3MH7A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 86
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh7A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh7A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh7A01
3TSWA 1NPMA 3MH5A 2I6QA 3RM0H 1RD3B 5EXMA 3TH2H 1BRBE 1SGPE 1GBJA 4MNWA 2OC1A 2JIKA 2P3FH 1HAVB 1AE8H 2GCHG 2P8OB 5GWZA 4RKOB 2JETB 1AD8H 1K1NA 1PQ7A 5JPMH 1TPSA 1V2JT 2BLOA 2ZGBH 3E0NB 5H4IB 3K1RA 1P2NA 2ZI2H 4WH6A 6CHAC 5I25A 3RM2H 3D62A 1O39A 5C20A 3I1EA 4MQAA 1O3LA 3ENSB 1ZHRA 3B9FH 1V2UT 2WPLS 1DE7H 1WTHD 2KG2A 2V0BA 2Y7XA 3OU0A 2JILA 1TNJA 2FX6A 2O8WA 8GCHF 5JBTA 1ANDA 1PYTC 3R3GB 3A88A 2QC2A 2OQSA 1ZPZA 2A1DB 3T29A 3OTJE 3TVJB 4X1QU 2PKSB 1D3QB 4BAHB 1GI9B 1DY9A 3B8JA 5EQSA 2NWNA 4K75A 1C5PA 4GVUA 2ANYA 5LPFA 3KNXA 4XBDA 1TYNA 3E3TA 3N7OA 2VIVA 2VB0A 1Y3YA 4CRFA 4JZIA 1YPMH 1TQ7B 2WYJA 1EP6A 1ELAA 1LDTT 2KV8A 3B76A 1BDAA 4OS1A 2VU8E 3K82A 1DSUA 2ZU1A 1O2UA 3KQBA 2ZFFH 1NRNH 4JOEA 3MH7A 4ZROA 1X8SA 3K2UA 2WPKS 1N6XA 2WV4A 4CHAC 1M9UA 2ZU5A 1FY8E 2ANMH 2FOBA 4R2ZA 2ZU2A 1GCTB 1K1LA 3GCNA 5I7ZA 1J17T 1LVMA 1PFXC 3F68H 3FP6E 3GOVB 2FI5E 5FAHA 4D7GA 1DDJA 1TBRH 1CHOF 1SGFA 3FZDA 2QXIA 4Q7XA 1O2QA 5DKMA 2DLUA 1ZGVA 2EHRA 4Q2QA 3PTBA 4WWYA 2GZ7A 1FC9A 4NGAH 2G8TA 2JREA 7GCHF 2ZPMA 3BV9B 3CBYA 1UTPA 2G52A 5EG4A 1EAIA 1PPZA 2ZDMA 3TITA 2KOHA 5L2ZH 1FN8A 1TLDA 2ZO3H 2ENOA 4DIHH 1W10U 3CENA 4MVNA 1NN6A 5E22A 3F9GA 3U1JB 4XE4A 3RC5A 3L33A 2AS9A 1X5RA 3BTTE 2CS5A 2FNEA 2BD5A 2KJPA 2UWOA 2H5DA 3MO6A 2JH5D 2ODQA 4X8SH 4CBNA 4Q3HA 1LKAA 2DB5A 4B73A 2YT8A 2H9EH 1E35B 3T62A 3ZVDA 4IC6A 3KHVA 1OKXA 4ABDA 5LPRA 2IWQA 1UTOA 2BVSH 1HLTH 4G69A 2YUYA 1C1NA 2KAIB 2YTWA 1UVPA 1YPJH 1HUTH 2BDYA 2PZDA 1GM1A 3LNXA 2KPLA 3T2NA 1CVWH 3L3TA 4K78A 4KFWA 4ABAA 1HAPH 2EEHA 3RXKA 4ESTE 1M5ZA 1K1PA 2CJIA 2PHBA 2WL7A 4FVDA 1S0QA 1UK4A 3PMBB 4JYUH 2P3TB 4LMMA 3TK6A 3NKKA 4GHQA 1LPGB 1W14U 5A8ZA 1G36A 4HTCH 5HFEA 4ZH8A 3AASA 3VB3A 1OSSA 1O2NA 2GT8A 3UQOA 3QLPH 3A84A 1LQDB 2H3MA 1HPGA 5HGGA 1CO7E 4JZEH 1FY5A 1TGSZ 4FUIA 4IMZA 3UUZA 3ZZ6A 1SGQE 1TMTH 3MOCA 1VJ9U 2DMZA 2Z9JA 1OZIA 1C1MA 3ZVEA 1HAHH 5HJ1A 5FX5A 3FZZA 1YGCH 2A5KA 2P3UB 3KEEA 4ZUHA 3TSZA 1IOEA 2HOBA 5F8XA 4IS5A 4E05H 1GJ7B 2WINI 4A1VA 1LPZB 3LKWA 2G4UA 4K8BA 4TY6A 1O3IA 1T31A 2EI8A 2UUKB 4AFUA 2DM8A 4K1TA 3TJUA 1RGQA 1JXPA 2BY6X 3P92A 4FXGH 1AQ7A 1EKBB 4IN2A 2PR3A 1WIFA 2OZFA 2F9NA 3LIWA 4Y76A 3GJ9A 3QO6A 1XUIA 3OY6U 1EUFA 1D3PB 2FOMB 1XKBC 1N7EA 1SVPA 2A4QA 2PV9B 1JWTA 1HJAB 1ZHPA 1ELGA 3SGAE 2AYWA 2H5CA 4EDJA 2ZGXH 4UE7H 1O5AB 8KME2 2OCVB 3T25A 2BD4A 2D8WA 3ZYEA 6CHAB 1A5IA 2BY9X 1KXFA 1HNEE 3QZQA 4BXSA 4CBOA 1MZAA 1X5QA 1AWHB 4IBLH 1QAUA 4INHA 3RMMH 3NGHA 3MU0A 4THNH 4X2YA 3F9FA 5C67A 2H2BA 1TNLA 2WPMS 4I8KA 2W4FA 5HEBA 2OD3B 2XC5A 2AERH 2A0QB 5FPYA 4Y11E 2G55A 2XBXA 1Q2WA 4OS5A 4NFEA 1O35A 1QL7A 2CMYA 3EAJA 1YCPK 1ZSJA 2BQWB 3BG4C 1GQ5A 1OX1A 1BMNH 1HV7A 3P8OA 1BJUA 1V6DA 4NNLA 1LVBA 3FP7E 1RTKA 2YOLA 2BD2A 1Z8IB 3QGJA 2DKRA 1TGCA 1P10A 4NIYA 2DC2A 4ASHA 2CXVA 4X6OA 1A0LA 1OP8A 1RIWC 2MHOA 3ZVCA 3SUZA 1SGNE 3SHWA 2RDLA 3U8TH 5EPYA 4B2CA 1K1IA 1WI4A 3QTVH 3U8RH 2I1NA 3TJVA 5FCRA 1UHBB 2P59A 5H3JA 4K8YA 1WH1A 4CHAB 1YYY1 5J4QA 3ZZDA 1QJ6B 3GY4A 2F9VA 3NCLA 3SUEA 4A7IB 3DFJA 1BTPA 1GMCF 5J4SA 1U39A 1C5TA 1NFUA 1KDQA 3SU1A 1DLKB 1THPB 4JMYA 1Y59T 1C1TA 2F9UA 4ZKSU 3TNSA 4LZ4B 2BQ7B 4HI3A 3HGPA 3QX5H 1S84A 3VB4A 3HKIB 1AUTC 1C5MD 3T26A 2XC0A 4A1XA 3GISB 1CA0C 4BANB 1HJ8A 6GCHF 1VB7A 4O3TA 3PV5A 2KOMA 5BRRE 1KXEA 2TRMA 3UR6A 2SNWA 7ESTE 5EPNA 1W13U 2K20A 1IQKA 3GYMA 3GCOA 3M35A 4DVAU 2PLXA 3SV8A 1RTLA 3UR9A 1SG8B 1CQQA 2VWNA 1W12U 4GHTA 3ZZ7A 2FLRH 4I32A 1PDRA 2OXSA 3DHKH 2D26C 2IWPA 4K1EA 3TPIZ 4PROA 4HOPA 2EDPA 1RTFB 2ZDKA 1GMDG 5HM9A 1JIMA 1VCQA 4BTUB 3S7HB 2R9PA 4NMOA 2HNTF 1QY6A 1QL8A 2EA3A 3ID2A 3KCGH 1T7CA 5DG6A 2I0LA 2CGAA 3HVQC 5HFCA 3BTME 4TPIZ 1WF7A 3FVFB 3S9AA 1BRUP 3NFKA 5C1YA 2GD4B 5GCHG 1MFLA 1EAXA 1WV7H 5E2PA 4NWLA 3D65E 3TJNA 1BITA 1ELFA 1GHAF 3FY5A 3M5MA 2REYA 1KXCA 3PS4A 1ZTKA 1J9CH 3BEUA 1TPAE 2BLWA 2CF9H 1O31A 4B2AA 2B5TB 4A5TS 1HIAA 2FN5A 4ZHAA 2G2LA 5T6GA 1D9IA 1ELVA 3MU5A 1YCPM 2ZQ2A 1ETSH 1EPTA 3ODFA 1P3CA 2P8OC 1MQ5A 4ISHH 1CGIE 1GJ4H 2ODYB 2FOAA 1S81A 3ATKA 5HXFA 2UZCA 4JORA 3E90B 1DVAH 3Q00A 2CF8H 1O2IA 1W3CA 1F5KU 1FZZA 4L8NA 1NFXA 4CH8B 1HAOH 3SU3A 3P17H 1V2QT 2R3YA 1ELEE 2SNVA 3M7UA 4YOIA 2ZDAH 3M5NA 3LGWA 2LC6A 1O2WA 5HFFA 2BOKA 3SW2B 3TU7H 4AX9H 3VEQB 3ZVAA 4Y8YA 3BPUA 3BEFB 1P9SA 2HALA 3PTNA 4AMHA 3SU0A 1RJXB 1G30B 1NZQH 1SGYE 4Z0KA 2GZ9A 5AFZH 2QXJA 1UTQA 4NSVA 1C1QA 3Q77A 4J2YB 3DA9B 2ZDNA 1A46H 4FUEA 5G1DA 1GHVH 1LHDH 5GDSH 1BOQA 1SGCA 4RSPA 2ZCHP 2KOJA 5DP3A 1OYTH 3NUMA 1F0SA 2GCHF 3MNXA 4X2WA 1TMBH 2Z17A 1PPHE 4WJG2 4DOQA 1VGCC 3O8DA 1UK2A 3BSQA 2X7ZA 1V2LT 1FDPA 4OS4A 5DP9A 2A45B 1Z8RA 4ZMAH 1O37A 4FUDA 1V2VT 4ISLA 1JRSA 1QA7A 3BTKE 2VPHA 5JBCS 3VB7A 5GJ4B 1IQNA 1L2EA 2FOFA 4YESB 2EXGA 4DT7B 2JH0D 3M7QA 2OINA 3BG4B 3V13A 1K1JA 3AXAA 2WPIS 3ZZ4A 1O2LA 4WYTA 3UOPA 1C2GA 1K22H 4O03A 2R0KA 2OTVA 5B6OA 1OWHA 3SI3H 5JBBS 3LT3A 1FPHH 3OY5U 2SGPE 1INCA 4H42U 2J2UA 1DSTA 4NFFA 1K9OE 1BMMH 1RIWB 1ZTJA 1NFWA 1Q3PA 2O8MA 2F0AA 3LJJA 4O9VA 5DP4A 1O3PB 1FV9A 1GDNA 3PMAB 5T6FA 1TBZH 2PGBB 2QF3A 3BTEE 4XSKU 1B0FA 2GGVB 1XMNB 4RI0A 3TMHA 1QL9A 1THRH 1YPHC 5GPIB 4FUGA 4QT8C 2XBVA 3E16B 1HAYB 3TIUA 5A8XA 2W5EA 3UQVA 1ABJH 2DE8A 2YUBA 3BTQE 2RA0A 5G4BA 2BB4A 5EZ0A 1O2XA 1BB0B 2AIPA 1L1NA 1LKBA 4K6YA 1P3EA 1W9OA 3U9AH 1EQ9A 2OQ5A 1CA0B 2A2XH 1AVXA 4ZXXH 2OUAA 3SJ9A 1O3MA 3TK5A 2P16A 5FHTA 1J15A 1QB6A 5L6NH 1O34A 1TQ0B 3EE0B 3DUXH 3HK3B 1DUAA 4Q2OA 5B6LA 1J14A 1FJSA 1GVLA 2GZ8A 3KL6A 1D6WA 2C90B 4J1YA 2H9HA 3BIUH 2PA1A 1Y5AT 1ESAA 4BAKB 4JOFA 1SGRE 2ZCLP 3M7TA 3PB1E 3I18A 2SGEE 1ZMLA 1GI4A 3QJMA 3GY3A 4X8TH 1UEPA 4CR9A 1GHZA 3GSLA 2WPHS 1UK3A 1A3BH 1EJMA 1Z7KA 3RXJA 3TGJE 3T28A 5T6DA 1A0JA 1ZR0A 2VIWA 3ZVFA 1XXDA 2Y7ZA 3AAVA 3SOSA 1ZJKA 1JRTA 1VITF 2FE5A 4WMFA 1BA8B 2LC7A 1P02A 2BX3A 4FUJA 4H6SB 1KEFA 2MX6A 4JL7A 2ZPSA 1KYNA 4DJZB 3PDVA 2SGAA 1R6JA 3LH3A 2ZGHA 2VVCA 1C2HA 1OP0A 2QA9E 2LUIA 1ETRH 2QT5A 4GCHG 4AG2A 2GV7A 2EDZA 1S5SA 1TPOA 3MNSA 4NMVA 3I4WA 4U32A 1QURH 1K2I1 1P1DA 2I0IA 2XW9A 3LPRA 2AWXA 2VZ5A 2VWRA 1X5NA 3ZZAA 4NXPA 1RGWA 2ZFQH 3A7YA 3RXCA 5C2ZA 2ZC9H 5EXLA 4X6PA 5L2YH 2A2QH 1O3DA 3QUMP 1P2OA 1IHSH 4NG9H 2EEJA 5E0JA 2ZFRH 3QDOA 2M0UA 1QQ4A 1GJAB 4JOPA 1HJAC 4UDWH 2CSSA 2D8IA 2BD8A 1EAWA 2ZDVH 4CRDA 2WV5A 4DY7B 5LPEA 1W2KH 2Q1JA 2Y5HA 2PKAA 2BQ6B 1YCPH 2CN0H 2O8LA 1OYQA 2V6NA 2R3UA 3DORA 3RMLH 2OPGA 2ZPRA 1ZSLA 2ZFSA 1MH0A 2VIQA 2XYAA 4A6LA 1Y5UT 1OXGA 1UTKA 2PW8H 3CS0A 2OBQA 1BMLA 1GJ9B 4SGBE 4NIXA 3GCHC 3SHAH 1C2JA 2KAWA 2IJOB 1O0DH 2KJKA 2FP7B 2EJYA 2Q6GA 3RLYH 1O2PA 2BDHA 1ACBE 4JZFH 1EAUA 1OS8A 2DJTA 3A81A 1W7GH 3KQDA 4FU7A 1VCWA 1W0ZU 1UTJA 4TWYA 1ZMJA 1NM6A 1BQYA 1CT2E 4K60A 2XWBI 2VJ1A 3GICB 4Y71A 2ULLA 1C9TA 4NMTA 1B7XB 2I04A 1C2MA 2ZU3A 3I29A 1O3HA 1BTUA 1VGCB 4IC5A 3IWMA 1O32A 3GGEA 3EYDA 2GX4A 2UUYA 1TIOA 3RC4A 1BFEA 5DP8A 3P8FA 1JBUH 1ELBA 1ELDE 4E7NA 1WCZA 3VGCC 1I16A 1EOLA 2BVXH 2GP9B 4YOGA 4CRGA 3LGUA 1CHGA 4NMPA 2FDAA 5AFYH 1TFXA 5F67A 3BTDE 1C5WB 1QA0A 2FCFA 1S85A 4YDPA 3MH6A 3TSVA 1XUKA 1TQ3A 4H4FA 2GDDA 3EGHC 1GI1A 1T4VH 4U30A 4AOQA 1EZUC 3AW0A 1QCPA 2SGFE 4ZXYH 4AFZA 1GHWH 1Y3UA 1V1TA 1LHFH 3RXUA 2Z9IA 2NU4E 1VZQH 1FN6A 5AHGH 3QZRA 1NU9A 2D92A 5DK1A 1O2MA 2A32A 1SLVB 1DLEA 4JK6A 1TP3A 2C8ZB 1UTNA 5DJ7A 2M10A 3E17A 2ZEBA 1V6BA 2PFEA 1GI6A 1TX7A 1ZRBA 3SOEA 1V2OT 3PM3A 4TY7A 3MYWA 1G9IE 1F5RA 2A4GA 2FI3E 2FTMA 4YOJA 3AVZA 2HGTH 3RXRA 2RCZA 5HDYA 3O8CA 1UF1A 4OGYA 3ZZ3A 4MNVA 1S82A 4HZHA 2F9OA 2P95A 4X6NA 1FNIA 1C1OA 1OOKB 1GHYH 2IN2A 3SU5A 1W11U 1YPEH 2HRVA 4K2YA 2EEKA 1DT2A 4Y79A 1O5CB 1QAVB 2ZTZA 1NS3A 2FS9A 4K3JA 4K1SA 3P8GA 2HE2A 3MNBA 4UFEH 3A89A 2O9QA 4WF8A 3FANA 2EV8A 1F7ZA 1GCDA 1DXPA 5E1YA 1MBQA 4YLUA 2BD7A 4ZHMU 2Y5GA 2XCNA 1TAWA 1DITH 5BPEA 2O2TA 1QRWA 1B5GH 2OC7A 3LDXH 1HYLA 3NXPA 2QF0A 4Y7BA 1LHCH 1IQJA 1NT1A 1QBOA 2Q6FA 2VWLA 1PPBH 1LHEH 1SC8U 1TNKA 3C27B 1UEQA 4FUCA 1FONA 3KIDU 2RG3A 1DXWA 3SI4H 3RMOH 1V2RT 3PV4A 1TP5A 5L30H 5A8YA 4X0WU 1AKSA 4P0CA 2FEQH 1UJUA 4IGDA 4E3BA 4JYVH 1N6DA 3V3MA 1PPCE 5HMAA 2IWOA 1NTPA 2ZFTA 1ELCA 1ANBA 4OEOA 3OYPA 2KRGA 3PLPA 1BCUH 1MTVA 2OC8A 4NIWA 4D76A 2FLBH 1SPJA 1VCPA 1G3EA 2HPPH 4XBBA 2R4HA 1K21H 3UIRA 4DURA 1AI8H 5T3HA 2KQFA 5DP7A 5HM2A 2WYGA 2HPQH 1GI3A 2AMQA 3D49H 4A92A 2D1JA 3UY9A 3SUDA 1HAZB 1CE5A 2AINA 1QB9A 1NC6A 2A31A 1P1EA 1W9EA 3GY8A 1WYKA 4KTCA 1C5NH 2JOAA 2XCFA 3WKLA 2ZHQH 2GTBA 4BNRA 1H4WA 1V2WT 4K72A 3RXMA 1T8OA 1O36A 1GL0E 3ZV8A 2C8XB 4X1SU 4OS6A 2BOHB 4B74A 1A3EH 1O3JA 1TABE 2BZ6H 3DJ3A 1Z6JH 2EI6A 1Z8GA 1FY3A 1GHBG 3BIVH 2B7DH 1GL1A 1GWAA 3PDZA 2L97A 2QGRA 1ZRKA 1BBRE 1MMJN 1A5GH 2AGIX 1GI2A 1GBDA 2RRMA 4NSYA 4JOHA 4A1TA 1IQFA 3GCHB 1TA6A 4DG4A 1D6RA 1N8OC 4NZLA 1NROH 1IHJA 4OS7A 1MFGA 1RGRA 1N7TA 2ODPA 2W7SA 1NRQH 1MAYA 1ZHMA 1WTGH 2J92A 1U37A 2BY7X 2ZQ1A 2F83A 1OWKA 1C5YB 4ISIH 4TPYA 1T32A 2H3LA 1O3CA 2CHAC 2LOBA 2TGTA 4X8VH 5ETXA 3SNCA 2ZTXA 3Q3KA 2KYLA 3UPEA 1ZTLA 4UFDH 1C2IA 2B9LA 3SJOA 1CHOG 3LC5A 1K28D 1JOUB 5AF9H 2W7RA 1ZPCA 3VGCB 4AN7A 4B75A 3RL7A 2Z9KA 4CRCA 1HAXB 2G5VA 1QBVH 1IQGA 3SV6A 1O5BB 2QV1A 4AYVB 4ZHLU 2HE4A 1C2KA 3SV9A 1ABIH 4NMRA 2BDBA 2BVRH 2Z9GA 4D7FA 4R8TB 1RS0A 1CGJE 2PUQH 1V2MT 1SGEE 4GVDA 3O8RA 1A61H 4OEPA 1SOZA 1F0UA 1WUNH 1ARCA 5DTHA 3PMHB 2AH4X 2J94A 1UVSH 3M3VA 1HFDA 2HVXA 1TBQH 4B2BA 3UREA 4Q6HA 3SGQE 1FY4A 1O3GA 2HNTE 2AIQA 2BY5X 1QR3E 1OBZA 1CT0E 5EGMA 3BF6H 2V90A 2Z6BD 4Y0YE 4YZUA 3SV7A 3BTFE 5E2OA 1HJ9A 1HAVA 4NA9H 3ZRTA 3RLWH 3UWJH 1WSSH 3PV2A 4Z6AH 3PYHA 4YM9A 3SV2H 1SGFG 1GJBB 3DIWA 1C4U2 1JIRA 4BOHA 1H9IE 2FO9A 5A0CA 1TA2A 2AEIH 4WVPE 1Q3XA 2KPKA 2F91A 1A4WH 3LGYA 4Y8ZA 3ZVBA 2Y6TA 4OGXA 4B76A 1WI2A 1MQ6A 1L1JA 2Z3EA 3SNBA 4RKJB 1PQAA 1FI8A 1C5OH 2BX4A 4FUFA 2M0TA 3UNRA 2Q9VA 4X1RU 5CHAC 1GGDC 2XTTB 3MO9A 3PLKA 1LHGH 1ZMNA 1KY9A 2OSGA 1QB1A 4X2XA 1KIGH 5PTPA 1LQEA 1AZ8A 2EI7A 1W8BH 2ZF0H 4Y6DA 1YPLH 4INKA 3CYYA 3O8BA 1BBRK 1WOFA 5EU8A 5C5NA 8LPRA 3BTHE 1FXYA 2VWMA 2FXRA 3HPTB 2ZGCA 4Q2PA 1MTWA 1TX6A 2TGPZ 1MAXA 3I77A 5F6MA 3ID1A 3A7VA 2VINA 3GDVA 1DPOA 1N6FA 3SN8A 4WXIA 1O5DH 1EOJA 3TK9A 1Z86A 3HKJB 4JK5A 1UVTH 4KP0A 3OTPA 1RRKA 2EEIA 1QGFA 1SBWA 4O06A 4Y7AA 3U98H 2FYRA 3S7KB 1SQOA 3AAUA 3LGIA 1C1WH 1O2KA 2C3SA 1A1RA 4FU8A 2Y80A 3VPKA 3CP7A 5JB8S 1BZXE 1KTTB 1BTYA 3P6ZB 3CBXA 1HDTH 3TH4H 3RXFA 3U8OH 4ZKRU 1QFKH 4JZ1A 1GI8B 1TRYA 2G51A 2Z3CA 2Q3GA 1SR5C 2FODA 3P95A 3UNQA 4NXRA 1Y8TA 5DGJA 1O2JA 4XDEA 5EODA 1OWIA 1EB2A 3M3SA 1H9LB 1CU1A 4BTIB 1UJDA 4MTBA 2JXOA 1VAEA 4NXQA 1FQ3A 1FPCH 5E21A 1GBEA 2ZA5A 3GYLB 2LNCA 1RZXA 4NZQA 5F03A 2FESH 4D9QA 2VIOA 1UJ1A 1SL3A 4JYTA 4I8LA 1KXBA 3UFAA 4MG3A 1DFPA 3JZ1B 1TMUH 1K1MA 2QXGA 1DWEH 2ZKSA 2CV3A 2ESTE 5FX6A 2WPJS 4MPAA 1ARBA 3VFEA 1ZPBA 2F9PA 2VWOA 3RXOA 2XBWA 3MHWU 2NU0E 1N8OB 3ATIA 1G32B 2KAIA 2FOCA 3A82A 1O3KA 4WXVA 4O97A 1CGHA 2QN5T 1TOMH 2FTLE 3D23A 3KN2A 4CRAA 3S9CA 4Q2NA 1IQEA 3NK8A 3NFLA 3RC6A 4AB8A 4BXWA 2H9TH 1QHRB 1DOJA 1XZ9A 2O8TA 2CHAB 1ANEA 3QTOH 4BTTB 1C1SA 3NPSA 1GMCG 4I7YH 3ID3A 1GBHA 5F8TA 1EPTC 2C4FH 3U1IB 3QWCH 4X2VA 1Z87A 1A7SA 2BDAA 1Z1IA 2QKUA 3IG6B 2L4TA 5E11A 2PGQB 2FX4A 2AWWA 1D4PB 2J4IA 3C1KA 1XXFA 1DWDH 3MNCA 1ESTA 2JWEA 2KA9A 1O3FA 2O8UA 4K69A 3I78A 1PPGE 1ZLRA 1BTZA 1Q7XA 2P94A 3PWBA 1XM1A 5EW1H 2XNIA 1TALA 4ABJA 3R0HA 2QIQA 2AMPA 1S83A 2J38A 1H1BA 1VJ6A 1VJAU 1WU1A 2STBE 4Q7YA 1Y7NA 3RXDA 2HGAA 2FPZA 5C1XA 1BMAA 4RN6A 1GDUA 1QIXB 2VVUA 3GY7A 4UFFH 2Z3DA 3ODDA 3RXHA 3T5FH 1UTMA 4MDSA 1G37A 3V0XA 1PQ8A 5E0HA 5E8EH 1TWXB 3MH4A 1ZGIA 1W9QA 1OBYA 2KBSA 3LOXA 3LH1A 2NU2E 4MLFB 2KL1A 4KTSA 1O2OA 2GMTC 1Y3XA 1FIZA 1FAKH 4JOKA 2BHGA 3RU4D 4FUHA 1WBGB 3SJIA 3K6YA 3E1XB 1E38B 1HB0B 2BD9A 2PTCE 4I8HA 1NO9H 1P04A 3VQFA 4LK4A 1WF8A 1EXFA 1F0RA 1C2EA 1FC6A 1GHAG 3ZYDA 8ESTE 4E34A 3EDXB 1NY22 5CHAB 3MI4A 1GGDB 1MCTA 1MTSA 1ZSKA 3UNSA 1LVOA 1DICA 1QBNA 5DP6A 4YTAA 1P57B 2FYQA 4AZ2B 1CA8B 2A7JA 2AFQB 5FPTA 3HPMA 1AB9C 2YNAA 2QAAA 1P8VC 1WQSA 3L4FD 4E06H 4PQWA 1T8MA 4NWKA 1S6FA 4LXBH 5IDKA 1G3CA 1W7XH 1C5XB 2TGDA 5JYIA 7LPRA 3HK6B 1A0HB 2Y5FA 1CBWC 3Q3XA 1KSNA 1KDQB 1AFQC 2C93B 1C5LH 4KGAA 1QNJA 3EQ0H 1N6YA 1TGBA 2ZP0H 2ZDLA 1NU7B 5JBAS 5ABWA 2FOGA 1YBWA 4FU9A 2IPHA 3RLEA 1P2JA 1UHBA 2VH0A 1P2KA 1GVKB 1SQTA 1HGTH 1WJLA 2BM2A 2C8YB 3G01A 1O2RA 1ZOKA 3K9XB 4AG1A 1GBLA 3GCTG 1V2TT 3ZZ5A 4ZAEA 4CRBA 5TCCA 2BZAA 2FOEA 1NRSH 1AY6H 2UWLA 1EP5A 1TGNA 2H6MA 1KXAA 3MU8A 1WAYB 6ESTA 2ZHWH 3A7XA 2QKTA 1GJDB 1AO5A 1HXFH 1XUFA 1RXPA 5FXLA 2FI4E 5FBIA 1EZQA 1GBMA 1N7FA 3A87A 3E0PB 1OWJA 4FGMA 4HOPB 5TJXA 3KGPA 1UVUH 1FMGA 1Z1JA 5EQRA 4NMSA 3UWIA 1BHXB 2H2CA 1C4V2 2YNBA 1AVWA 4B71A 3HPKA 1J16A 2GT7A 2TBSA 2SGQE 1GBIA 5HF1A 2GKVE 1KLTA 3LU9B 4ISNA 5E0GA 1Q31A 1D3DB 3SU6A 2J34A 3URDA 4N6XA 2NU1E 1WQVH 3EA7A 2XWAA 2SFAA 5DP5A 4ABIA 3MU1A 2BXTH 3QJNA 3T27A 4ZKOU 2W26A 2KJDA 1MZDA 1NESE 1IQIA 4GPGA 5FPSA 3VB5A 1GI0A 1DWCH 1QJ1B 3GY5A 3ATMA 3A83A 3PMJA 1GHBF 5DPAA 2ZPLA 5JDUB 1S0RA 1U3BA 1P0SH 1ZJDA 2W7UA 4OS2A 1HIAB 2BMGB 2ZWLH 1QRXA 1L6OA 1AUJA 1DS2E 3GY2A 3IITA 1V2KT 1O38A 1UCYE 2HWLB 1AU8A 4E7RG 1EPTB 1C9PA 2PKTA 5HYOA 2QXHA 1G2LA 3F6UH 3KZDA 4ISOA 2XXLA 3F9HA 4F4OC 2K1ZA 2STAE 1DY8A 4R0IA 3S0NA 5DO4H 1F5LA 2M0VA 1BUIA 2DLSA 1GJCB 3URCA 1L1GA 2VH6A 4KELA 2RA3A 2A5IA 4AORA 1O2HA 1ANCA 1AWFH 5IYTA 3RU4E 1NF3C 4JOJA 1YPKH 1HAGE 1MKWK 2IOTA 4JZDH 4MPVA 4ZKNU 4U01A 4K76A 3BG8A 4AFQA 1V5QA 1QLCA 1IQMA 4UFGH 3SQEE 3ZVGA 4MNXA 3SHUA 2DE9A 1N6EA 1UFXA 1BBRH 2OGPA 2A4RA 1QJ7B 2W3KA 1GMHG 3FAOA 5EXNA 4ABBA 4Q7ZA 1V62A 3A80A 3SHCH 1O3OA 1OWEA 1XKAC 1C4Y2 4K5ZA 4GAWA 1ETTH 4NA7A 4NCYA 1L4ZA 4BAOB 3L6PA 1VITG 1QTFA 2D2DA 4H11A 1C5SA 5HETA 2W3IA 1OWDA 1C1PA 2GMTB 2BXUH 3TJOA 2BY8X 3SGBE 1O5EH 4VGCC 1EB1H 2JH6D 2ZIQH 4F8KA 3STIA 1GBCA 1B0EA 1UMAH 1MKXK 4WYUA 1UTLM 2V3HH 1P01A 4F49A 4WMEA 1U38A 3RXAA 1X45A 5E6PB 1P06A 3ZZ8A 2OP9A 5CMXH 1O3AA 4O3UA 4YO9A 2M0ZA 3LGVA 1T4UH 3H7OA 1C5RA 2BDGA 3EA9A 3Q3YA 3H7TA 3TGIE 4Q6SA 1L4DA 2F3CE 4XHVA 1DM4B 3ID4A 1GMDF 2ZECA 2BDCA 2GDEH 2PKUA 1HAIH 3B23B 1ELTA 3RUOA 2PSXA 1DX5M 1AB9B 1DANH 2V1WA 4HGCA 1E37B 4JCNA 1C1UH 3A8AA 1GBKA 2AGGX 2QY0B 1E36B 2PTNA 2SGDE 1BTHH 2ALVA 2ZU4A 1MUEB 3M3TA 3DJ1A 1CBWB 3DJAA 2OS6A 2DAZA 5HFBA 1JMOH 4INLA 1EX3A 1MTNC 2WUCA 2OMJA 1QQUA 1AFQB 1MD8A 1AFEH 3LC3A 5GCHF 4X6MA 1TNIA 4KKDA 2BLVA 3MFJA 1UCYK 1XVOA 3ELAH 3LJOA 1EATA 1Y5BT 3P8NA 4GUXA 2EAQA 3E6PH 8GCHG 4OAJA 1FY1A 3SZNA 5HF4A 1ZOMA 1NRPH 1P12E 4M7GA 4D9RA 4KFVA 3QIKA 4NNMA 5HFDA 1SFQB 1TPPA 1TRMA 4SGAE 3SNDA 1SGTA 1EZXC 1P05A 2NU3E 5K0HA 3GDSA 1OP2A 3KF2A 3RXPA 1SHYA 2RCEA 3VXFH 4UEHH 1HBTH 3ITIA 2FZZA 2BD3A 2AGEX 3RXBA 4GSOA 2VIDA 3QGLA 3BTGE 1S6HA 3R0FA 5SGAE 1BTXA 3MO3A 1WHDA 1ZUBA 1THSH 1GBBA 1GPZA 2VGCC 2OCSA 4CR5A 3RXQA 1GBAA 4X1PU 2ZZUH 2AWUA 1Z6EA 1SQAA 2OC0A 2QYIA 2J9NA 3SUGA 2OLGA 5FB8C 1G3DA 3A8DA 1YBOA 4Y0ZE 5LGOA 1T8NA 5ESTE 1WFVA 3BTWE 3ATLA 2ZHDA 1C2LA 3QDZB 1AVGH 1G2MA 2OQUA 3A7WA 3A8CA 1LO6A 2HLCA 3KQEA 3K65B 1GDQA 2BDIA 1H8IH 3P70B 1FLEE 3BN9A 1SI5H 2QG1A 1C5UA 1GG6C 1NFYA 4AB9A 4UU5A 1MTUA 1F0TA 1Z8JB 5K7RA 1GQ4A 1CT4E 3GDUA 1O2YA 1DUEA 7GCHG 2VSPA 2V35A 3CBZA 3A86A 1X7AC 1VA8A 1Y3WA 3F9EA 4I31A 2Z7FE 2VNTA 4Z8JA 1SLXB 5ESBA 1O5GH 1UHPA 4FVBA 2UWPA 2EDVA 3DD2H 1AHTH 5JXBA 4YLQH 7KMEH 2TGAA 1V2PT 1C5VA 1K32A 1HCGA 2UUFB 1GJ8B 3BEIB 1P03A 3SQHE 9ESTA 3QGNB 1B8QA 1Z71A 2EGNA 1L0ZA 2VVVA 3CC0A 1V2NT 2Z9LA 3W94A 1C1RA 4X8UH 1C2DA 1KTSB 1AGJA 1V3XA 2QBWA 3TGKE 5F3XA 5JB9S 5LH8A 2I4SA 1UEZA 2PNTA 2ZHEH 3TH3H 2V3OH 2G00A 3PO1C 4LZ1H 2BYGA 3JXTA 2PKAB 2PWXA 2EGKA 1O33A 1OPHB 4Y10E 3FP8E 3RP2A 1SLWB 2DUCA 1BJVA 1PQ5A 4Y8XA 1KWAA 1TB6H 3AW1A 4NIVA 1MU8B 1K1OA 1C2FA 2PSYA 1O30A 1EZSC 2R0LA 1IQLA 1E34B 3SJKA 4LOYH 3SU4A 1HXEH 1W0YH 3M5LA 4YYXA 2ZCKP 4E35A 1V5LA 4UU6A 3PLBA 4Q2KA 2H1UA 3WY8A 2FWWA 3VB6A 4GVCA 2VSVA 1C1VH 3ZZBA 1LCYA 2CSJA 5GLJA 1EASA 3CS7A 3WKMA 2I6SA 3W95A 5TCAA 2P3WA 3RXEA 2GCTC 3LONA 4WH8A 1WFGA 4AGKA 1XX9A 1YLCA 3DT0H 4DCDA 1P09A 4DGJA 5G1EA 2ZFPH 4VGCB 1ESBA 3A7ZA 3MU4A 4I33A 4NA8A 3HATH 2AMDA 1TGTA 2OBOA 2PUXB 2VRFA 3RXLA 4ABFA 1LTOA 2EGOA 1SLUB 2G5MB 2HNTC 3RDZA 5EW2H 1YF4A 3S9BA 1F92A 1AE5A 3Q76A 5C1UA 1GI7B 2XBYA 2VIPA 1GBTA 3NZIA 4YT6H 3UOUA 1HRTH 5AVDA 4IMQA 2QKVA 1Y3VA 3LGTA 3RU4T 1I92A 4IN1A 3K50A 3RL8A 3R69A 9LPRA 1QRZA 1SSXA 2BLQA 1O2SA 1ORFA 1X6DA 3CH8A 2Y82A 2A7CA 1U6QA 1O2ZA 1FAXA 3TLOA 3M61U 2GV6A 3VXEH 3QN7A 1BRCE 4REYA 1BTWA 3OX7U 4I8JA 1YC0A 4FUBA 4MPXA 1MTNB 1UO6A 4TWWA 1YM0A 4JOGA 2TPIZ 1XVMA 1NRRH 4GCHF 2YT7A 5EQQA 2BTCE 2ALPA 1PYTD 2JETC 1VITH 3KQCA 3RXIA 2FS8A 1GI5A 2FIRH 2WUBA 3SJ8A 2ANWA 2A7HA 1D5GA 1GHXH 2ASUB 4MNYA 1FC7A 3EGGC 1BHXF 1WG6A 1P2MA 1T8LA 2I6VA 3MMGA 1O3BA 1LMWB 1FCFA 3ZV9A 1RFNA 5C3NA 3GY6A 1TX8A 2ZG0H 3JZ2B 1D3TB 1UJVA 1MCVA 1EJNA 2ZNKH 4D8NA 4ABHA 4AGJA 1IQHA 1SFIA 3GCTF 2FM2A 1EJAA 5HEDA 2PKSC 3EGKH 2LA8A 3KZEA 2VGCB 1ZZZA 1RY4A 4XBCA 1YPHE 2D90A 3KHFA 3RXSA 3SO3A 1MU6B 3HGNA 1YKTA 3SBKA 3S69A 1DWBH 5GXPA 1QAVA 1C5QA 1MBMA 2JKHA 1IU0A 3R68A 3MTYA 4MPWA 3UTUH 3SUFA 1O2VA 4IW4E 1GJ6A 2F5YA 4DW2U 1T2MA 2G5NA 2R2MB 4MPUA 3RXTA 1BT7A 1SOTA 1BE9A 3ZZ9A 4YT7H 3V7TA 1UVOA 2UUJB 2GVFA 1GG6B 1AKSB 3LNYA 1AN1E 5C5OA 1GCTC 1FIWA 1IAUA 2Y81A 3PROA 4NMQA 1A2CH 5EYZA 1MKWH 2H2ZA 3V12A 6LPRA 4XOJA 3SNAA 6GCHG 5A09A 4X1NU 1GVZA 1YLDA 1SB1H 1LPKB 3MWIU 2Q6DA 4GLYA 3O5NA 1PJPA 3U69H 4H6TA 2XC4A 1IU2A 1PPEE 1ID5H 4GHNA 1MC7A 1P2IA 2FOHA 3VQGA 2J95A 4WY3A 5GIBA 1YP9A 1IHTH 3RMNH 5I46H 1C5ZB 4BAMB 5F8ZA 1UEWA 5EOKA 2ANKH 1P2QA 2K1QA 1GBFA 2PDZA 1AMHA 1BIOA 1H8DH 3ESTA 3TNTA 4BAQB 5FBEA 3EA8A 1TNGA 3ZZCA 1OBXA 4I8GA 1XUJA 1P9UA 2ZGJA 1LVYA 1O2TA 3H5CB 1J8AA 4ABGA 5D13A 2R2WU 3A7TA 3PO1B 1G9OA 2C8WB 1TONA 4KTUA 4AYYB 1MKXH 2TIOA 3SU2A 1Q3OA 2ZHFH 1TRNA 2L4SA 2F9BH 3M37A 1XUHA 3RXGA 2EEGA 1YPGH 2IWNA 1V2ST 4ABEA 3E8LA 4Z33A 1SGIB 1NTEA 2JINA 2EC9H 2G81E 3SFJA 1VR1H 3F1SB 1GJ5H 1F2SE 1UM1A 2XRCA 2BYAX 1ZYOA 2FMJA 1SHHB 1O3NA 4U2WA 3QK1A 1KXDA 2G4TA 3DFLA 3SNEA 3RXVA 4CH2B 1N99A 1BRAA 4CREA 1WHAA 1H9HE 4HFPB 4DIIH 1SMFE 1AZZA 3K6ZA 1FUJA 3STJA 1UM7A 2GZVA 2ILNA 5A2PA 1KLJH 4WMDA 1CSOE 2GCTB 3PWCA 1O3EA 3OSYA 2A5AA 4AFSA 1E0FD 2ZTYA 2LPRA 3NWUA 5A0BA 1N1LA 5HEYA 3M36A 1GMHF 2B8OH 4P2AB 1O2GH 2Z94A 5FCKA 5A0AE 3A85A 2ZPQA 1P11E 2P93A 1SGDE 1UCYH 2A4OA 1XUGA 5CE1A 4Q80A 1G3BA 2QCYA 1TE0A 2M3MA 4UD9H 2B0FA 3O46A 1TNHA 3QE1A 1A5HA 4TYDA 4UONA 1O5FH 3A8BA 5GNDA 1PPFE 2THFB 5A2MH 3E91A 3FFGA 2E7KA 3SORA 1TOCB 4XFQA 1UITA 3M5OA 3ATWA 1MD7A 2M5TA 4B1TA 1AIXH 1KLIH
chains in the Genus database with same CATH superfamily
3TSWA 1NPMA 3MH5A 2I6QA 3RM0H 1RD3B 5EXMA 3TH2H 1BRBE 1SGPE 1GBJA 4MNWA 2OC1A 2JIKA 2P3FH 1HAVB 1AE8H 2GCHG 2P8OB 5GWZA 4RKOB 2JETB 1AD8H 1K1NA 1PQ7A 5JPMH 1TPSA 1V2JT 2BLOA 2ZGBH 3E0NB 5H4IB 3K1RA 4YXWD 1P2NA 2ZI2H 4WH6A 4RT0A 6CHAC 3RM2H 3D62A 5I25A 1O39A 5C20A 3I1EA 4MQAA 1O3LA 3ENSB 1ZHRA 2JJ2D 3B9FH 3U28C 1V2UT 2WPLS 1DE7H 1WTHD 2KG2A 2V0BA 2Y7XA 3OU0A 2JILA 1TNJA 2FX6A 2O8WA 8GCHF 5JBTA 1ANDA 1PYTC 3R3GB 3A88A 2QC2A 2OQSA 1ZPZA 2A1DB 3T29A 3OTJE 3TVJB 4X1QU 2PKSB 1D3QB 4BAHB 1GI9B 1DY9A 3B8JA 5EQSA 2NWNA 4K75A 1C5PA 4GVUA 2ANYA 1H8HD 5LPFA 3KNXA 4XBDA 1TYNA 3E3TA 3N7OA 2VIVA 2VB0A 1Y3YA 4CRFA 4JZIA 1YPMH 1TQ7B 2WYJA 3W1EA 1EP6A 1ELAA 1LDTT 2CK3D 2KV8A 3B76A 1BDAA 4OS1A 2VU8E 3K82A 1DSUA 2ZU1A 1O2UA 3KQBA 2ZFFH 1NRNH 4JOEA 3MH7A 4ZROA 1X8SA 3K2UA 2WPKS 1N6XA 2WV4A 4CHAC 1M9UA 2ZU5A 1FY8E 2ANMH 2FOBA 4R2ZA 2ZU2A 1GCTB 1K1LA 3GCNA 5I7ZA 1J17T 1LVMA 1PFXC 3F68H 3FP6E 3GOVB 2FI5E 5FAHA 4D7GA 1DDJA 1TBRH 2LP6A 1CHOF 1SGFA 3FZDA 2QXIA 4Q7XA 1O2QA 5DKMA 2DLUA 1ZGVA 2EHRA 4Q2QA 3PTBA 4WWYA 2GZ7A 1FC9A 4NGAH 2G8TA 2JREA 7GCHF 2ZPMA 3BV9B 3CBYA 1UTPA 2G52A 5EG4A 1EAIA 1PPZA 2ZDMA 3TITA 2KOHA 5L2ZH 1FN8A 1TLDA 2ZO3H 2ENOA 4DIHH 1W10U 3CENA 4MVNA 1NN6A 5E22A 3F9GA 3U1JB 4XE4A 3RC5A 3L33A 2AS9A 1X5RA 3BTTE 2CS5A 2FNEA 2XOKD 2BD5A 2KJPA 2UWOA 2H5DA 3MO6A 2JH5D 2ODQA 4X8SH 4CBNA 4Q3HA 1YY3A 1LKAA 2DB5A 4B73A 2YT8A 2H9EH 1E35B 3T62A 3ZVDA 4IC6A 3KHVA 1OKXA 4ABDA 5LPRA 2IWQA 1UTOA 2BVSH 1HLTH 4G69A 2YUYA 1C1NA 2KAIB 2YTWA 1UVPA 1YPJH 1HUTH 2BDYA 2PZDA 1GM1A 3LNXA 2KPLA 3T2NA 1CVWH 3L3TA 4K78A 4KFWA 4ABAA 1HAPH 2F43B 2EEHA 3RXKA 4ESTE 1M5ZA 1K1PA 2CJIA 2PHBA 2WL7A 4FVDA 1S0QA 1UK4A 3PMBB 1COWD 4JYUH 2P3TB 4LMMA 3TK6A 3NKKA 4GHQA 1LPGB 1W14U 5A8ZA 1G36A 5KGOA 4HTCH 5HFEA 4ZH8A 2F4LA 3AASA 1UW7A 3VB3A 1OSSA 1O2NA 5HIYA 2GT8A 3UQOA 3QLPH 3A84A 1LQDB 2H3MA 1HPGA 5HGGA 1CO7E 4JZEH 1FY5A 1TGSZ 4FUIA 4IMZA 3UUZA 3ZZ6A 1SGQE 1TMTH 2KM0A 3MOCA 1VJ9U 2DMZA 2Z9JA 1OZIA 1C1MA 3ZVEA 1HAHH 5HJ1A 5FX5A 3FZZA 1YGCH 2A5KA 5CHBA 3OE7D 2P3UB 3KEEA 4ZUHA 5KECA 3TSZA 1IOEA 2HOBA 5F8XA 4IS5A 4E05H 4F55A 1GJ7B 2WINI 4A1VA 1LPZB 3LKWA 1W0JD 2G4UA 4K8BA 4TY6A 1O3IA 1T31A 2EI8A 2UUKB 4AFUA 2DM8A 4K1TA 3TJUA 1RGQA 1JXPA 2BY6X 3CNRA 3P92A 4FXGH 1AQ7A 1EKBB 4IN2A 2PR3A 1WIFA 2OZFA 2F9NA 3LIWA 4Y76A 3GJ9A 3QO6A 1XUIA 3OY6U 1EUFA 1D3PB 2FOMB 1XKBC 1N7EA 1SVPA 2A4QA 2PV9B 1JWTA 1HJAB 1ZHPA 1ELGA 3SGAE 2AYWA 2H5CA 4EDJA 2ZGXH 4UE7H 1O5AB 8KME2 2OCVB 3T25A 2BD4A 2D8WA 3ZYEA 6CHAB 1A5IA 2BY9X 1KXFA 1HNEE 3QZQA 4BXSA 4CBOA 1MZAA 1X5QA 1AWHB 4IBLH 1QAUA 4INHA 3RMMH 3NGHA 3MU0A 4THNH 4X2YA 3F9FA 5C67A 2H2BA 1TNLA 2WPMS 4I8KA 2W4FA 5HEBA 2OD3B 2XC5A 2AERH 2A0QB 5FPYA 4AC9A 4Y11E 2G55A 2XBXA 1Q2WA 4OS5A 4NFEA 1O35A 1QL7A 2CMYA 3EAJA 4ASUD 1YCPK 1ZSJA 2BQWB 3BG4C 1GQ5A 1OX1A 1BMNH 1HV7A 3P8OA 1BJUA 1V6DA 4NNLA 1LVBA 3FP7E 1RTKA 2YOLA 2BD2A 1Z8IB 3QGJA 2DKRA 1TGCA 1P10A 4NIYA 2DC2A 4ASHA 2CXVA 4X6OA 1A0LA 1OP8A 1RIWC 2MHOA 3ZVCA 3SUZA 1SGNE 3SHWA 2RDLA 3U8TH 2KR7A 5EPYA 4B2CA 1K1IA 1WI4A 3QTVH 3U8RH 2I1NA 3TJVA 5FCRA 1UHBB 2P59A 5H3JA 4K8YA 1WH1A 4CHAB 1YYY1 5J4QA 3ZZDA 1QJ6B 3GY4A 2F9VA 3NCLA 2WV9A 3SUEA 4A7IB 3DFJA 4M9FA 1BTPA 1GMCF 5J4SA 1U39A 1C5TA 1NFUA 1KDQA 3OFND 3SU1A 1DLKB 1THPB 4JMYA 1Y59T 1C1TA 2F9UA 4ZKSU 3TNSA 4LZ4B 2BQ7B 4HI3A 3HGPA 3QX5H 1S84A 3VB4A 3HKIB 1AUTC 1C5MD 3T26A 2XC0A 4A1XA 3GISB 1CA0C 4BANB 1HJ8A 6GCHF 1VB7A 2YMSC 4O3TA 3PV5A 2KOMA 5BRRE 1KXEA 2TRMA 3UR6A 2SNWA 7ESTE 5EPNA 1W13U 2K20A 1IQKA 3GYMA 3GCOA 3M35A 4DVAU 2PLXA 3SV8A 1RTLA 3UR9A 1SG8B 1CQQA 2VWNA 1W12U 3OAAD 4GHTA 3ZZ7A 2FLRH 4I32A 1PDRA 2OXSA 3DHKH 2D26C 2IWPA 4K1EA 3TPIZ 4PROA 4HOPA 2EDPA 1RTFB 2ZDKA 1GMDG 5HM9A 1JIMA 1VCQA 4BTUB 3S7HB 2R9PA 4NMOA 2HNTF 1QY6A 1QL8A 2EA3A 3ID2A 3KCGH 1T7CA 5DG6A 2I0LA 2CGAA 3HVQC 5HFCA 3BTME 4TPIZ 1WF7A 3FVFB 3S9AA 1BRUP 3NFKA 5C1YA 2GD4B 5GCHG 1MFLA 1FX0B 1EAXA 1WV7H 5E2PA 4NWLA 3D65E 3TJNA 1BITA 1ELFA 1GHAF 3FY5A 3M5MA 2REYA 1KXCA 3PS4A 5B42A 1J9CH 1ZTKA 3BEUA 1TPAE 2BLWA 2CF9H 1O31A 4B2AA 2B5TB 4A5TS 1HIAA 2FN5A 4ZHAA 2G2LA 2AHME 5T6GA 1D9IA 1ELVA 3MU5A 5ILBA 1YCPM 2ZQ2A 1ETSH 1EPTA 3ODFA 1P3CA 2P8OC 1MQ5A 3WW7A 4ISHH 1CGIE 1GJ4H 2ODYB 2FOAA 1S81A 3ATKA 5C0UA 5HXFA 2UZCA 4JORA 3E90B 1DVAH 3Q00A 2CF8H 1O2IA 1W3CA 1F5KU 1FZZA 4L8NA 1NFXA 4CH8B 1HAOH 3SU3A 3P17H 3F3BA 1V2QT 2R3YA 1ELEE 2SNVA 3M7UA 4YOIA 2ZDAH 3M5NA 3LGWA 2LC6A 1O2WA 5HFFA 2BOKA 3SW2B 3TU7H 4AX9H 3VEQB 3ZVAA 4Y8YA 3BPUA 3BEFB 1P9SA 2HALA 3PTNA 4AMHA 3SU0A 1RJXB 1G30B 1NZQH 1SGYE 4Z0KA 1SQRA 2GZ9A 5AFZH 2QXJA 1UTQA 4NSVA 1C1QA 3Q77A 4J2YB 3DA9B 2ZDNA 1A46H 4FUEA 5G1DA 1GHVH 1LHDH 5GDSH 1BOQA 1SGCA 4RSPA 2ZCHP 2KOJA 5DP3A 1OYTH 3NUMA 1F0SA 2GCHF 3MNXA 4FETA 4X2WA 1TMBH 2Z17A 1PPHE 4WJG2 4DOQA 1VGCC 3O8DA 1UK2A 3BSQA 2X7ZA 1V2LT 1FDPA 4OS4A 5DP9A 3F0OA 2A45B 1Z8RA 4ZMAH 1O37A 4FUDA 1V2VT 4ISLA 1JRSA 1QA7A 3BTKE 2VPHA 5EJ1A 5JBCS 3VB7A 5GJ4B 1IQNA 1L2EA 1VKYA 2FOFA 2LELA 4YESB 2EXGA 4DT7B 2JH0D 4RT1A 3M7QA 2OINA 3BG4B 3V13A 1K1JA 3AXAA 2WPIS 3ZZ4A 1O2LA 4WYTA 3UOPA 1C2GA 1K22H 4O03A 2R0KA 2OTVA 5B6OA 1OWHA 3SI3H 5JBBS 3LT3A 1FPHH 3OY5U 2SGPE 1INCA 4H42U 2J2UA 1DSTA 4NFFA 1K9OE 1BMMH 1RIWB 1ZTJA 1NFWA 1Q3PA 2O8MA 2F0AA 3LJJA 4O9VA 5DP4A 1O3PB 1FV9A 1GDNA 3PMAB 5T6FA 1TBZH 2PGBB 2QF3A 3BTEE 4XSKU 1B0FA 2GGVB 1XMNB 4RI0A 3TMHA 1QL9A 1THRH 1YPHC 5GPIB 4FUGA 4QT8C 2XBVA 3E16B 1HAYB 3TIUA 5A8XA 2W5EA 3UQVA 1ABJH 2DE8A 2YUBA 2JIZD 3BTQE 2RA0A 5G4BA 2BB4A 5EZ0A 1O2XA 1BB0B 2AIPA 1L1NA 3N7DA 1LKBA 4K6YA 1P3EA 1W9OA 3U9AH 1EQ9A 2OQ5A 1CA0B 2A2XH 1AVXA 4ZXXH 2YMSB 2OUAA 3SJ9A 1O3MA 3TK5A 2P16A 5FHTA 1J15A 1QB6A 5L6NH 3SZEA 1O34A 1TQ0B 3EE0B 3DUXH 3HK3B 1DUAA 4Q2OA 5B6LA 1J14A 1FJSA 1GVLA 2GZ8A 1WXRA 3KL6A 1D6WA 2K8IA 3AK5A 2C90B 4J1YA 2H9HA 3BIUH 2PA1A 1Y5AT 1ESAA 4BAKB 4JOFA 1SGRE 2ZCLP 3M7TA 3PB1E 3I18A 2SGEE 1S6LA 1ZMLA 1GI4A 2HLDD 3QJMA 3GY3A 4X8TH 1UEPA 4CR9A 1GHZA 3GSLA 3OEED 2WPHS 1UK3A 1A3BH 1EJMA 1Z7KA 3RXJA 3TGJE 3T28A 5T6DA 1A0JA 1ZR0A 2VIWA 3ZVFA 1XXDA 2Y7ZA 3AAVA 3SOSA 1ZJKA 1JRTA 1VITF 2FE5A 4WMFA 1BA8B 2LC7A 1P02A 2BX3A 4FUJA 4H6SB 1KEFA 2MX6A 4JL7A 2ZPSA 1KYNA 4DJZB 3PDVA 2SGAA 1R6JA 3LH3A 2ZGHA 2VVCA 1C2HA 1OP0A 2QA9E 2LUIA 1ETRH 2QT5A 2WZQA 4GCHG 4AG2A 2GV7A 2EDZA 1S5SA 1TPOA 3MNSA 4NMVA 3I4WA 4U32A 1QURH 1K2I1 1P1DA 2I0IA 2XW9A 3LPRA 2AWXA 2VZ5A 2VWRA 1X5NA 3ZZAA 4NXPA 1RGWA 2ZFQH 1H8ED 3A7YA 3RXCA 5C2ZA 2ZC9H 5EXLA 4X6PA 5L2YH 2A2QH 3DSPA 1O3DA 3QUMP 2W6JD 1P2OA 1IHSH 4B6FA 4NG9H 2EEJA 5E0JA 2ZFRH 3QDOA 2M0UA 1QQ4A 1GJAB 4JOPA 1HJAC 4UDWH 2CSSA 2D8IA 2BD8A 1EAWA 2ZDVH 2VBCA 4CRDA 2WV5A 4DY7B 5LPEA 1W2KH 2Q1JA 2Y5HA 2PKAA 2BQ6B 2PP6A 1YCPH 2CN0H 2O8LA 1OYQA 2V6NA 2R3UA 3DORA 3RMLH 2OPGA 2ZPRA 1ZSLA 1K0HA 2ZFSA 1MH0A 2VIQA 2XYAA 4A6LA 1Y5UT 1OXGA 1UTKA 2PW8H 3CS0A 2OBQA 1BMLA 1GJ9B 4SGBE 4NIXA 3GCHC 3SHAH 1C2JA 2KAWA 2IJOB 2KCPA 2W6ID 1O0DH 2KJKA 2EQNA 2FP7B 2EJYA 2Q6GA 3RLYH 1O2PA 2BDHA 1ACBE 4JZFH 1EAUA 1OS8A 2DJTA 3A81A 1W7GH 3KQDA 4FU7A 1VCWA 3NRLA 1W0ZU 1UTJA 4TWYA 1ZMJA 1NM6A 1BQYA 1CT2E 4K60A 2XWBI 2VJ1A 3GICB 4Y71A 2ULLA 1C9TA 4NMTA 1B7XB 2I04A 1C2MA 2ZU3A 3I29A 1O3HA 1BTUA 1VGCB 4IC5A 3IWMA 1O32A 3GGEA 3EYDA 2GX4A 2UUYA 1TIOA 3RC4A 1BFEA 5DP8A 3P8FA 1JBUH 1ELBA 1ELDE 4E7NA 1WCZA 1E1RD 3VGCC 2J98A 1I16A 1EOLA 2BVXH 2GP9B 4YOGA 3KDKA 4CRGA 3LGUA 1CHGA 4NMPA 2FDAA 5AFYH 1TFXA 5F67A 3BTDE 1C5WB 1QA0A 2FCFA 1S85A 4YDPA 3MH6A 3TSVA 1XUKA 1TQ3A 4H4FA 2GDDA 3EGHC 1GI1A 1T4VH 4U30A 4AOQA 1EZUC 3AW0A 3N99A 1QCPA 5T1VA 2SGFE 4ZCNA 4ZXYH 4AFZA 1GHWH 1Y3UA 1V1TA 1LHFH 3RXUA 2Z9IA 2NU4E 1VZQH 1FN6A 5AHGH 3QZRA 1NU9A 2D92A 5DK1A 1O2MA 2A32A 1SLVB 1DLEA 4JK6A 1TP3A 2C8ZB 1UTNA 5DJ7A 2M10A 3E17A 2ZEBA 1V6BA 2PFEA 1GI6A 1TX7A 1ZRBA 3SOEA 1V2OT 3PM3A 4TY7A 3MYWA 1G9IE 1F5RA 2A4GA 2FI3E 2FTMA 4YOJA 3AVZA 2HGTH 3RXRA 2RCZA 5HDYA 3O8CA 1UF1A 4OGYA 3ZZ3A 4MNVA 1S82A 4HZHA 2F9OA 2P95A 4X6NA 1FNIA 1C1OA 1OOKB 1GHYH 2IN2A 3SU5A 1W11U 1YPEH 2HRVA 4K2YA 2EEKA 5DSFA 1DT2A 4Y79A 1O5CB 1QAVB 2ZTZA 1NS3A 2FS9A 4K3JA 4K1SA 3P8GA 2HE2A 3MNBA 4UFEH 3A89A 2O9QA 4WF8A 3FANA 2EV8A 1F7ZA 1GCDA 1DXPA 5E1YA 1MBQA 4YLUA 2BD7A 4ZHMU 2Y5GA 2XCNA 1TAWA 1DITH 5BPEA 2O2TA 1QRWA 1B5GH 2OC7A 3LDXH 1HYLA 3NXPA 2QF0A 4Y7BA 1LHCH 1IQJA 1NT1A 1QBOA 2Q6FA 2VWLA 1PPBH 2V3MA 1LHEH 1SC8U 1TNKA 3C27B 1UEQA 4FUCA 1FONA 3KIDU 2RG3A 1DXWA 3NCVA 3SI4H 3RMOH 1V2RT 3PV4A 1TP5A 5L30H 5A8YA 4X0WU 1AKSA 4P0CA 2FEQH 1UJUA 4IGDA 4E3BA 4JYVH 1N6DA 2WSSD 3V3MA 1PPCE 4HG6A 5HMAA 2IWOA 1NTPA 2ZFTA 1ELCA 1ANBA 4OEOA 3OYPA 2KRGA 3PLPA 1BCUH 1MTVA 2OC8A 4NIWA 4D76A 2FLBH 1SPJA 1VCPA 1G3EA 2HPPH 4XBBA 2R4HA 1K21H 3UIRA 4DURA 1AI8H 5T3HA 2KQFA 5DP7A 5HM2A 2WYGA 2HPQH 1GI3A 2AMQA 3D49H 4A92A 2D1JA 3UY9A 3SUDA 1HAZB 1CE5A 3DSOA 2AINA 1QB9A 1NC6A 2A31A 1P1EA 1W9EA 3GY8A 1WYKA 4KTCA 1C5NH 5HIZA 2JOAA 2XCFA 3WKLA 2ZHQH 2GTBA 4BNRA 1H4WA 1V2WT 4K72A 3RXMA 1T8OA 1O36A 5CDFE 1GL0E 3ZV8A 2C8XB 4X1SU 4OS6A 2BOHB 4B74A 1A3EH 1O3JA 1TABE 2BZ6H 3DJ3A 1Z6JH 2EI6A 1Z8GA 4B6EA 1FY3A 1GHBG 3BIVH 2B7DH 1GL1A 1GWAA 3PDZA 2L97A 2QGRA 1ZRKA 1BBRE 1MMJN 1A5GH 2AGIX 1GI2A 1GBDA 2RRMA 4NSYA 4JOHA 4A1TA 1IQFA 3GCHB 1TA6A 2M2AA 4DG4A 1D6RA 1N8OC 4NZLA 1NROH 1IHJA 4OS7A 1MFGA 1RGRA 1N7TA 2ODPA 2W7SA 1NRQH 1MAYA 1ZHMA 1WTGH 2J92A 1U37A 2BY7X 2ZQ1A 2F83A 1OWKA 1C5YB 4ISIH 4TPYA 1T32A 2H3LA 1O3CA 2CHAC 2LOBA 2TGTA 4X8VH 5ETXA 3SNCA 2ZTXA 3Q3KA 2KYLA 3UPEA 1ZTLA 3KYFA 1C2IA 4UFDH 2B9LA 3SJOA 1CHOG 3LC5A 1K28D 1JOUB 5AF9H 2W7RA 1ZPCA 3VGCB 4AN7A 4B75A 3RL7A 2Z9KA 4CRCA 1HAXB 2G5VA 1QBVH 1IQGA 3SV6A 1O5BB 2QV1A 4AYVB 4ZHLU 2HE4A 1C2KA 3SV9A 1ABIH 4NMRA 2BDBA 2BVRH 2Z9GA 4D7FA 4R8TB 1RS0A 1CGJE 2PUQH 1V2MT 1SGEE 4GVDA 3O8RA 1A61H 4OEPA 1SOZA 1F0UA 1WUNH 1ARCA 5DTHA 3PMHB 2AH4X 2J94A 1UVSH 3M3VA 1HFDA 2HVXA 1TBQH 4B2BA 3UREA 4Q6HA 3SGQE 1FY4A 1O3GA 2HNTE 2AIQA 2BY5X 3PRBA 1QR3E 1OBZA 1CT0E 5EGMA 3BF6H 2V90A 2Z6BD 4Y0YE 4YZUA 3SV7A 3BTFE 5E2OA 1HJ9A 1HAVA 4NA9H 3ZRTA 3RLWH 3UWJH 1WSSH 3PV2A 4Z6AH 3PYHA 4YM9A 3SV2H 1SGFG 1GJBB 3DIWA 1C4U2 1JIRA 4BOHA 1H9IE 2FO9A 5A0CA 1TA2A 2AEIH 3UB0A 4WVPE 1Q3XA 2KPKA 2F91A 1A4WH 3LGYA 4Y8ZA 3ZVBA 2Y6TA 4OGXA 4B76A 1WI2A 1MQ6A 1L1JA 2Z3EA 3SNBA 4RKJB 1PQAA 1FI8A 1C5OH 2BX4A 2KCAA 4FUFA 2M0TA 3UNRA 2Q9VA 4X1RU 5CHAC 5DN6D 1GGDC 2XTTB 3MO9A 3PLKA 1LHGH 1ZMNA 1KY9A 2OSGA 1QB1A 4X2XA 1KIGH 5PTPA 1LQEA 1AZ8A 2EI7A 1W8BH 2ZF0H 4Y6DA 1YPLH 4INKA 3CYYA 3O8BA 1BBRK 1WOFA 5EU8A 5C5NA 8LPRA 3BTHE 1FXYA 2VWMA 2FXRA 2GEFA 2L6OA 3HPTB 2ZGCA 4Q2PA 1MTWA 1TX6A 2TGPZ 1MAXA 3I77A 1W0KD 5F6MA 3ID1A 3A7VA 3DSGA 2VINA 3GDVA 1DPOA 1N6FA 3SN8A 4WXIA 1O5DH 1EOJA 3TK9A 1Z86A 2WHXA 3HKJB 4JK5A 1UVTH 4KP0A 3OTPA 1RRKA 2EEIA 1QGFA 1SBWA 4O06A 4Y7AA 3U98H 2FYRA 3GS9A 2WPDD 3S7KB 1SQOA 3EE7A 2J97A 3AAUA 3LGIA 1C1WH 1O2KA 2C3SA 4ACAA 1A1RA 4FU8A 2Y80A 3VPKA 3CP7A 5JB8S 1BZXE 1KTTB 1BTYA 3P6ZB 3CBXA 1HDTH 3TH4H 4P02A 3RXFA 3U8OH 4ZKRU 1QFKH 4JZ1A 1GI8B 1TRYA 2G51A 2Z3CA 2Q3GA 1SR5C 2FODA 3P95A 3UNQA 4NXRA 1Y8TA 3GABA 5DGJA 1O2JA 4XDEA 5EODA 1OWIA 1EB2A 3M3SA 1H9LB 1CU1A 4BTIB 1UJDA 4MTBA 2JXOA 1VAEA 4NXQA 1FQ3A 1FPCH 5E21A 1GBEA 2ZA5A 3GYLB 2LNCA 1RZXA 4NZQA 5F03A 2FESH 4D9QA 2VIOA 1UJ1A 1SL3A 4JYTA 4I8LA 1KXBA 3UFAA 4MG3A 1DFPA 3JZ1B 1TMUH 1K1MA 2QXGA 1DWEH 2ZKSA 2CV3A 2ESTE 5FX6A 2KZ4A 2WPJS 4MPAA 1ARBA 3VFEA 1ZPBA 2F9PA 2VWOA 3RXOA 2XBWA 3MHWU 2NU0E 1N8OB 3ATIA 1G32B 2KAIA 2FOCA 3A82A 1O3KA 4WXVA 4O97A 1CGHA 2QN5T 1TOMH 2FTLE 3D23A 3KN2A 4CRAA 3S9CA 4Q2NA 1IQEA 4TT3D 3NK8A 3NFLA 3RC6A 4AB8A 4ACBA 4BXWA 2H9TH 1QHRB 1DOJA 1XZ9A 2O8TA 2CHAB 1ANEA 3QTOH 4BTTB 1C1SA 3NPSA 1GMCG 4I7YH 4I86A 3ID3A 1GBHA 5F8TA 1EPTC 2C4FH 3U1IB 5C94A 2JSNA 3QWCH 4X2VA 1Z87A 1A7SA 2BDAA 2OK5A 1Z1IA 2QKUA 3IG6B 2L4TA 5E11A 2PGQB 2FX4A 2AWWA 1D4PB 2J4IA 3C1KA 1XXFA 1DWDH 3MNCA 1ESTA 2JWEA 2KA9A 1O3FA 2O8UA 4K69A 3I78A 1PPGE 1ZLRA 1BTZA 1Q7XA 2P94A 3PWBA 1XM1A 5EW1H 2XNIA 1TALA 4ABJA 3R0HA 2QIQA 2AMPA 1S83A 2J38A 1H1BA 1VJ6A 1VJAU 1WU1A 2STBE 4Q7YA 1Y7NA 3RXDA 2HGAA 2FPZA 5C1XA 1BMAA 4RN6A 1GDUA 1QIXB 2VVUA 3GY7A 4UFFH 2Z3DA 3ODDA 3RXHA 4OM9A 3T5FH 1UTMA 4MDSA 3KDGA 1G37A 3V0XA 1PQ8A 5E0HA 5E8EH 1TWXB 4XRNA 3MH4A 1ZGIA 1W9QA 1OBYA 2KBSA 3LOXA 3LH1A 5HKKD 2NU2E 4MLFB 2KL1A 4KTSA 1O2OA 2GMTC 1Y3XA 1FIZA 1FAKH 4JOKA 2BHGA 3RU4D 4FUHA 1WBGB 3SJIA 3K6YA 2EY4C 3E1XB 1E38B 1HB0B 2BD9A 2PTCE 4I8HA 1NO9H 1P04A 2QF5A 3VQFA 4LK4A 1WF8A 1EXFA 3FO8D 1F0RA 1C2EA 4TSFD 1FC6A 1GHAG 3ZYDA 8ESTE 4E34A 3EDXB 1NY22 5CHAB 3MI4A 1GGDB 1MCTA 1MTSA 5C17A 1ZSKA 3UNSA 1LVOA 1DICA 1QBNA 5DP6A 4YTAA 1P57B 2FYQA 4AZ2B 1CA8B 2A7JA 2AFQB 5FPTA 3HPMA 1AB9C 2YNAA 2QAAA 1P8VC 1WQSA 3L4FD 4E06H 4PQWA 1T8MA 4NWKA 4FLNA 1S6FA 4LXBH 4F48B 1G3CA 5IDKA 3WWBA 1W7XH 1C5XB 4JJ0A 2TGDA 5JYIA 7LPRA 3HK6B 1A0HB 2Y5FA 1CBWC 3Q3XA 1KSNA 1KDQB 1AFQC 2C93B 1C5LH 4KGAA 1QNJA 3EQ0H 1N6YA 1TGBA 2ZP0H 2ZDLA 1NU7B 5JBAS 5ABWA 2FOGA 1YBWA 4FU9A 2IPHA 3PRDA 3RLEA 1P2JA 5IL9A 1UHBA 2VH0A 1P2KA 1GVKB 1SQTA 1HGTH 1WJLA 2BM2A 2C8YB 3G01A 1O2RA 1ZOKA 3K9XB 4AG1A 1GBLA 3GCTG 1V2TT 3ZZ5A 4ZAEA 4CRBA 5TCCA 2BZAA 2FOEA 1NRSH 1AY6H 2UWLA 1EP5A 1TGNA 2H6MA 1KXAA 3MU8A 3SYJA 1WAYB 6ESTA 2ZHWH 3A7XA 2QKTA 1GJDB 1AO5A 1HXFH 1XUFA 1RXPA 5FXLA 2FI4E 5FBIA 1EZQA 1GBMA 1N7FA 3A87A 3E0PB 1OWJA 4FGMA 4HOPB 5TJXA 2RDEA 3KGPA 1UVUH 1FMGA 1Z1JA 5EQRA 4NMSA 3UWIA 1BHXB 2H2CA 1C4V2 2YNBA 1AVWA 4B71A 3HPKA 1J16A 2GT7A 2TBSA 3UAIC 2SGQE 1GBIA 2IJD1 1QZ8A 5HF1A 2GKVE 1KLTA 3LU9B 4ISNA 5E0GA 1Q31A 1D3DB 3SU6A 2J34A 3URDA 4N6XA 2NU1E 1WQVH 3EA7A 2XWAA 2SFAA 5DP5A 4ABIA 3MU1A 2BXTH 3QJNA 3T27A 4ZKOU 2W26A 2KJDA 1MZDA 1NESE 1OHHD 4JJ3A 1IQIA 4GPGA 5FPSA 3VB5A 1GI0A 1DWCH 1QJ1B 3GY5A 3ATMA 3A83A 3PMJA 1GHBF 5DPAA 2ZPLA 5JDUB 5C0TA 1S0RA 1U3BA 1P0SH 1ZJDA 2W7UA 4OS2A 1HIAB 2BMGB 2ZWLH 1QRXA 1L6OA 1AUJA 1DS2E 3GY2A 3IITA 5F53A 1V2KT 1O38A 1UCYE 1SKYE 1WDIA 2HWLB 1AU8A 4E7RG 1EPTB 1C9PA 2PKTA 5HYOA 2QXHA 1G2LA 3F6UH 2YMSD 3KZDA 4ISOA 2XXLA 3F9HA 4F4OC 2K1ZA 2STAE 1DY8A 4R0IA 3S0NA 5DO4H 1F5LA 2M0VA 5EJLA 1BUIA 2DLSA 1BMFD 1GJCB 3URCA 1L1GA 2VH6A 4KELA 2RA3A 2A5IA 4AORA 1O2HA 1ANCA 1AWFH 5IYTA 4P00A 4Z1MD 3RU4E 1NF3C 4JOJA 1YPKH 2K0QA 1HAGE 2QE7D 1MKWK 2IOTA 4JZDH 4MPVA 4ZKNU 4U01A 4K76A 1MABB 3BG8A 4AFQA 1V5QA 1QLCA 1IQMA 4UFGH 3SQEE 3ZVGA 4MNXA 3SHUA 2DE9A 1N6EA 1UFXA 1BBRH 2OGPA 2A4RA 1QJ7B 2W3KA 1GMHG 3FAOA 5EXNA 4ABBA 4Q7ZA 1V62A 3A80A 3SHCH 1O3OA 1OWEA 1XKAC 1C4Y2 2GJGA 4K5ZA 4GAWA 1ETTH 4NA7A 4NCYA 1L4ZA 4BAOB 3L6PA 1VITG 1QTFA 2D2DA 4H11A 3ZIAD 1C5SA 5HETA 2W3IA 1OWDA 1C1PA 2GMTB 2KFWA 2V7QD 1NBMD 2BXUH 3TJOA 2BY8X 3SGBE 1O5EH 4VGCC 4DT4A 1EB1H 2JH6D 2ZIQH 4F8KA 3STIA 1EFRD 1GBCA 1B0EA 1UMAH 1MKXK 4WYUA 1UTLM 2V3HH 5KEDA 1P01A 4F49A 4WMEA 1U38A 3RXAA 1X45A 5E6PB 1P06A 3ZZ8A 2OP9A 5CMXH 1O3AA 4O3UA 4YO9A 2M0ZA 3LGVA 1T4UH 3H7OA 1C5RA 2BDGA 3EA9A 4FOUC 3Q3YA 3H7TA 3TGIE 4Q6SA 1L4DA 2F3CE 4XHVA 1DM4B 3ID4A 1GMDF 2ZECA 2BDCA 2GDEH 2PKUA 1HAIH 3B23B 1ELTA 3RUOA 2PSXA 1DX5M 3F0PA 1AB9B 1DANH 2V1WA 4HGCA 1E37B 4JCNA 1C1UH 3A8AA 1GBKA 2AGGX 2QY0B 1E36B 2PTNA 2SGDE 1BTHH 3F2GA 2ALVA 2ZU4A 1MUEB 3M3TA 3DJ1A 1CBWB 3DJAA 2OS6A 2DAZA 5HFBA 1JMOH 4INLA 1EX3A 1MTNC 2WUCA 2OMJA 1QQUA 1AFQB 1MD8A 1AFEH 3LC3A 3F2FA 5GCHF 4X6MA 1TNIA 4KKDA 2BLVA 3MFJA 1UCYK 1XVOA 3ELAH 3LJOA 1EATA 1Y5BT 3P8NA 4GUXA 2EAQA 3E6PH 8GCHG 4OAJA 1FY1A 3SZNA 5HF4A 1ZOMA 1NRPH 1P12E 4M7GA 4D9RA 2L74A 4KFVA 3QIKA 4NNMA 5HFDA 1SFQB 1TPPA 1TRMA 4SGAE 3SNDA 1SGTA 1EZXC 1P05A 2NU3E 5K0HA 3GDSA 1OP2A 3KF2A 3RXPA 1SHYA 2RCEA 3VXFH 4UEHH 1HBTH 3WWFA 3F2HA 3ITIA 2FZZA 2BD3A 2AGEX 3RXBA 4GSOA 2VIDA 3QGLA 3BTGE 1S6HA 3R0FA 5SGAE 1BTXA 3MO3A 1WHDA 1ZUBA 3KQ5A 1THSH 1GBBA 1GPZA 2VGCC 2OCSA 4CR5A 3RXQA 1GBAA 4X1PU 2ZZUH 2AWUA 1Z6EA 1SQAA 2OC0A 2QYIA 2J9NA 3SUGA 2OLGA 5FB8C 1G3DA 3A8DA 1YBOA 4Y0ZE 5LGOA 1T8NA 5EIYA 5ESTE 3H09A 1WFVA 3BTWE 3ATLA 2QF4A 2ZHDA 1C2LA 3QDZB 1AVGH 1G2MA 2OQUA 3A7WA 3A8CA 1LO6A 2HLCA 3KQEA 3K65B 1GDQA 2BDIA 1H8IH 3P70B 1FLEE 3BN9A 1SI5H 3MQKC 2QG1A 1C5UA 1GG6C 1NFYA 4AB9A 4UU5A 1MTUA 1F0TA 1Z8JB 5K7RA 1GQ4A 1CT4E 3GDUA 1O2YA 1DUEA 1YWUA 7GCHG 2VSPA 2V35A 3CBZA 1YLNA 3A86A 1X7AC 1VA8A 1Y3WA 3F9EA 4I31A 2Z7FE 2VNTA 4Z8JA 1SLXB 5ESBA 1O5GH 1UHPA 4FVBA 2IPQX 2UWPA 2EDVA 3DD2H 1AHTH 5JXBA 3N7EA 4YLQH 7KMEH 2TGAA 1V2PT 1C5VA 1K32A 1HCGA 2UUFB 1GJ8B 3BEIB 1P03A 3SQHE 9ESTA 3QGNB 1B8QA 1Z71A 2EGNA 1L0ZA 2VVVA 3CC0A 1V2NT 2Z9LA 3W94A 1C1RA 4X8UH 1C2DA 1KTSB 1AGJA 1V3XA 2QBWA 3TGKE 5F3XA 5JB9S 5LH8A 2I4SA 1UEZA 2PNTA 2ZHEH 3TH3H 2V3OH 2G00A 3PO1C 4LZ1H 2BYGA 3JXTA 2PKAB 2PWXA 2EGKA 1O33A 1OPHB 4Y10E 3FP8E 3RP2A 1SLWB 2DUCA 1BJVA 1PQ5A 4Y8XA 1KWAA 1NBME 1TB6H 3AW1A 4NIVA 1MU8B 1K1OA 1C2FA 2PSYA 1O30A 1EZSC 2R0LA 1IQLA 1E34B 3SJKA 4LOYH 3SU4A 1HXEH 1W0YH 3M5LA 4YYXA 2ZCKP 4E35A 1V5LA 4UU6A 3PLBA 4Q2KA 2H1UA 3WY8A 2FWWA 3VB6A 4GVCA 2J5UA 2VSVA 1C1VH 3ZZBA 1LCYA 2CSJA 5GLJA 1EASA 3CS7A 3WKMA 2I6SA 3W95A 5TCAA 2P3WA 3RXEA 2GCTC 3LONA 4WH8A 1WFGA 2JDID 3KYGA 1XX9A 4AGKA 1YLCA 3DT0H 4DCDA 1P09A 4DGJA 5G1EA 2ZFPH 4VGCB 1ESBA 2J98B 3A7ZA 3MU4A 4I33A 4NA8A 3HATH 2AMDA 2RFKC 5EJZA 1TGTA 2OBOA 2PUXB 2VRFA 3RXLA 4ABFA 1LTOA 2EGOA 1SLUB 2G5MB 2HNTC 3RDZA 5EW2H 1YF4A 3S9BA 1F92A 1AE5A 3Q76A 5C1UA 1GI7B 2XBYA 2VIPA 1GBTA 3NZIA 4YT6H 3UOUA 1HRTH 5AVDA 4IMQA 2QKVA 1Y3VA 3LGTA 3RU4T 2KX4A 1I92A 4IN1A 3K50A 3RL8A 3R69A 9LPRA 1QRZA 1SSXA 2BLQA 1O2SA 1ORFA 1X6DA 3CH8A 2Y82A 2A7CA 1U6QA 1O2ZA 1FAXA 3TLOA 5FL7D 3M61U 2GV6A 3VXEH 3QN7A 1BRCE 4REYA 1BTWA 3OX7U 4I8JA 1YC0A 4FUBA 4MPXA 1MTNB 1UO6A 4TWWA 2JJ1D 1YM0A 4JOGA 2TPIZ 4XD7D 1XVMA 1NRRH 4GCHF 2YT7A 5EQQA 1X9ZA 2BTCE 2ALPA 1PYTD 2JETC 1VITH 3KQCA 3RXIA 2FS8A 1GI5A 2FIRH 2WUBA 3SJ8A 2ANWA 2A7HA 1D5GA 1GHXH 2ASUB 4MNYA 1FC7A 3EGGC 1BHXF 1WG6A 1P2MA 1T8LA 2I6VA 3MMGA 1O3BA 2HVYB 1LMWB 1FCFA 3ZV9A 1RFNA 5C3NA 3GY6A 1TX8A 2ZG0H 3JZ2B 1D3TB 1UJVA 1KMHB 1MCVA 3FOAA 4Q4LA 1EJNA 2ZNKH 4D8NA 4ABHA 4AGJA 1IQHA 1SFIA 3GCTF 2FM2A 1EJAA 5HEDA 2PKSC 3EGKH 2LA8A 3KZEA 2VGCB 1ZZZA 1RY4A 4XBCA 1YPHE 2D90A 3KHFA 3RXSA 3SO3A 1E79D 1MU6B 3HGNA 1YKTA 3SBKA 3S69A 1DWBH 5GXPA 1QAVA 3FN8A 1C5QA 1MBMA 2JKHA 1IU0A 3R68A 3MTYA 4MPWA 3UTUH 3SUFA 1O2VA 4IW4E 1GJ6A 2F5YA 4DW2U 1T2MA 2G5NA 2R2MB 4MPUA 3RXTA 1BT7A 1SOTA 1BE9A 3ZZ9A 4YT7H 3V7TA 1UVOA 2UUJB 2GVFA 1GG6B 1AKSB 3LNYA 1AN1E 5C5OA 1GCTC 1FIWA 1IAUA 2Y81A 3PROA 4NMQA 1A2CH 5EYZA 1MKWH 2H2ZA 2XNDD 3V12A 6LPRA 4XOJA 3SNAA 6GCHG 5A09A 4X1NU 1GVZA 1YLDA 1SB1H 1LPKB 3MWIU 2Q6DA 4GLYA 3O5NA 1PJPA 3U69H 4H6TA 2XC4A 1IU2A 1PPEE 1ID5H 4GHNA 1MC7A 1P2IA 2FOHA 3VQGA 2J95A 4WY3A 5GIBA 1YP9A 1IHTH 3RMNH 5I46H 1C5ZB 4BAMB 5F8ZA 1UEWA 5EOKA 2ANKH 1P2QA 2K1QA 1GBFA 2PDZA 1AMHA 1BIOA 1H8DH 3ESTA 3TNTA 4BAQB 5FBEA 3EA8A 1TNGA 3ZZCA 1OBXA 4I8GA 1XUJA 1P9UA 2ZGJA 1LVYA 1O2TA 3H5CB 1J8AA 4ABGA 5D13A 2R2WU 3A7TA 3PO1B 1G9OA 2C8WB 1TONA 4KTUA 4AYYB 1MKXH 2TIOA 3SU2A 1Q3OA 2ZHFH 1TRNA 2L4SA 2F9BH 3M37A 1XUHA 4Q63A 3RXGA 2EEGA 1YPGH 2IWNA 1V2ST 4ABEA 3E8LA 4Z33A 1SGIB 1NTEA 2JINA 1E1QD 2EC9H 2G81E 3SFJA 1VR1H 3F1SB 1GJ5H 1F2SE 1UM1A 2XRCA 2BYAX 2KCYA 1ZYOA 2FMJA 1SHHB 1O3NA 4U2WA 3QK1A 1KXDA 2G4TA 3DFLA 3SNEA 3RXVA 4CH2B 3DCLA 1N99A 5IK2D 1BRAA 4CREA 1WHAA 1H9HE 4HFPB 4DIIH 1SMFE 1AZZA 3K6ZA 1FUJA 3STJA 1UM7A 2GZVA 2ILNA 5A2PA 1KLJH 4WMDA 1CSOE 2GCTB 3PWCA 1O3EA 3OSYA 2A5AA 4AFSA 1E0FD 2ZTYA 2LPRA 3NWUA 5A0BA 1N1LA 5HEYA 3M36A 1GMHF 2B8OH 4P2AB 1O2GH 2Z94A 5FCKA 5A0AE 3A85A 2ZPQA 1P11E 2P93A 1SGDE 1UCYH 2A4OA 1XUGA 5CE1A 4Q80A 1G3BA 2QCYA 1TE0A 2M3MA 4UD9H 2B0FA 3O46A 1TNHA 3QE1A 3OEHD 1A5HA 4TYDA 4UONA 1O5FH 3A8BA 5GNDA 1PPFE 2THFB 5A2MH 3E91A 3FFGA 2E7KA 3SORA 1TOCB 4XFQA 1UITA 3M5OA 3FKSD 3ATWA 1MD7A 2KCOA 2M5TA 4B1TA 3VG8A 1AIXH 1KLIH
chains in the Genus database with same CATH topology
3TSWA 1NPMA 3MH5A 2I6QA 3RM0H 1RD3B 5EXMA 3TH2H 1BRBE 1SGPE 1GBJA 4MNWA 2OC1A 2JIKA 2P3FH 1HAVB 1AE8H 2GCHG 2P8OB 5GWZA 4RKOB 2JETB 1AD8H 1K1NA 1PQ7A 5JPMH 1TPSA 1V2JT 2BLOA 2ZGBH 3E0NB 5H4IB 3K1RA 1P2NA 2ZI2H 4WH6A 6CHAC 5I25A 3RM2H 3D62A 1O39A 5C20A 3I1EA 4MQAA 1O3LA 3ENSB 1ZHRA 3B9FH 1V2UT 2WPLS 1DE7H 1WTHD 2KG2A 2V0BA 2Y7XA 3OU0A 2JILA 1TNJA 2FX6A 2O8WA 8GCHF 5JBTA 1ANDA 1PYTC 3R3GB 3A88A 2QC2A 2OQSA 1ZPZA 2A1DB 3T29A 3OTJE 3TVJB 4X1QU 2PKSB 1D3QB 4BAHB 1GI9B 1DY9A 3B8JA 5EQSA 2NWNA 4K75A 1C5PA 4GVUA 2ANYA 5LPFA 3KNXA 4XBDA 1TYNA 3E3TA 3N7OA 2VIVA 2VB0A 1Y3YA 4CRFA 4JZIA 1YPMH 1TQ7B 2WYJA 1EP6A 1ELAA 1LDTT 2KV8A 3B76A 1BDAA 4OS1A 2VU8E 3K82A 1DSUA 2ZU1A 1O2UA 3KQBA 2ZFFH 1NRNH 4JOEA 3MH7A 4ZROA 1X8SA 3K2UA 2WPKS 1N6XA 2WV4A 4CHAC 1M9UA 2ZU5A 1FY8E 2ANMH 2FOBA 4R2ZA 2ZU2A 1GCTB 1K1LA 3GCNA 5I7ZA 1J17T 1LVMA 1PFXC 3F68H 3FP6E 3GOVB 2FI5E 5FAHA 4D7GA 1DDJA 1TBRH 1CHOF 1SGFA 3FZDA 2QXIA 4Q7XA 1O2QA 5DKMA 2DLUA 1ZGVA 2EHRA 4Q2QA 3PTBA 4WWYA 2GZ7A 1FC9A 4NGAH 2G8TA 2JREA 7GCHF 2ZPMA 3BV9B 3CBYA 1UTPA 2G52A 5EG4A 1EAIA 1PPZA 2ZDMA 3TITA 2KOHA 5L2ZH 1FN8A 1TLDA 2ZO3H 2ENOA 4DIHH 1W10U 3CENA 4MVNA 1NN6A 5E22A 3F9GA 3U1JB 4XE4A 3RC5A 3L33A 2AS9A 1X5RA 3BTTE 2CS5A 2FNEA 2BD5A 2KJPA 2UWOA 2H5DA 3MO6A 2JH5D 2ODQA 4X8SH 4CBNA 4Q3HA 1LKAA 2DB5A 4B73A 2YT8A 2H9EH 1E35B 3T62A 3ZVDA 4IC6A 3KHVA 1OKXA 4ABDA 5LPRA 2IWQA 1UTOA 2BVSH 1HLTH 4G69A 2YUYA 1C1NA 2KAIB 2YTWA 1UVPA 1YPJH 1HUTH 2BDYA 2PZDA 1GM1A 3LNXA 2KPLA 3T2NA 1CVWH 3L3TA 4K78A 4KFWA 4ABAA 1HAPH 2EEHA 3RXKA 4ESTE 1M5ZA 1K1PA 2CJIA 2PHBA 2WL7A 4FVDA 1S0QA 1UK4A 3PMBB 4JYUH 2P3TB 4LMMA 3TK6A 3NKKA 4GHQA 1LPGB 1W14U 5A8ZA 1G36A 4HTCH 5HFEA 4ZH8A 3AASA 3VB3A 1OSSA 1O2NA 2GT8A 3UQOA 3QLPH 3A84A 1LQDB 2H3MA 1HPGA 5HGGA 1CO7E 4JZEH 1FY5A 1TGSZ 4FUIA 4IMZA 3UUZA 3ZZ6A 1SGQE 1TMTH 3MOCA 1VJ9U 2DMZA 2Z9JA 1OZIA 1C1MA 3ZVEA 1HAHH 5HJ1A 5FX5A 3FZZA 1YGCH 2A5KA 2P3UB 3KEEA 4ZUHA 3TSZA 1IOEA 2HOBA 5F8XA 4IS5A 4E05H 1GJ7B 2WINI 4A1VA 1LPZB 3LKWA 2G4UA 4K8BA 4TY6A 1O3IA 1T31A 2EI8A 2UUKB 4AFUA 2DM8A 4K1TA 3TJUA 1RGQA 1JXPA 2BY6X 3P92A 4FXGH