2A 1TB6H 4Y10E 1G2LA 3U8TH 3QZQA 4P2AB 4AGKA 2WPKS 2GCTC 4ZHMU 4B75A 4YOJA 4B73A 2W3KA 3Q3YA 5PTPA 4UD9H 1GI0A 2KAWA 2W5EA 1TPAE 5EQQA 2GKVE 1EJAA 3PLBA 3UWIA 5E1YA 1HAYB 1F5KU 1C2KA 1X45A 2OPGA 2W7UA 2QXGA 2K1ZA 1O2KA 4Y76A 2XC5A 2Z9LA 4Y7BA 1CT4E 2ANMH 1Q3XA 2ZKSA 3BEIB 2ZWLH 3FP8E 3O8CA 2G81E 3SO3A 1BTZA 3RXIA 1TAWA 1O3OA 1P9SA 4U2WA 2XTTB 1QB6A 3RMOH 3S69A 2VRFA 5G1DA 5HEBA 4NWKA 5AVDA 1AB9C 1KYNA 2QT5A 1SHHB 1UCYE 1V2RT 8KME2 3LGYA 2ZECA 3KQBA 2FO9A 2XBVA 4AYVB 2BVSH 3PO1C 2PTNA 1DANH 2HGTH 2RG3A 3IWMA 1O2TA 3STIA 5A8ZA 1UEPA 4CRCA 1KIGH 1O2JA 2CSSA 2D1JA 3ODDA 1GHZA 4ZKOU 1F0UA 1XM1A 2BD3A 8LPRA 3SOSA 4DIIH 1W10U 1Y59T 2I0IA 1EQ9A 2Z9IA 2AEIH 2I6VA 2NU0E 1BBRE 3VB3A 3O5NA 4ABBA 1IQFA 1TLDA 2NU2E 2G2LA 3TGIE 3MHWU 2JH0D 1UJUA 5HFCA 1THSH 1GG6C 3BG8A 5JBAS 2ZGHA 2ZHDA 2VSVA 1MKWH 5E0HA 2PNTA 3L6PA 4MPVA 2H5DA 1V2VT 1A5GH 2TGAA 2TGTA 4CH2B 3A82A 3CBZA 1P04A 1DWDH 4YDPA 4MPUA 1VITG 4A5TS 1QBNA 4XBBA 1LO6A 1YCPM 1WHDA 2OZFA 3DFLA 3SJKA 3K6YA 2IJOB 1YCPH 4Z33A 1SGCA 3Q3XA 1KXEA 1SLXB 2O8MA 3QWCH 2ZC9H 5C5OA 3T29A 4ABJA 2L4SA 1LPGB 1C1SA 3M7TA 2BOKA 2SNWA 4X1NU 2PW8H 1C5RA 3CS7A 2YT7A 5E0GA 5FHTA 2JINA 1TRNA 4KTSA 5C1UA 1AE5A 4Y8ZA 1GPZA 2DKRA 1GHXH 4O3TA 1W14U 2YUYA 2C93B 1TONA 1WFGA 2HE2A 1O36A 2Y5GA 3ZYDA 2ZTYA 2VPHA 4B71A 2FESH 3PMHB 2GZ8A 3LGIA 1GI3A 2BD4A 1AKSA 3RXCA 7GCHF 1SBWA 4ABEA 1NM6A 1N7FA 3BN9A 2VJ1A 2LPRA 1O2ZA 1CO7E 2ZP0H 1O5AB 1ELAA 2P3TB 1XVMA 2V3OH 1EOJA 3RC5A 2NWNA 1TFXA 3L3TA 1V5LA 1H4WA 3BSQA 4GAWA 5FPSA 2FTMA 1N6FA 2EV8A 2QV1A 1W7GH 3LIWA 1Y5UT 1Z1JA 1W7XH 1Z8JB 4Q6HA 2AIPA 3KZDA 3RM0H 1A61H 1TALA 5EYZA 4INHA 4BAOB 3OX7U 3M61U 1SOZA 3RXKA 3SV9A 4WF8A 5GNDA 1UK2A 1ACBE 1XUHA 3M5MA 3BIVH 1EZSC 5EXLA 1C2DA 3FZDA 1LVMA 1QBOA 5F67A 4Q3HA 1C5MD 2ILNA 3M36A 1MFLA 4I8JA 1GDUA 1OSSA 4OGYA 1Y3UA 2UWPA 4ABGA 1ZHRA 3JZ2B 1SGFA 5A0AE 2FNEA 2BY6X 4JZIA 3FFGA 3I29A 5GIBA 4AFZA 2OC8A 3GJ9A 1ESBA 3ZZDA 1CGIE 4IN2A 1EKBB 3SHUA 3TU7H 4PROA 1FIWA 2HNTE 4I8HA 3SI3H 5TJXA 5HETA 2IN2A 1QHRB 2ESTE 5HEYA 1QR3E 2F9BH 1EZXC 3TMHA 1H9LB 3IG6B 1CBWC 3TJOA 1T31A 1YP9A 3PMAB 2B7DH 2FI5E 1LKBA 1CA0C 3KL6A 5DP4A 4SGAE 1FJSA 1LHGH 1Y5AT 1MC7A 4Q7XA 3WKMA 3BIUH 2H9EH 4DW2U 4X0WU 1KWAA 1AGJA 1SFIA 1EP6A 2DLUA 1ZZZA 1D5GA 1RGRA 1VA8A 4HGCA 5E8EH 3MMGA 3T25A 4LZ4B 2FXRA 1P0SH 1THRH 3ODFA 1O32A 1V6BA 3RXVA 1ELTA 2JWEA 1FMGA 3KHFA 1QBVH 1X5QA 1WBGB 4GPGA 1O2SA 1BOQA 2UUFB 2D8IA 1P1EA 2RCEA 2QKUA 1L6OA 3QGJA 2R3UA 1NO9H 1SLVB 3QJMA 1BCUH 3F1SB 3SFJA 1JRTA 5C20A 3SV7A 3E90B 2BHGA 2P8OC 2GMTC 3TK6A 4GUXA 5J4QA 2VWRA 3QUMP 3TSVA 2ODYB 3TVJB 2I0LA 1N6DA 5L2ZH 1BRUP 2B9LA 3AXAA 2JREA 3M37A 2PTCE 1GM1A 1UCYH 1YLDA 3A7ZA 4O3UA 1C5ZB 5EPYA 3RC4A 3SBKA 4JK6A 2EHRA 1SGNE 3I18A 4NSVA 1DLKB 3ZZ3A 4WXVA 1RGQA 1P1DA 3EAJA 4Q2KA 1WIFA 2ZU5A 3BF6H 3GDSA 4ABDA 2C4FH 5F8TA 2CF8H 2PUXB 1YCPK 4GHNA 3GY5A 2QAAA 1UK4A 1B0EA 3F9GA 4Y7AA 1C5WB 3SUFA 1THPB 2ZU1A 1OOKB 1WFVA 4Q2OA 2GMTB 1X5NA 2ZU2A 1O3PB 1OX1A 5D13A 2XXLA 3AAUA 4H6SB 2OSGA 1KLIH 1NU9A 3BTFE 1C2JA 1LDTT 2BQ7B 2F0AA 3WKLA 1GL0E 1GBDA 4ISIH 1UHBA 1OBXA 4D7GA 6GCHG 3CBXA 2V35A 1ZHPA 3RXHA 1G3CA 2PLXA 2BB4A 3RUOA 3KQDA 1RGWA 2G52A 4O97A 5JPMH 3KCGH 4E7NA 4NXRA 1RZXA 1EZUC 2Q3GA 1I16A 2SGPE 2BD9A 3K6ZA 9ESTA 1HV7A 1U6QA 2IWNA 1Q7XA 4K6YA 3P8NA 3MI4A 1ETTH 3ZZ7A 3O8DA 1O38A 2ZU4A 2ZQ1A 4JOEA 1PPBH 1WSSH 1G36A 3LJJA 4B1TA 3STJA 1TGNA 1TABE 2ZHFH 1K1OA 2QBWA 3AW1A 3RXAA 4A1VA 2EEIA 1SGFG 3CS0A 2VH0A 4UEHH 1AN1E 1N6XA 1GBHA 1LCYA 4UONA 3ZZ8A 4GHQA 1SL3A 2DAZA 1NFXA 2M0UA 4KP0A 1HIAB 3BTTE 1NTPA 2FE5A 5T6FA 3W94A 1KXDA 1AZZA 1AY6H 4YOGA 1BMAA 2FM2A 1LHDH 2R0KA 1N6YA 2Z3CA 3JXTA 3RXQA 4KTUA 3UREA 3ZVBA 3LONA 3MH4A 2BLWA 2EXGA 3FVFB 3QDOA 4J2YB 4MNXA 1Z71A 1TBZH 1OP8A 4DIHH 3UR6A 1NFYA 3DT0H 3AVZA 3LGUA 3SHCH 1ZMNA 4E06H 2AMDA 1PPHE 1HFDA 3SNAA 1KEFA 4BTIB 2I04A 1ABJH 1AU8A 1QURH 1OBZA 2ODQA 1T8NA 5FAHA 1VB7A 1XUFA 1F2SE 1JRSA 1OWKA 1ZRBA 4RKOB 2XCFA 1VZQH 2GZVA 2CHAC 2V1WA 2QYIA 1FCFA 5HGGA 5EXNA 5AHGH 2FP7B 2A2XH 5DTHA 2WV5A 4JMYA 4YLQH 5H4IB 5A0CA 3SHWA 3SJIA 5EW1H 3PO1B 1NS3A 4ABHA 2QF3A 1HJAC 4HI3A 4Q7YA 3URCA 5HYOA 1CT2E 4I7YH 3ESTA 4OEOA 4RN6A 1PQ8A 1Y7NA 1UTOA 3F6UH 1QCPA 1S6HA 1SSXA 2P59A 2VWOA 4NMQA 3FP6E 3QO6A 3E16B 1C2MA 1HAVA 1MKXH 1ABIH 1SHYA 1FY1A 4NMTA 4NFFA 1FAKH 4DT7B 2VINA 1ELBA 5BRRE 1KY9A 1O3KA 2VIOA 4TWWA 4BANB 1DWEH 1ESTA 3A86A 1O3BA 1FC9A 2GT7A 4WVPE 3MNSA 5L6NH 3SU2A 3LKWA 1C9TA 1V2KT 4FUEA 3TSWA 1CSOE 1P2IA 2AH4X 1UTKA 4OS6A 2O8TA 2BX3A 3VXEH 1TNIA 3V12A 1C5NH 3RL8A 1NESE 2A7JA 3EE0B 2TBSA 1EZQA 1E38B 2FOMB 1IQEA 3HPMA 1O2RA 1XXFA 1XX9A 3PROA 3P8OA 4LK4A 1QJ6B 4FUIA 1UJVA 3MU4A 2FMJA 1O5BB 1A5HA 3SJ9A 2UUJB 1SI5H 1KDQB 3HK6B 4XBCA 2D92A 2PHBA 1X5RA 1SOTA 1Y5BT 3VQGA 4Y11E 3QDZB 1LQEA 5FXLA 2GT8A 1VCPA 3VPKA 5E0JA 1A3EH 2H9HA 1ZPBA 2KOHA 1Y3XA 1HXFH 3LJOA 3DJ3A 3PDZA 2ZPLA 1EP5A 2NU4E 2LA8A 3K2UA 3LGVA 2Q9VA 4KELA 3TGKE 2BYAX 1WJLA 3RU4D 5F3XA 3PB1E 3TK9A 1NRSH 1LHFH 1C4V2 2FIRH 3EQ0H 1AZ8A 1DS2E 3URDA 4BTUB 3U9AH 3F9EA 1SVPA 2STBE 2B5TB 2R3YA 2KOJA 4QT8C 2F9VA 2OLGA 5C3NA 1P9UA 5AFZH 2ALPA 3KQCA 2KYLA 4K8BA 3A85A 1HYLA 1GI7B 2R2WU 1P2OA 2OTVA 4K1SA 4DCDA 3B9FH 4M7GA 2RA3A 1GI6A 2TGDA 4ZUHA 2BDAA 1Z86A 2HPQH 3RU4T 4WWYA 1DSUA 2QY0B 3LGWA 2ZGBH 1VITH 4X6NA 2IOTA 2GCTB 4LOYH 1C4Y2 2KJPA 1BRAA 1MD7A 3HKIB 3RXUA 1O2MA 2CJIA 4BAMB 4AFQA 2G5VA 2A2QH 3ZZBA 2JETB 4D76A 1TMUH 4X1QU 3O46A 1ETRH 4ESTE 2XRCA 2ZHWH 2PA1A 1IOEA 5HM2A 1ZMJA 4Y6DA 3O8RA 2F9PA 4BAHB 1YBOA 1G32B 2XC0A 4DG4A 2O2TA 3EA7A 3ZVEA 2D90A 5DP3A 3MOCA 2Z9GA 1Z6EA 5T6DA 3PMJA 1P2KA 3U1IB 4L8NA 3QN7A 5CMXH 3TK5A 3LH3A 1TBQH 1T7CA 1WF7A 1XUJA 2BMGB 1C5XB 2BZAA 2FLBH 3E6PH 1L1GA 4HZHA 1SG8B 2VVVA 4X2XA 4DGJA 1GMHF 2XC4A 3RXFA 3JZ1B 2TGPZ 2UUKB 1O34A 4GLYA 1BFEA 1LTOA 3F9HA 2EGNA 1RTLA 1N7TA 2WL7A 1NROH 5EQSA 1HAIH 1ZSJA 1DWCH 4THNH 3TLOA 1BHXB 4ABAA 1GWAA 1K1JA 4H11A 1UTJA 3K1RA 3CBYA 1BMLA 1NC6A 1BIOA 2TRMA 4K3JA 4NSYA 4NA9H 4Y79A 2HE4A 1ZTLA 1BTPA 1F5RA 2HPPH 5IYTA 3FY5A 4BTTB 4AN7A 1B5GH 4AFSA 6CHAB 3P95A 1GG6B 4NFEA 1N8OB 1IQLA 5FB8C 1ZR0A 2HNTC 1NF3C 1HAOH 1GGDC 1VAEA 2OC7A 2Z7FE 4MNVA 1X6DA 1SLWB 4LXBH 1P2QA 1C5SA 1AFQB 1GBEA 2H6MA 1C5OH 2FYQA 2FWWA 1FAXA 2GCHF 3S0NA 1YGCH 1IAUA 2VWMA 2Y7ZA 1EPTB 1L1NA 2O9QA 3UIRA 1Z8IB 1M9UA 5EPNA 2YNBA 5EXMA 3PLPA 5DP7A 4CHAC 1B0FA 3P92A 5AFYH 1A2CH 3W95A 1TRYA 2L4TA 3BTWE 4FUDA 2BD7A 1GI1A 1K2I1 4E35A 1GBKA 1U37A 1TX7A 2XBXA 1WU1A 2OQUA 2TIOA 4NMVA 2OGPA 1O3CA 1ZPCA 4HTCH 2A0QB 4NZLA 4XHVA 1C1OA 1HAHH 4MPXA 2ANYA 1GBLA 2ZGCA 2F3CE 1DFPA 1UMAH 4UFFH 1O2OA 4X8SH 3GY7A 2C3SA 1AD8H 2PSYA 4E3BA 4CH8B 1ZUBA 3K65B 1O3AA 4FUFA 3UY9A 4YESB 2BM2A 3RLYH 1WG6A 1K9OE 2LC6A 3LU9B 1S81A 4K72A 1W0YH 3CP7A 3OYPA 3ITIA 1NFWA 4JYTA 1MAYA 2LNCA 1HJ9A 1NT1A 3MNBA 1NU7B 4Z0KA 2OBQA 4UDWH 2GVFA 3ATMA 5CHAB 1JWTA 5FBIA 5I7ZA 2QXIA 5JBBS 2VIPA 2H2BA 1CA8B 2D8WA 4YYXA 1O5EH 2Z9KA 1KLTA 1O3HA 4ZH8A 3ZRTA 1BTYA 2R0LA 3A8CA 1E0FD 6ESTA 4P0CA 5HXFA 5ESBA 1MU8B 2EEJA 2BX4A 2CHAB 2QCYA 1O2NA 2QKTA 1OWDA 3E0NB 1DWBH 2ZHQH 2K20A 1WHAA 2XBWA 3ZZ9A 1GMCG 2WUCA 2HALA 3T62A 2GDEH 2F91A 1S82A 5HDYA 3EYDA 1S85A 1N1LA 4CR5A 4ZXYH 5B6LA 1J16A 2GP9B 2FLRH 2YOLA 1DUEA 3OY5U 2WUBA 1IQHA 2VIDA 3HKJB 3R0FA 4CRDA 1UEZA 5DKMA 2ALVA 4F8KA 1SB1H 2DJTA 1ETSH 3KQEA 5B6OA 2OC0A 1P2JA 2WYGA 5G1EA 1GBFA 3TSZA 2EDPA 2STAE 1RIWC 1NTEA 3ATIA 4EDJA 2TPIZ 1MCTA 1ZGVA 1D3PB 3LDXH 3NZIA 3UQVA 2AINA 1K1IA 3A7YA 3SN8A 3A80A 4A7IB 4WH8A 1D4PB 8GCHF 5DJ7A 3VB5A 4HFPB 2ZDMA 1K1NA 5LGOA 4JOJA 2WV4A 3VB4A 2PDZA 2PGBB 1O31A 1WQVH 3GCNA 2P3FH 2A7HA 1P3EA 2H3MA 1AVXA 4K76A 1LKAA 2EDZA 4H6TA 1Z1IA 2ZG0H 4D9QA 3TJNA 2JIKA 3MH5A 2VH6A 2BZ6H 4H42U 5EODA 5T3HA 4FUGA 1TPSA 1YC0A 4DY7B 4NG9H 2DE8A 3TNTA 4ISLA 4A1TA 3A8DA 1ELFA 1UHBB 1WOFA 3BTGE 1GMHG 3D62A 3OY6U 1V2NT 4OS4A 1V2QT 1GJBB 2G5MB 3T5FH 4KGAA 2KPLA 1QGFA 3C27B 1C2IA 4GCHF 4FVDA 3RM2H 4JZDH 3TH3H 3SZNA 5HM9A 3ZVCA 3MU8A 3H7TA 1P3CA 1T4VH 3NUMA 4FUHA 2CGAA 1A4WH 1R6JA 1BTUA 4X2YA 1O2GH 2W7RA 2Q1JA 4NIXA 4CRAA 1C2EA 4CRBA 4PQWA 3M5OA 3P8GA 2QXJA 3R69A 2A45B 2BXUH 2AWXA 2ZHEH 1BT7A 1C4U2 1HPGA 4K1EA 1TYNA 1BMMH 1HLTH 1KXCA 1EATA 3SQHE 2F5YA 5HF4A 2J9NA 2A32A 1O2WA 4X2WA 3KF2A 4ISOA 3A84A 2BVRH 5HFBA 2FI4E 1HXEH 1NRRH 2LUIA 1O5DH 1FQ3A 1BBRK 1S6FA 1GDNA 4NGAH 1C1QA 1MTSA 4IMZA 3ZV8A 2BLOA 2JKHA 1WTGH 1Y3WA 1O2HA 2QA9E 4Q6SA 1W2KH 1AO5A 3ENSB 3DD2H 1DXWA 1HAXB 2CXVA 3MU0A 1WQSA 1RTKA 3V3MA 4A92A 2FX4A 3B23B 3PLKA 3MO9A 4BAKB 4GVCA 1U39A 1W3CA 1YPJH 1GHBF 2FOGA 3SU1A 2VIVA 1MTUA 1DLEA 3G01A 5L30H 1MBMA 3B76A 4YO9A 1HBTH 3ID4A 1TBRH 4UU6A 2BVXH 4FU9A 4AFUA 2JH5D 1A5IA 5A8XA 4KFWA 1YLCA 2Y5HA 3M7UA 1NRPH 2FOFA 2I6SA 1G30B 1V2JT 4D9RA 2QKVA 3A7TA 2IPHA 3MH7A 3RXEA 3V13A 1EAXA 4TY6A 5HJ1A 3RLWH 2CV3A 1QAVB 2RA0A 1HAVB 1O2VA 1V2TT 1C1NA 2YT8A 3T27A 5A2PA 3A83A 4UFGH 1BTWA 4NZQA 1EX3A 2VGCC 3D49H 1O3EA 1VJ6A 1CHOF 3MH6A 1NFUA 2BOHB 2XWAA 2KJKA 5DGJA 5I46H 1DY8A 1GJCB 1EASA 4MVNA 1P2MA 4Q2QA 3UR9A 8ESTE 1AWFH 1PDRA 1IHTH 2SGFE 1UITA 2OP9A 3WY8A 3SNEA 2OQ5A 5E2OA 2KL1A 2EEKA 1GHBG 4BNRA 2HRVA 1IHSH 3PS4A 4ASHA 3FAOA 2W4FA 1C1MA 1SGQE 3GYMA 2VIWA 4ZMAH 2BLQA 1MH0A 1L0ZA 2BQ6B 2V3HH 1X8SA 4XFQA 3VB7A 5DO4H 4ZKSU 1GL1A 1WH1A 1EAWA 3P70B 3KHVA 2ZDAH 3SU0A 1W12U 5HFDA 4ZKNU 4YT7H 1BJUA 3EGGC 2BD2A 1GQ4A 4MG3A 3I1EA 2VWLA 2C8XB 5F03A 1UTQA 3KGPA 2OQSA 2ZI2H 2X7ZA 4NMSA 2PKAA 4E34A 1O2YA 1YPEH 2A7CA 1V2UT 1ANCA 1YM0A 2V0BA 1ZJKA 1RIWB 2M0VA 4MNWA 1JIRA 3OTJE 2J94A 3ZVGA 2P94A 1UJDA 1C1RA 1C5VA 3QK1A 4DJZB 1O39A 1UEQA 1A0LA 1ZSLA 1O3NA 3L33A 1TWXB 3F68H 1P2NA 2A5KA 4E7RG 3GY3A 3ZZ6A 2CN0H 1MTNC 1GHAF 1ZRKA 1I92A 3PDVA 3MWIU 4OS5A 2YTWA 2PUQH 1CU1A 3U8RH 2UZCA 1TQ3A 2G4TA 1J14A 3V0XA 2PKTA 1V2MT 1KSNA 1LPKB 2B8OH 1QQUA 1TE0A 4MPWA 1QRXA 1OYTH 3A81A 1W8BH 1ZMLA 3ZVAA 1GBCA 3LH1A 1W9QA 1ELEE 2ZF0H 2ANWA 1V2ST 3TNSA 3NXPA 5FPYA 1XVOA 2OUAA 3RXDA 2SGDE 5G4BA 4B2AA 4IC6A 2PGQB 5HEDA 3UOPA 2HNTF 1TIOA 2DUCA 1ANEA 3PYHA 3QIKA 1TNGA 3DORA 1XKBC 1FDPA 1EAUA 1NN6A 1E34B 2ZEBA 1MKXK 4WMDA 1VITF 4N6XA 1F92A 4UE7H 1TGBA 1IU2A 1P12E 3QGNB 1ELDE 1FPHH 3GISB 2AWWA 3O8BA 1OPHB 5CHAC 4OS1A 3A7VA 1RD3B 2ZCKP 1WCZA 3DIWA 2EAQA 1GHAG 1ZOMA 3DFJA 3BTDE 1UVUH 2BTCE 2QC2A 1UO6A 4XOJA 4Z6AH 2OMJA 1D3DB 1O3FA 2HVXA 1LVOA 1EB2A 1VCQA 3M3VA 1UCYK 3UTUH 3GGEA 3ZV9A 5FPTA 3GCHC 1MZAA 3U98H 2GD4B 2KBSA 1J17T 1TA6A 2RDLA 3LC3A 5I25A 4JOGA 4VGCC 1D3TB 2LC7A 2EI7A 2KQFA 2M0ZA 1CGHA 2ANKH 3D23A 3SGQE 4CRFA 1H1BA 2OCSA 4Y8XA 2FDAA 3GY4A 3A8BA 1BUIA 4K8YA 2P8OB 2VB0A 1SGPE 2DE9A 2WPJS 4Q7ZA 3RXSA 5E21A 3FANA 2OXSA 1J8AA 3EGHC 2SGEE 5A2MH 3L4FD 3NK8A 2Y7XA 2FS8A 4CHAB 1BBRH 3FZZA 1O0DH 2G51A 1AVGH 3SU4A 2PKAB 5DG6A 2KG2A 1GQ5A 2KV8A 3SW2B 3E17A 5GCHF 2XBYA 1WUNH 4MDSA 1D3QB 1MMJN 2ZU3A 1GCTB 1SLUB 2THFB 2M0TA 2H3LA 1VCWA 1O2QA 1PQAA 4OAJA 4OS7A 4X1SU 3V7TA 4KFVA 1TRMA 1GHWH 1EPTA 6GCHF 3Q3KA 1DXPA 1BQYA 1OWIA 1FY4A 1QY6A 3MU5A 2ZDNA 3MNCA 3U8OH 1TGSZ 3E1XB 2V6NA 2AGGX 2SGQE 4YT6H 3PMBB 3VGCC 4Q80A 2Y6TA 4IGDA 1RRKA 1MKWK 2ZPRA 1C5QA 7KMEH 1AVWA 2SGAA 1NPMA 4HOPB 2B0FA 2KOMA 1GCTC 4D8NA 1GBAA 5FX6A 1DUAA 2IWOA 3ATWA 1AFEH 1EUFA 1BB0B 1OZIA 3SI4H 2LOBA 1GMDG 2A4GA 5A0BA 4DOQA 4YTAA 1O2PA 2W7SA 1GBTA 2IWQA 5JDUB 1E36B 1MZDA 5ESTE 3ID2A 1Y3VA 5DP6A 1TQ7B 1O5FH 3UNQA 2EI6A 1PQ7A 3VGCB 1ZHMA 1PJPA 1V2OT 1P02A 3BG4C 5F8ZA 1GBBA 4NA7A 1NRQH 1DITH 3GY6A 1FUJA 3SGAE 1HNEE 4WYTA 1V3XA 1HRTH 2EDVA 3GDVA 3MTYA 2WPMS 1HAGE 2KRGA 1BDAA 5LPFA 3LT3A 3A7WA 3RXBA 3BTQE 1ZLRA 3UNSA 4WY3A 5K7RA 4JCNA 2BQWB 1EXFA 3PWCA 1ELVA 2A5AA 2AWUA 3NGHA 1SR5C 3SQEE 2UWOA 1W0ZU 1TPPA 1CVWH 4NIYA 4A1XA 1TP3A 2AERH 5IDKA 3ELAH 4K78A 4AZ2B 1N7EA 2UUYA 1GVLA 1UHPA 2Y80A 4K5ZA 1Y3YA 1A7SA 5C5NA 2Y82A 1F0SA 1K21H 1GHYH 3ZZ4A 2BY8X 1O35A 3S7KB 2AS9A 2MHOA 1O3GA 4FGMA 1HJAB 3K82A 1A1RA 1CA0B 1FV9A 5TCCA 4RI0A 4NIVA 5T6GA 3RMMH 1C2LA 4VGCB 1GJ4H 5L2YH 1G3BA 1BITA 5HFFA 1IQNA 1LHCH 4WYUA 4IMQA 4TY7A 2VWNA 3RL7A 1G9IE 1C1WH 1SMFE 1S5SA 1QNJA 2I1NA 1SGIB 1GDQA 3GY8A 1GI4A 2ZIQH 4O06A 3HGNA 1IQGA 2Y81A 3ID1A 1Q3PA 1WTHD 2E7KA 4NCYA 1P09A 1C5UA 3Q76A 4WMEA 3RDZA 3D65E 2GCHG 2REYA 3RXJA 1TMBH 1MU6B 2BDCA 4F49A 1AI8H 1Y8TA 4ABIA 1PPGE 2ZZUH 4R0IA 2PZDA 2Q6DA 4GHTA 3T28A 1AE8H 1O5CB 1TX8A 2R9PA 2XWBI 4JYVH 1L1JA 3Q77A 1OXGA 1UFXA 2O8WA 3U69H 3QX5H 2DMZA 1W9OA 3QJNA 4YLUA 3SU5A 3OTPA 4LMMA 1GI2A 4MPAA 5EGMA 3DJ1A 3M5NA 1SGTA 3PTNA 9LPRA 1C1UH 3U1JB 3GYLB 2I6QA 4GVDA 1OP2A 3BEUA 1AMHA 5J4SA 2BLVA 1QL8A 2FZZA 1Z6JH 4IBLH 4BXWA 1TNHA 1O3LA 2JXOA 1JIMA 1SQAA 3GCOA 4Z8JA 1MFGA 1N6EA 3E3TA 1GI9B 2J4IA 3ZZAA 1L4ZA 1GGDB 1C1PA 1C5TA 1KDQA 1QRZA 1SC8U 1UEWA 1DSTA 4OS2A
chains in the Genus database with same CATH superfamily
1C2HA 1VJ9U 5F6MA 1QB9A 1MTWA 2FOEA 3ID3A 2FYRA 3UQOA 2OD3B 1A0HB 1FNIA 1LVYA 5JB9S 1FN8A 5C1XA 1FI8A 2KFWA 2A4QA 4H4FA 3UOUA 3LGTA 2CF9H 3BV9B 1GVZA 1J15A 3RXTA 1KXAA 3RXLA 1H8DH 4K60A 5SGAE 1PPFE 1JBUH 2MX6A 4R2ZA 5C67A 2HWLB 1RXPA 3SNDA 3RXGA 1GBIA 1YY3A 2KCAA 1U3BA 2ZFSA 1D6WA 5F53A 1EJNA 4ZROA 1BE9A 2BDIA 1QQ4A 1XUGA 3Q00A 4JOFA 5GCHG 3S9AA 4RT1A 1YPHC 1UM1A 1V1TA 1FLEE 4Q2NA 1L2EA 2EJYA 4I8KA 3R68A 2FTLE 1AKSB 2ZQ2A 4WJG2 1ELGA 1DVAH 4NNMA 4UU5A 2JILA 3TIUA 1TP5A 2PFEA 1MAXA 2HOBA 1AUJA 4O03A 3T2NA 5LPRA 4FUCA 1SGRE 3P6ZB 3A89A 2BDGA 3HGPA 4F4OC 1NZQH 2KJDA 1VGCC 2K1QA 5LPEA 1OBYA 1QL9A 4SGBE 1WDIA 2EGOA 2A4RA 2GX4A 5E6PB 2ULLA 5A09A 3RC6A 1H9HE 2P95A 2CSJA 3T26A 2VGCB 3UUZA 3GOVB 2VIQA 1OKXA 5C2ZA 1D6RA 1RY4A 1GJ6A 1LQDB 1UTLM 4X6OA 1BA8B 3IITA 2ZPMA 1XKAC 3UB0A 1UVTH 3KEEA 2CS5A 1MUEB 1GBJA 2EC9H 2F9UA 2F9OA 2FS9A 1QAUA 1B8QA 1ZTJA 3CYYA 1T8LA 2FODA 2ZDLA 1RJXB 4B76A 5EU8A 1HAPH 1LVBA 3BTKE 2P3UB 3M3SA 4Q2PA 2H1UA 1NBMD 7GCHG 1FY5A 1GJAB 1NRNH 4FVBA 2RRMA 1QTFA 1TNJA 2OS6A 3A7XA 2AGIX 2ZGJA 3QTVH 8GCHG 2G8TA 3HVQC 5EQRA 2XYAA 1O2LA 4X8VH 1A46H 2SFAA 1ESAA 2GV6A 1Z87A 2ZFPH 3RMNH 1E35B 1VR1H 1ZSKA 2H2ZA 4K69A 2AMQA 5HMAA 5ABWA 1YPLH 2GDDA 2J95A 4TPIZ 2AMPA 2M10A 1JMOH 1B7XB 1QA0A 2C8ZB 2O8LA 4ISNA 5DK1A 5JYIA 1QLCA 1FY3A 2JETC 1TMTH 4JK5A 2AFQB 1BZXE 1PQ5A 1FZZA 5CE1A 1HCGA 1HDTH 1K1PA 1CE5A 3PTBA 4NIWA 4Y8YA 1F0RA 5FBEA 1D9IA 1H8IH 2JOAA 1AFQC 2VU8E 4CRGA 4AG2A 2GV7A 4JOPA 2C8YB 2ZNKH 4CBOA 1FY8E 4INLA 1UVOA 4ZXXH 2GZ7A 1XUIA 3TJUA 2XW9A 2M5TA 4UFEH 2QGRA 4TYDA 3UWJH 4Y0YE 4MLFB 5EJ1A 1MQ6A 4KKDA 1W9EA 2AGEX 1QA7A 4GSOA 1TOCB 2ASUB 2PR3A 3E8LA 3SUDA 1V62A 4CREA 4BOHA 5AF9H 1MTNB 3K50A 1GHVH 4B2CA 4I32A 4CBNA 3SU3A 2W6ID 3MO6A 1DOJA 1A0JA 1OP0A 3AW0A 4DT4A 1G2MA 2D2DA 1YBWA 1ZTKA 3RXMA 3VQFA 4AORA 1KLJH 6CHAC 5JXBA 1DE7H 1O5GH 1P8VC 2BYGA 2O8UA 1IU0A 3OSYA 1V2LT 4B2BA 2J34A 1RFNA 1ANDA 1SGDE 3LPRA 2C8WB 1ANBA 2QF0A 2BY5X 2V7QD 2ZDVH 1AUTC 2ZGXH 1Q3OA 5B42A 4K1TA 3BEFB 3DA9B 2R4HA 4JORA 1CT0E 3UFAA 4XE4A 1C5YB 2ZCLP 1YYY1 5DSFA 4NMPA 5E11A 1FC6A 1F5LA 2BDHA 2PWXA 3F9FA 2WPIS 3RXOA 4ABFA 1GMDF 3NFLA 4JZ1A 5EW2H 2EA3A 5GLJA 1ORFA 1UTMA 1QIXB 2W26A 3QTOH 1ARCA 5FCRA 3I78A 2FI3E 2H9TH 4ISHH 1HAZB 1YKTA 1GCDA 1TPOA 4AOQA 2Q6GA 5GDSH 2Z9JA 1SQOA 1DX5M 2QXHA 3BG4B 1GI8B 1HJ8A 3SV6A 4U01A 3CH8A 1Z7KA 1SGEE 2VVCA 5JBTA 2PKSC 3MNXA 5F8XA 5FX5A 4MQAA 3EGKH 5E2PA 1MBQA 4JYUH 2OC1A 1YPHE 1C9PA 1WYKA 7ESTE 2ZCHP 2Z6BD 5E22A 5GJ4B 2A31A 4R8TB 3QE1A 4B74A 5EIYA 2A4OA 4OEPA 2ZFTA 1GJDB 5GXPA 3F2FA 3UPEA 2Z94A 3RMLH 3RXPA 4NWLA 2DB5A 4I33A 1P03A 4ZAEA 1QL7A 1S84A 1F7ZA 1TGCA 2YNAA 1XXDA 2GTBA 3B8JA 1O3IA 1V6DA 6LPRA 1EAIA 2OBOA 1UJ1A 1PYTD 2WPHS 3N7OA 4NMOA 4RKJB 5ETXA 4X6MA 1BJVA 2P3WA 1L4DA 3P8FA 3PRBA 3SNBA 1FONA 4FUJA 1C5LH 1OWEA 1YF4A 2ZTZA 1PPCE 2FEQH 4UFDH 4REYA 3MFJA 4X6PA 4Y0ZE 4YM9A 1C2GA 1EB1H 4G69A 2OINA 4P00A 1T8MA 1T2MA 1WXRA 3VG8A 3OEHD 1FC7A 4ZCNA 1MTVA 3QGLA 3GCHB 1M5ZA 1WAYB 2EGKA 1V2PT 3TJVA 1N99A 2EEHA 2JH6D 1IQKA 1NBME 3VEQB 3PV4A 3SUEA 1BRCE 4ZHAA 2ZA5A 3A8AA 2L97A 1BRBE 3SNCA 1QAVA 2KCOA 1C1TA 4J1YA 5JB8S 3DUXH 3E0PB 1AB9B 3R3GB 1G3EA 1ZOKA 1KXFA 2PSXA 1GJ7B 5DP8A 3CC0A 1UVSH 2VNTA 5DP5A 1P10A 4FU8A 3SV2H 5DP9A 7LPRA 1ZGIA 4AB9A 2W3IA 1S83A 2H2CA 2FPZA 2KPKA 1TNLA 3M7QA 3MO3A 3HK3B 1ARBA 1BTHH 1UTPA 4IS5A 3SV8A 1SFQB 5EG4A 4O9VA 2FX6A 3DHKH 1F0TA 1Z8RA 3ATLA 4TPYA 1V5QA 2WPLS 2J38A 3FP7E 5HF1A 2H5CA 4I8LA 1EPTC 2BDBA 2ZFRH 1V2WT 2HLDD 3FKSD 5C1YA 3PV2A 3SOEA 2SNVA 3SU6A 3I77A 3I4WA 1GJ8B 3EA8A 2ZFFH 1H9IE 3M35A 1S0RA 1EJMA 1TX6A 2GGVB 2DM8A 2XCNA 2OCVB 4BXSA 4HOPA 1LHEH 3EDXB 4TWYA 2PKUA 1GI5A 3QZRA 3P17H 2KCPA 1WI2A 1SGYE 3NKKA 1PFXC 4X8UH 4YZUA 3M5LA 3SHAH 2QIQA 3HATH 4JZFH 4MNYA 1SQTA 1BMFD 1O2XA 4JJ3A 1KTSB 3GY2A 3SJOA 1NY22 1KTTB 5LH8A 1W0KD 2JJ2D 2G4UA 1K1LA 2ODPA 3GCTG 1XMNB 4GVUA 1UF1A 4FXGH 4RSPA 4X1PU 2NU1E 3SUGA 1RTFB 3RP2A 3RU4E 3TH4H 1WI4A 1U38A 1T32A 2EEGA 5K0HA 3PV5A 1ELCA 3A88A 1MABB 3GICB 2IWPA 3BTHE 4I31A 3GSLA 1XUKA 4JOKA 1O33A 1O2IA 1G3DA 1OWHA 2FN5A 1KXBA 3N99A 3N7DA 5KEDA 1INCA 1O3DA 2KAIB 4MTBA 4OGXA 2HVYB 2ZPQA 2FCFA 1P06A 1ID5H 2GZ9A 1XZ9A 1DT2A 5FCKA 3LOXA 1YPMH 1CHOG 1O3MA 2BDYA 1AIXH 3VXFH 2J2UA 4FUBA 2CMYA 4A6LA 4INKA 1OS8A 1TOMH 2RDEA 5A8YA 3ZZ5A 1OYQA 1BHXF 1K32A 2HLCA 3DJAA 3HPTB 2ZDKA 3EA9A 2L6OA 1P57B 5CHBA 3TITA 1S0QA 1MQ5A 1K1MA 3OU0A 3GCTF 2F83A 2PV9B 4IW4E 1TA2A 1HUTH 1P11E 1YPKH 4D7FA 1P01A 2F9NA 1GVKB 2FOBA 4K75A 3H7OA 3R0HA 3RXRA 4XBDA 1PYTC 2HGAA 1K28D 2PKSB 5BPEA 3ZZCA 1G37A 1TQ0B 2Z3DA 2RCZA 1FXYA 2FOAA 1CGJE 3S9CA 2VVUA 2R2MB 2WYJA 3VB6A 2ZFQH 2ENOA 3C1KA 4ZKRU 1HIAA 1DPOA 2YUBA 1Q31A 3KZEA 1ZPZA 4WXIA 2Z17A 2VZ5A 3BTME 3VFEA 1RS0A 1C5PA 1UTNA 2A5IA 1AQ7A 1W13U 2A1DB 1GJ5H 4E05H 1A3BH 1SQRA 3S9BA 2XNIA 4AMHA 1YPGH 1J9CH 4LZ1H 2ZTXA 1CHGA 1UK3A 3AAVA 4WH6A 1BMNH 3KIDU 3PM3A 3PWBA 1PPZA 3TGJE 3SGBE 5TCAA 5JBCS 1T4UH 2OK5A 3KN2A 2BD8A 4BAQB 4IC5A 3NFKA 3TPIZ 2C90B 3KNXA 2WHXA 3NRLA 3A87A 1ZYOA 1O37A 1HB0B 1E1RD 4FU7A 1MCVA 3NPSA 1QJ1B 1GBMA 2Z3EA 3SJ8A 4JZEH 1DY9A 5GPIB 1QB1A 2QG1A 3LNYA 4NMRA 1CQQA 2G55A 3K9XB 3NWUA 4AG1A 1O2UA 3BPUA 3QLPH 2P93A 1AHTH 2KCYA 4NNLA 1GMCF 1SPJA 2BD5A 3OAAD 1WF8A 1IQIA 4X8TH 2UWLA 1OWJA 3ZVDA 3M3TA 4IN1A 3TH2H 4XDEA 1P05A 3UNRA 3SORA 1FPCH 3BTEE 2VSPA 2BY9X 1FN6A 3ZVFA 4DVAU 1X7AC 5GWZA 2DLSA 1QJ7B 4KTCA 2FOCA 1E37B 2KAIA 2P16A 1IQMA 1UM7A 1DM4B 4YOIA 5HFEA 1O3JA 1VGCB 1T8OA 2G00A 3CENA 1Q2WA 3MYWA 4K2YA 1K22H 1W11U 4XSKU 1LMWB 4NXPA 2JJ1D 4ZHLU 1QRWA 2V90A 4JOHA 2G5NA 1N8OC 1O30A 2WINI 1TNKA 3S7HB 2EI8A 1FIZA 4Y71A 1WV7H 2BXTH 2BY7X 1IHJA 4CR9A 3RLEA 2Y5FA 2QE7D 2KA9A 3SUZA 3H5CB 3NCLA 1GJ9B 2IPQX 3GDUA 1EOLA 3LNXA 3LC5A 1UVPA 4NXQA 1JOUB 5DPAA 4AGJA 2J92A 3HPKA 1C2FA 1DICA 4X1RU 4DURA 1DDJA 4AB8A 4AYYB 5H3JA 4NA8A 1PPEE 2NU3E 2Q6FA 3MU1A 4WMFA 1BTXA 2ZPSA 4U30A 1LPZB 1MD8A 1JXPA 2AIQA 4U32A 2D26C 2ZO3H 5EZ0A 1TGTA 2I4SA 3ZYEA 2QN5T 1AWHB 1ZJDA 4JL7A 4GCHG 4I8GA 3WW7A 1VJAU 3E91A 1Z8GA 1G9OA 1E79D 2AYWA 3ATKA 3KYGA 5EOKA 1HGTH 4AX9H 4X2VA 3AASA 1IQJA 1C1VH 4I86A 5HIYA 1QFKH 2M3MA 2FOHA 1CBWB 2DC2A 1TB6H 4Y10E 1G2LA 3U8TH 3QZQA 4P2AB 4AGKA 2WPKS 2GCTC 4ZHMU 4B75A 4YOJA 4B73A 2W3KA 3Q3YA 5PTPA 4UD9H 1GI0A 2KAWA 2W5EA 1TPAE 5EQQA 2GKVE 1EJAA 3PLBA 3UWIA 5E1YA 1HAYB 1F5KU 1C2KA 1X45A 2OPGA 2W7UA 2QXGA 2K1ZA 1O2KA 4Y76A 2XC5A 2Z9LA 4Y7BA 1CT4E 2ANMH 1Q3XA 2ZKSA 3BEIB 2ZWLH 3FP8E 3O8CA 2G81E 3SO3A 1BTZA 2KX4A 1TAWA 1O3OA 1P9SA 4U2WA 2XTTB 1QB6A 3RMOH 3RXIA 2VRFA 5G1DA 5HEBA 4NWKA 3S69A 5AVDA 1AB9C 1KYNA 2QT5A 1SHHB 1UCYE 1V2RT 8KME2 3LGYA 2ZECA 3KQBA 2FO9A 2XBVA 4AYVB 2BVSH 3PO1C 2PTNA 1DANH 2HGTH 2RG3A 3IWMA 1O2TA 3STIA 5A8ZA 1UEPA 4CRCA 1KIGH 1O2JA 2CSSA 2D1JA 3ODDA 1GHZA 4ZKOU 1F0UA 1XM1A 2BD3A 8LPRA 3SOSA 4DIIH 1W10U 1Y59T 2I0IA 1EQ9A 2Z9IA 2AEIH 2I6VA 2NU0E 1BBRE 3VB3A 1SKYE 3O5NA 4ABBA 1IQFA 1TLDA 2NU2E 2G2LA 3TGIE 3MHWU 2JH0D 1UJUA 5HFCA 1THSH 1GG6C 3BG8A 5JBAS 2ZGHA 2ZHDA 2VSVA 1MKWH 5E0HA 2PNTA 3L6PA 4MPVA 2H5DA 1V2VT 1A5GH 2GEFA 2TGAA 2TGTA 4CH2B 3A82A 3CBZA 2QF4A 1P04A 1DWDH 4YDPA 4MPUA 1VITG 5FL7D 4A5TS 1QBNA 4XBBA 1LO6A 1YCPM 1WHDA 2OZFA 3DFLA 3SJKA 3K6YA 2IJOB 4TSFD 1YCPH 4Z33A 1SGCA 3Q3XA 1KXEA 1SLXB 2O8MA 3QWCH 2ZC9H 5C5OA 3T29A 4ABJA 2L4SA 1LPGB 2KZ4A 1C1SA 3M7TA 2BOKA 2SNWA 4X1NU 4HG6A 2PW8H 1C5RA 3CS7A 2YT7A 4Q4LA 5E0GA 5FHTA 2JINA 1TRNA 4KTSA 4F55A 5C1UA 1AE5A 4Y8ZA 1GPZA 2DKRA 1GHXH 4O3TA 1W14U 2YUYA 2C93B 1TONA 1WFGA 2HE2A 1O36A 2Y5GA 3ZYDA 2ZTYA 2VPHA 4B71A 2FESH 3PMHB 2GZ8A 3LGIA 1GI3A 2BD4A 1AKSA 3RXCA 4Z1MD 7GCHF 1SBWA 4P02A 4ABEA 1NM6A 1N7FA 3BN9A 2VJ1A 2LPRA 1O2ZA 5EJZA 1CO7E 2ZP0H 4XD7D 1O5AB 1ELAA 2P3TB 1XVMA 2V3OH 1EOJA 3RC5A 2NWNA 3ZIAD 1TFXA 3L3TA 1V5LA 1H4WA 3BSQA 4GAWA 5FPSA 2FTMA 1N6FA 2EV8A 2QV1A 1W7GH 3LIWA 1Y5UT 1Z1JA 4TT3D 1W7XH 1Z8JB 4Q6HA 2AIPA 3KZDA 3RM0H 1A61H 1TALA 5EYZA 4INHA 4BAOB 3OX7U 3M61U 1SOZA 3RXKA 3SV9A 4WF8A 5GNDA 3SYJA 1UK2A 1ACBE 1XUHA 3M5MA 3BIVH 1EZSC 5EXLA 1C2DA 3FZDA 1LVMA 1QBOA 5F67A 4Q3HA 1C5MD 2ILNA 3M36A 1MFLA 4I8JA 1GDUA 1OSSA 4OGYA 1Y3UA 2UWPA 4ABGA 1ZHRA 3JZ2B 1SGFA 5A0AE 2FNEA 2BY6X 4JZIA 3FFGA 3I29A 5GIBA 4AFZA 2OC8A 3GJ9A 1ESBA 3ZZDA 5DN6D 1CGIE 4IN2A 1EKBB 3SHUA 3TU7H 4PROA 1FIWA 2HNTE 4I8HA 3SI3H 5TJXA 5HETA 2IN2A 1QHRB 2ESTE 5HEYA 1QR3E 2F9BH 1EZXC 3TMHA 1H9LB 3IG6B 1CBWC 3TJOA 1T31A 1YP9A 3PMAB 2B7DH 2FI5E 1LKBA 1CA0C 3KL6A 5DP4A 4SGAE 1FJSA 1LHGH 1Y5AT 1MC7A 4Q7XA 3WKMA 3BIUH 2H9EH 4DW2U 4X0WU 1KWAA 1AGJA 1SFIA 1EP6A 2DLUA 1ZZZA 1D5GA 1RGRA 1VA8A 4HGCA 5E8EH 3MMGA 3T25A 4LZ4B 2LP6A 2FXRA 1P0SH 1THRH 3ODFA 1O32A 1V6BA 3RXVA 1ELTA 2JWEA 1FMGA 3KHFA 1QBVH 1X5QA 1WBGB 4GPGA 1O2SA 1BOQA 2UUFB 2D8IA 1P1EA 2RCEA 2QKUA 1L6OA 2QF5A 3QGJA 2R3UA 1NO9H 1SLVB 3QJMA 1BCUH 4YXWD 3F1SB 3SFJA 1JRTA 5C20A 3SV7A 3E90B 2BHGA 2P8OC 2GMTC 4RT0A 4GUXA 3TK6A 5J4QA 2VWRA 3QUMP 3TSVA 2ODYB 3TVJB 2I0LA 1N6DA 5L2ZH 1BRUP 2B9LA 3AXAA 2WZQA 2JREA 3M37A 2PTCE 1GM1A 1UCYH 1YLDA 3A7ZA 4O3UA 1C5ZB 5EPYA 3RC4A 3SBKA 4JK6A 2EHRA 1SGNE 3I18A 4NSVA 1DLKB 3ZZ3A 4WXVA 1RGQA 1P1DA 3EAJA 4Q2KA 1WIFA 2ZU5A 3BF6H 3GDSA 4ABDA 2C4FH 5F8TA 2CF8H 2PUXB 1YCPK 4GHNA 3GY5A 2QAAA 1UK4A 1B0EA 3F9GA 4Y7AA 1C5WB 3SUFA 1THPB 2J98A 2ZU1A 1OOKB 1WFVA 4Q2OA 2GMTB 1X5NA 2ZU2A 1O3PB 1OX1A 5D13A 2XXLA 3AAUA 4H6SB 2OSGA 1KLIH 1NU9A 3BTFE 1C2JA 1LDTT 2BQ7B 2F0AA 3WKLA 1GL0E 1GBDA 4ISIH 1UHBA 1OBXA 4D7GA 6GCHG 3CBXA 2V35A 1ZHPA 3RXHA 1G3CA 2PLXA 2BB4A 3RUOA 3KQDA 1RGWA 2G52A 4O97A 5JPMH 3KCGH 4E7NA 4NXRA 1RZXA 1EZUC 2Q3GA 1I16A 2SGPE 2BD9A 3K6ZA 9ESTA 1HV7A 1U6QA 2IWNA 1Q7XA 4K6YA 2W6JD 3P8NA 3MI4A 1ETTH 3ZZ7A 3O8DA 1O38A 2ZU4A 3H09A 2ZQ1A 4JOEA 1PPBH 1W0JD 1WSSH 1G36A 3LJJA 4B1TA 1TGNA 3STJA 1TABE 2ZHFH 1K1OA 2QBWA 3AW1A 3RXAA 5C0TA 4A1VA 2EEIA 1SGFG 5HKKD 3CS0A 2VH0A 4UEHH 1AN1E 1N6XA 1GBHA 1LCYA 4UONA 3ZZ8A 4GHQA 1SL3A 5C94A 2DAZA 1NFXA 2M0UA 4KP0A 1HIAB 3BTTE 1NTPA 2FE5A 5T6FA 3W94A 1KXDA 1AZZA 1AY6H 4YOGA 1BMAA 2FM2A 1LHDH 2R0KA 1N6YA 2Z3CA 3JXTA 3RXQA 4KTUA 3UREA 3ZVBA 3LONA 3MH4A 2BLWA 2EXGA 3FVFB 3QDOA 4J2YB 5EJLA 4MNXA 1Z71A 1TBZH 1OP8A 4DIHH 3UR6A 1NFYA 3DT0H 3AVZA 3LGUA 3SHCH 1ZMNA 4E06H 2AMDA 1PPHE 1HFDA 3SNAA 1KEFA 4BTIB 2I04A 1ABJH 1AU8A 1QURH 1OBZA 2ODQA 2YMSC 1T8NA 5FAHA 1VB7A 1XUFA 1F2SE 1JRSA 1OWKA 1ZRBA 4RKOB 2XCFA 1VZQH 2GZVA 2CHAC 2V1WA 2QYIA 1FCFA 5HGGA 5EXNA 5AHGH 2FP7B 2A2XH 5DTHA 2WV5A 5IK2D 4JMYA 4YLQH 5H4IB 5A0CA 3SHWA 3SJIA 5EW1H 4B6FA 3PO1B 1NS3A 4ABHA 2QF3A 1HJAC 4HI3A 4Q7YA 3URCA 5HYOA 1CT2E 4I7YH 3ESTA 4OEOA 4RN6A 1PQ8A 1Y7NA 1UTOA 3F6UH 1QCPA 1S6HA 1SSXA 2P59A 2VWOA 4NMQA 3FP6E 3QO6A 3E16B 1C2MA 1HAVA 1MKXH 1ABIH 1SHYA 1FY1A 4NMTA 4NFFA 1FAKH 4DT7B 2VINA 1ELBA 4B6EA 5BRRE 1KY9A 3WWBA 1O3KA 2WPDD 2VIOA 4TWWA 4BANB 1DWEH 1ESTA 3A86A 1O3BA 1FC9A 2GT7A 4WVPE 3MNSA 5L6NH 3SU2A 3LKWA 1C9TA 1V2KT 4FUEA 3TSWA 1CSOE 1P2IA 2AH4X 1UTKA 4OS6A 4OM9A 2O8TA 2BX3A 3VXEH 1TNIA 3V12A 1C5NH 3RL8A 1NESE 2A7JA 3EE0B 2TBSA 1EZQA 1E38B 2FOMB 1IQEA 3HPMA 1O2RA 1XXFA 3OEED 1XX9A 3DSOA 3PROA 3P8OA 4LK4A 1QJ6B 4FUIA 1UJVA 3MU4A 2FMJA 1O5BB 1A5HA 3SJ9A 2UUJB 1SI5H 1KDQB 3HK6B 4XBCA 1X9ZA 2D92A 2PHBA 1X5RA 1SOTA 1Y5BT 3VQGA 4Y11E 3QDZB 1LQEA 5FXLA 3KYFA 2GT8A 1VCPA 3VPKA 5E0JA 1A3EH 2H9HA 1ZPBA 2KOHA 1Y3XA 1HXFH 3LJOA 3DJ3A 3PDZA 2ZPLA 1EP5A 2NU4E 2LA8A 3K2UA 3LGVA 2Q9VA 4KELA 3TGKE 2BYAX 1WJLA 3RU4D 5F3XA 3PB1E 3TK9A 1NRSH 1LHFH 1C4V2 4AC9A 2FIRH 3EQ0H 1AZ8A 1DS2E 3URDA 4BTUB 3U9AH 3F9EA 1SVPA 2STBE 2B5TB 2R3YA 2KOJA 4QT8C 2F9VA 1QZ8A 2RFKC 2OLGA 3CNRA 5C3NA 1P9UA 5AFZH 2ALPA 3KQCA 2KYLA 4K8BA 3A85A 1HYLA 1GI7B 2R2WU 1P2OA 4ACAA 2OTVA 4K1SA 4DCDA 3B9FH 4M7GA 2RA3A 1GI6A 2TGDA 4ZUHA 2BDAA 1Z86A 2HPQH 3RU4T 4WWYA 1DSUA 2QY0B 3LGWA 2ZGBH 1VITH 4X6NA 2IOTA 2GCTB 5ILBA 2K0QA 3GS9A 4LOYH 1C4Y2 2KJPA 1BRAA 1MD7A 3HKIB 3RXUA 1O2MA 2K8IA 2CJIA 4BAMB 4AFQA 2G5VA 2A2QH 3ZZBA 2JETB 4D76A 1TMUH 5CDFE 4X1QU 3O46A 1ETRH 4ESTE 1KMHB 2XRCA 2ZHWH 2PA1A 1IOEA 5HM2A 1ZMJA 4Y6DA 3O8RA 2F9PA 4BAHB 1YBOA 1G32B 2XC0A 4DG4A 2O2TA 3EA7A 3ZVEA 2D90A 5DP3A 3MOCA 2Z9GA 1Z6EA 5T6DA 3PMJA 1P2KA 3U1IB 4L8NA 3QN7A 5CMXH 3KDKA 1EFRD 3TK5A 4F48B 3LH3A 1TBQH 1T7CA 1WF7A 1XUJA 2BMGB 1C5XB 2BZAA 2FLBH 3E6PH 1L1GA 4HZHA 1SG8B 2VVVA 4X2XA 4DGJA 1GMHF 2J97A 2XC4A 3RXFA 2IJD1 2TGPZ 2UUKB 3JZ1B 1O34A 4GLYA 1BFEA 1LTOA 3F9HA 2EGNA 1RTLA 1N7TA 2WL7A 1NROH 5EQSA 1HAIH 1ZSJA 1DWCH 4THNH 3TLOA 1BHXB 4ABAA 1GWAA 1K1JA 4H11A 1UTJA 3K1RA 3CBYA 1BMLA 1NC6A 1BIOA 2TRMA 4K3JA 4NSYA 4NA9H 4Y79A 2HE4A 1ZTLA 1BTPA 1F5RA 2HPPH 5IYTA 3FY5A 4BTTB 4AN7A 1B5GH 4AFSA 6CHAB 3P95A 1GG6B 2PP6A 4NFEA 1N8OB 1IQLA 5FB8C 1ZR0A 2HNTC 3EE7A 1NF3C 1HAOH 4FETA 1GGDC 1VAEA 2OC7A 2Z7FE 4MNVA 1X6DA 1SLWB 4LXBH 3W1EA 1P2QA 1C5SA 1AFQB 1VKYA 1GBEA 2H6MA 1C5OH 2FYQA 2FWWA 1FAXA 2GCHF 3S0NA 1YGCH 1IAUA 2VWMA 2Y7ZA 1COWD 1EPTB 1L1NA 2O9QA 3UIRA 1Z8IB 1M9UA 5EPNA 2YNBA 5EXMA 2CK3D 3PLPA 5DP7A 4CHAC 1B0FA 3P92A 5AFYH 1A2CH 3W95A 2L74A 2AHME 1TRYA 2L4TA 3BTWE 4FUDA 2BD7A 1GI1A 1K2I1 4E35A 1GBKA 1U37A 1TX7A 2XBXA 1WU1A 2OQUA 2TIOA 4NMVA 2XNDD 2OGPA 1O3CA 1ZPCA 4HTCH 3PRDA 2A0QB 4NZLA 4XHVA 1C1OA 1HAHH 4MPXA 2ANYA 1GBLA 2ZGCA 2F3CE 1DFPA 1UMAH 4UFFH 1O2OA 4X8SH 3GY7A 2C3SA 1AD8H 2JIZD 2PSYA 4E3BA 4CH8B 1ZUBA 3K65B 1O3AA 4FUFA 3UY9A 4YESB 2BM2A 3RLYH 1WG6A 1K9OE 2LC6A 3LU9B 1S81A 4K72A 1W0YH 3CP7A 3OYPA 3ITIA 1NFWA 4JYTA 1MAYA 2LNCA 1HJ9A 1NT1A 3MNBA 1NU7B 4Z0KA 2OBQA 4UDWH 2GVFA 3ATMA 5CHAB 1JWTA 5FBIA 5I7ZA 2QXIA 5JBBS 2VIPA 2H2BA 1CA8B 2D8WA 4YYXA 1O5EH 2Z9KA 3F3BA 1KLTA 1O3HA 4ZH8A 3ZRTA 3FOAA 3DSGA 1BTYA 2R0LA 3A8CA 1E0FD 6ESTA 4P0CA 5HXFA 5ESBA 1MU8B 2EEJA 2BX4A 2CHAB 2QCYA 1O2NA 2QKTA 1OWDA 3E0NB 1DWBH 2ZHQH 2K20A 5KGOA 1WHAA 2XBWA 3ZZ9A 1GMCG 2WUCA 2HALA 3T62A 2GDEH 3F0OA 3AK5A 2F91A 1S82A 5HDYA 3EYDA 1S85A 1N1LA 4CR5A 4ZXYH 5B6LA 1J16A 2GP9B 2FLRH 2YOLA 1DUEA 3OY5U 2WUBA 1IQHA 2VIDA 3HKJB 3R0FA 4CRDA 1UEZA 5DKMA 2ALVA 4F8KA 1SB1H 2DJTA 1ETSH 3KQEA 5B6OA 1YLNA 2OC0A 1P2JA 2WYGA 5G1EA 1GBFA 3TSZA 2EDPA 2STAE 1RIWC 1NTEA 3ATIA 4EDJA 2TPIZ 1MCTA 1ZGVA 1D3PB 3LDXH 3NZIA 3UQVA 2AINA 1K1IA 3A7YA 3SN8A 3A80A 4A7IB 4WH8A 2V3MA 1D4PB 8GCHF 5DJ7A 3VB5A 4HFPB 2ZDMA 1K1NA 5LGOA 4JOJA 2WV4A 3VB4A 2PDZA 1OHHD 2PGBB 1O31A 1WQVH 3GCNA 2P3FH 2A7HA 1P3EA 2H3MA 1AVXA 4K76A 1LKAA 2EDZA 4H6TA 1Z1IA 2ZG0H 4D9QA 3TJNA 2JIKA 3MH5A 2VH6A 2BZ6H 4H42U 5EODA 5T3HA 3FN8A 4FUGA 1TPSA 1YC0A 2KM0A 4DY7B 4NG9H 2DE8A 3TNTA 4ISLA 4A1TA 3A8DA 1ELFA 2J5UA 1UHBB 1WOFA 3BTGE 1GMHG 3D62A 1E1QD 3OY6U 1V2NT 4OS4A 1V2QT 1GJBB 2G5MB 1H8ED 3T5FH 4KGAA 3MQKC 2KPLA 1QGFA 3C27B 3SZEA 1C2IA 4GCHF 4FVDA 3RM2H 4JZDH 3TH3H 3SZNA 5HM9A 3ZVCA 3MU8A 3H7TA 1P3CA 1T4VH 3NUMA 4FUHA 2CGAA 1A4WH 1R6JA 1BTUA 4X2YA 2XOKD 4Q63A 1O2GH 2W7RA 2Q1JA 4NIXA 4CRAA 1C2EA 4CRBA 4PQWA 3M5OA 3P8GA 2QXJA 3R69A 2A45B 2BXUH 2AWXA 2ZHEH 1BT7A 1C4U2 1HPGA 4K1EA 1TYNA 1BMMH 1HLTH 1KXCA 1EATA 3SQHE 2F5YA 5HF4A 2J9NA 2A32A 1O2WA 4X2WA 2GJGA 3KF2A 4ISOA 3A84A 2BVRH 5HFBA 4JJ0A 2FI4E 1HXEH 1NRRH 2LUIA 1O5DH 1FQ3A 1BBRK 1S6FA 1GDNA 4NGAH 1C1QA 1MTSA 4IMZA 3ZV8A 2BLOA 2JKHA 1WTGH 1Y3WA 1O2HA 2QA9E 4Q6SA 1W2KH 1AO5A 3ENSB 3DD2H 1DXWA 1HAXB 2CXVA 3MU0A 1WQSA 1RTKA 3V3MA 4A92A 2EQNA 2FX4A 3B23B 3PLKA 3MO9A 4BAKB 4GVCA 1U39A 1W3CA 1YPJH 1GHBF 2FOGA 3SU1A 2VIVA 1MTUA 1DLEA 3G01A 5L30H 1MBMA 3B76A 4YO9A 1HBTH 2WSSD 3ID4A 1TBRH 4UU6A 2BVXH 4FU9A 4AFUA 2JH5D 1A5IA 5A8XA 4KFWA 1YLCA 2Y5HA 3M7UA 1NRPH 2FOFA 2I6SA 1G30B 2F4LA 1V2JT 4D9RA 2QKVA 3A7TA 4XRNA 2IPHA 3MH7A 3RXEA 3V13A 1EAXA 4TY6A 5HJ1A 3U28C 3RLWH 2CV3A 3F2GA 1QAVB 2RA0A 4ASUD 1HAVB 1O2VA 1V2TT 1C1NA 2YT8A 3T27A 5A2PA 3A83A 4UFGH 1BTWA 4NZQA 1EX3A 2VGCC 3D49H 1O3EA 1VJ6A 1CHOF 3MH6A 1NFUA 2BOHB 2XWAA 2KJKA 5DGJA 5I46H 2LELA 1DY8A 1GJCB 1EASA 4MVNA 1P2MA 4Q2QA 3UR9A 8ESTE 1AWFH 1PDRA 1IHTH 2JSNA 2SGFE 1UITA 2OP9A 3WY8A 3SNEA 2OQ5A 5E2OA 2KL1A 2EEKA 1GHBG 4BNRA 2HRVA 1IHSH 3PS4A 4ASHA 3FAOA 2W4FA 1C1MA 1SGQE 3GYMA 2VIWA 4ZMAH 2BLQA 1MH0A 1L0ZA 2BQ6B 2V3HH 1X8SA 4XFQA 3VB7A 5DO4H 4ZKSU 1GL1A 1WH1A 1UW7A 1EAWA 3P70B 3KHVA 2ZDAH 3SU0A 1W12U 5HFDA 4ZKNU 4YT7H 1BJUA 3EGGC 2BD2A 1GQ4A 4MG3A 3I1EA 2VWLA 2C8XB 5F03A 1UTQA 3KGPA 5KECA 2OQSA 2ZI2H 2X7ZA 4NMSA 2PKAA 4E34A 1O2YA 1YPEH 2A7CA 1V2UT 1ANCA 1YM0A 2V0BA 1ZJKA 1RIWB 2M0VA 4MNWA 1JIRA 3OTJE 2J94A 3KDGA 3ZVGA 2P94A 1UJDA 1C1RA 1C5VA 3QK1A 4DJZB 1O39A 2J98B 1UEQA 1A0LA 1ZSLA 1O3NA 3L33A 1FX0B 1TWXB 3F68H 5C17A 1P2NA 2A5KA 4E7RG 3GY3A 3ZZ6A 2CN0H 1MTNC 1GHAF 1ZRKA 1I92A 3PDVA 3MWIU 4OS5A 2YTWA 2PUQH 1CU1A 3U8RH 2UZCA 1TQ3A 2G4TA 1J14A 3N7EA 3V0XA 2PKTA 1V2MT 1KSNA 1LPKB 2B8OH 1QQUA 1TE0A 4MPWA 1QRXA 1OYTH 3F0PA 3A81A 1W8BH 3WWFA 1ZMLA 3ZVAA 1GBCA 3LH1A 1W9QA 1ELEE 2ZF0H 2ANWA 1V2ST 3TNSA 3NXPA 5FPYA 1XVOA 2OUAA 3RXDA 2SGDE 5G4BA 4B2AA 4IC6A 2PGQB 5HEDA 3UOPA 2YMSB 2HNTF 1TIOA 2DUCA 1ANEA 3PYHA 3QIKA 1TNGA 3DORA 1XKBC 1FDPA 1EAUA 1NN6A 1E34B 2ZEBA 1MKXK 4WMDA 1VITF 4N6XA 1F92A 4UE7H 1TGBA 1IU2A 1P12E 3QGNB 2KR7A 3FO8D 1ELDE 1FPHH 3GISB 2AWWA 3O8BA 1OPHB 5CHAC 4OS1A 3A7VA 1RD3B 2ZCKP 1WCZA 3DIWA 2EAQA 1GHAG 1ZOMA 4M9FA 3DFJA 3BTDE 1UVUH 2BTCE 2QC2A 1UO6A 4XOJA 4Z6AH 2OMJA 1D3DB 1O3FA 2HVXA 1LVOA 1EB2A 1VCQA 3M3VA 1UCYK 3UTUH 3GGEA 3ZV9A 5FPTA 3GCHC 1MZAA 3UAIC 3U98H 2GD4B 2KBSA 1J17T 1TA6A 2RDLA 3LC3A 5I25A 4JOGA 4VGCC 1D3TB 2LC7A 2EI7A 2KQFA 2M0ZA 1CGHA 2ANKH 3D23A 3SGQE 4CRFA 1H1BA 2OCSA 4Y8XA 2FDAA 3GY4A 3A8BA 1BUIA 4K8YA 2P8OB 2VB0A 1SGPE 2DE9A 2WPJS 4Q7ZA 3RXSA 4ACBA 5E21A 3FANA 2OXSA 2JDID 2VBCA 1J8AA 3EGHC 2SGEE 5A2MH 3L4FD 3NK8A 2Y7XA 2FS8A 4CHAB 1BBRH 3FZZA 1O0DH 2G51A 1AVGH 3SU4A 2PKAB 5DG6A 2KG2A 1GQ5A 2KV8A 3OFND 3E17A 3SW2B 5GCHF 2XBYA 1WUNH 4MDSA 1D3QB 1MMJN 2ZU3A 1GCTB 2M2AA 1SLUB 2THFB 2M0TA 2H3LA 1VCWA 1O2QA 1PQAA 4OAJA 4OS7A 4X1SU 3V7TA 4KFVA 1TRMA 1GHWH 1EPTA 6GCHF 3Q3KA 1DXPA 1BQYA 1OWIA 1FY4A 1QY6A 3MU5A 2ZDNA 3MNCA 3U8OH 1TGSZ 3E1XB 2V6NA 2AGGX 2SGQE 4YT6H 3PMBB 3VGCC 4Q80A 2Y6TA 4IGDA 1RRKA 1MKWK 2ZPRA 1YWUA 1C5QA 7KMEH 1AVWA 2SGAA 1NPMA 4HOPB 2B0FA 2KOMA 1GCTC 4D8NA 1GBAA 5FX6A 1DUAA 2IWOA 3ATWA 1AFEH 1EUFA 1BB0B 1OZIA 3SI4H 2LOBA 1GMDG 2A4GA 5A0BA 4DOQA 4YTAA 1O2PA 2W7SA 1GBTA 2IWQA 5JDUB 1E36B 1MZDA 5ESTE 3ID2A 1Y3VA 5DP6A 1TQ7B 1O5FH 3DCLA 2EI6A 1PQ7A 3UNQA 1ZHMA 1PJPA 3VGCB 1V2OT 1P02A 3BG4C 5F8ZA 1GBBA 4FOUC 4NA7A 1NRQH 1DITH 3GY6A 1FUJA 3SGAE 1HNEE 4WYTA 1V3XA 5T1VA 1HRTH 2EDVA 3GDVA 3MTYA 2F43B 2WPMS 1HAGE 2KRGA 1BDAA 1S6LA 3KQ5A 5LPFA 3LT3A 3A7WA 3RXBA 3BTQE 1ZLRA 3UNSA 4WY3A 5K7RA 4JCNA 2BQWB 1EXFA 3PWCA 1ELVA 2A5AA 2AWUA 3NGHA 1SR5C 3SQEE 2UWOA 1W0ZU 1TPPA 1CVWH 4NIYA 4A1XA 1TP3A 2AERH 5IDKA 3ELAH 4K78A 4AZ2B 1N7EA 1H8HD 1GVLA 1UHPA 2UUYA 2Y80A 4K5ZA 1Y3YA 1A7SA 5C5NA 2Y82A 1F0SA 1K21H 1GHYH 3ZZ4A 2BY8X 2WV9A 1O35A 3S7KB 2AS9A 2MHOA 1O3GA 4FGMA 1HJAB 3K82A 1A1RA 1CA0B 1FV9A 5TCCA 4RI0A 3OE7D 4NIVA 5T6GA 3RMMH 1C2LA 4VGCB 1GJ4H 5L2YH 1G3BA 1BITA 5HFFA 1IQNA 1LHCH 4WYUA 4IMQA 4TY7A 2VWNA 3F2HA 3RL7A 1G9IE 1C1WH 1SMFE 1S5SA 4FLNA 1QNJA 2I1NA 1SGIB 1GDQA 3GY8A 1GI4A 2ZIQH 4O06A 3HGNA 1IQGA 2Y81A 3ID1A 1Q3PA 1WTHD 2E7KA 4NCYA 1P09A 1C5UA 3Q76A 4WMEA 3RDZA 3D65E 2GCHG 3NCVA 2REYA 3RXJA 1TMBH 1MU6B 2BDCA 4F49A 1K0HA 1AI8H 1Y8TA 4ABIA 1PPGE 2ZZUH 4R0IA 2PZDA 2Q6DA 4GHTA 3T28A 1AE8H 1O5CB 1TX8A 2R9PA 2YMSD 2XWBI 4JYVH 1L1JA 3Q77A 5IL9A 1OXGA 1UFXA 2O8WA 3U69H 5HIZA 3GABA 3QX5H 2DMZA 1W9OA 3QJNA 4YLUA 3SU5A 3OTPA 4LMMA 1GI2A 4MPAA 5EGMA 3DJ1A 3M5NA 1SGTA 3PTNA 2EY4C 1C1UH 9LPRA 3U1JB 3GYLB 2I6QA 4GVDA 1OP2A 3BEUA 1AMHA 5J4SA 2BLVA 1QL8A 2FZZA 1Z6JH 4IBLH 5C0UA 4BXWA 1TNHA 1O3LA 2JXOA 1JIMA 1SQAA 3GCOA 4Z8JA 1MFGA 1N6EA 3DSPA 3E3TA 1GI9B 2J4IA 3ZZAA 1L4ZA 1GGDB 1C1PA 1C5TA 1KDQA 1QRZA 1SC8U 1UEWA 1DSTA 4OS2A
chains in the Genus database with same CATH topology
1C2HA 1VJ9U 5F6MA 1QB9A 1MTWA 2FOEA 3ID3A 2FYRA 3UQOA 2OD3B 1A0HB 1FNIA 1LVYA 5JB9S 1FN8A 5C1XA 1FI8A 4H4FA 2A4QA 3UOUA 3LGTA 2CF9H 3BV9B 1GVZA 1J15A 3RXTA 1KXAA 3RXLA 1H8DH 4K60A 5SGAE 1PPFE 1JBUH 2MX6A 4R2ZA 5C67A 2HWLB 1RXPA 3SNDA 3RXGA 1GBIA 1U3BA 2ZFSA 1D6WA 1EJNA 4ZROA 1BE9A 2BDIA 1QQ4A 1XUGA 3Q00A 4JOFA 5GCHG 3S9AA 1YPHC 1UM1A 1V1TA 1FLEE 4Q2NA 1L2EA 2EJYA 4I8KA 3R68A 2FTLE 1AKSB 2ZQ2A 4WJG2 1ELGA 1DVAH 4NNMA 4UU5A 2JILA 3TIUA 1TP5A 2PFEA 1MAXA 2HOBA 1AUJA 4O03A 3T2NA 5LPRA 4FUCA 1SGRE 3P6ZB 3A89A 2BDGA 3HGPA 4F4OC 1NZQH 2KJDA 1VGCC 2K1QA 5LPEA 1OBYA 1QL9A 4SGBE 2EGOA 2A4RA 2GX4A 5E6PB 2ULLA 5A09A 3RC6A 1H9HE 2P95A 2CSJA 3T26A 2VGCB 3UUZA 3GOVB 2VIQA 1OKXA 5C2ZA 1D6RA 1RY4A 1GJ6A 1LQDB 1UTLM 4X6OA 1BA8B 3IITA 2ZPMA 1XKAC 1UVTH 3KEEA 2CS5A 1MUEB 1GBJA 2EC9H 2F9UA 2F9OA 2FS9A 1QAUA 1B8QA 1ZTJA 3CYYA 1T8LA 2FODA 2ZDLA 1RJXB 4B76A 5EU8A 1HAPH 1LVBA 3BTKE 2P3UB 3M3SA 4Q2PA 2H1UA 7GCHG 1FY5A 1GJAB 1NRNH 4FVBA 2RRMA 1QTFA 1TNJA 2OS6A 3A7XA 2AGIX 2ZGJA 3QTVH 8GCHG 2G8TA 3HVQC 5EQRA 2XYAA 1O2LA 4X8VH 1A46H 2SFAA 1ESAA 2GV6A 1Z87A 2ZFPH 3RMNH 1E35B 1VR1H 1ZSKA 2H2ZA 4K69A 2AMQA 5HMAA 5ABWA 1YPLH 2GDDA 2J95A 4TPIZ 2AMPA 2M10A 1JMOH 1B7XB 1QA0A 2C8ZB 2O8LA 4ISNA 5DK1A 5JYIA 1QLCA 1FY3A 2JETC 1TMTH 4JK5A 2AFQB 1BZXE 1PQ5A 1FZZA 5CE1A 1HCGA 1HDTH 1K1PA 1CE5A 3PTBA 4NIWA 4Y8YA 1F0RA 5FBEA 1D9IA 1H8IH 2JOAA 1AFQC 2VU8E 4CRGA 4AG2A 2GV7A 4JOPA 2C8YB 2ZNKH 4CBOA 1FY8E 4INLA 1UVOA 4ZXXH 2GZ7A 1XUIA 3TJUA 2XW9A 2M5TA 4UFEH 2QGRA 4TYDA 3UWJH 4Y0YE 4MLFB 1MQ6A 4KKDA 1W9EA 2AGEX 1QA7A 4GSOA 1TOCB 2ASUB 2PR3A 3E8LA 3SUDA 1V62A 4CREA 4BOHA 5AF9H 1MTNB 3K50A 1GHVH 4B2CA 4I32A 4CBNA 3SU3A 3MO6A 1DOJA 1A0JA 1OP0A 3AW0A 1G2MA 2D2DA 1YBWA 1ZTKA 3RXMA 3VQFA 4AORA 1KLJH 6CHAC 5JXBA 1DE7H 1O5GH 1P8VC 2BYGA 2O8UA 1IU0A 3OSYA 1V2LT 4B2BA 2J34A 1RFNA 1ANDA 1SGDE 3LPRA 2C8WB 1ANBA 2QF0A 2BY5X 2ZDVH 1AUTC 2ZGXH 1Q3OA 5B42A 4K1TA 3BEFB 3DA9B 2R4HA 4JORA 1CT0E 3UFAA 4XE4A 1C5YB 2ZCLP 1YYY1 4NMPA 5E11A 1FC6A 1F5LA 2BDHA 2PWXA 3F9FA 2WPIS 3RXOA 4ABFA 1GMDF 3NFLA 4JZ1A 5EW2H 2EA3A 5GLJA 1ORFA 1UTMA 1QIXB