3MH7A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 86
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh7A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh7A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh7A01
4BAQB 1ZTJA 2ZDKA 2WYGA 2FEQH 2VH0A 1JXPA 4B74A 1UVTH 1LPGB 5HJ1A 2FDAA 5JPMH 1QAVA 1XUJA 1OOKB 4Z33A 1S83A 2FI5E 3E3TA 3OY6U 1CGHA 3Q3KA 2P3FH 3F1SB 4JL7A 1TOMH 1UEQA 1C4V2 2ZWLH 6LPRA 1O3CA 2OUAA 3URDA 3SU1A 2BDGA 4ZMAH 4JZIA 5A2MH 3SFJA 3RP2A 1S0QA 1OWKA 4Q6HA 2A1DB 1NFXA 4GPGA 4X2XA 4X8VH 3STJA 1UEWA 1MKXH 5FPTA 1O2MA 5EU8A 1O2VA 2FO9A 3ZZ7A 1AU8A 1GI0A 1X5RA 1SGFG 3LT3A 3UQVA 1OBZA 2E7KA 1MU6B 5CMXH 3ID4A 3ZRTA 1K1NA 2ZEBA 1ZMLA 1ZUBA 3NGHA 2ZECA 4YOIA 1SLXB 3SU4A 3BTHE 6CHAB 1AGJA 2GD4B 4YTAA 1QB6A 1V2WT 2HGAA 3TK9A 2R3YA 1WTHD 1UFXA 1GBMA 1CT0E 2FZZA 4LZ4B 2VVUA 1C1OA 3E8LA 7ESTE 4MNXA 1PQ5A 4OS1A 1KEFA 1O2PA 1LVOA 1O2WA 2XCNA 2QF3A 2STAE 3P8FA 1MTNC 5G1DA 3KNXA 4AFQA 1HUTH 4AZ2B 1SGTA 1C2GA 1JBUH 4YESB 4FGMA 1DY9A 1O2YA 5HEDA 3P6ZB 2BY8X 4WMEA 3UNSA 3VXFH 1YC0A 1CT2E 2XNIA 5L2ZH 1V3XA 1QAVB 2LC6A 1C2EA 1GCTB 4AGKA 4Y7BA 1FAKH 4HI3A 3K50A 9ESTA 3S9CA 2Y82A 3A84A 3BTTE 1ACBE 2ODQA 2DLSA 1A5GH 1MZAA 2D26C 4CRGA 3F9FA 2SGPE 2Z3CA 2PKAA 3G01A 2C93B 3C1KA 4AB9A 2ZGXH 1TMTH 1WI2A 5JB8S 4K78A 2XBVA 1YPJH 5JXBA 2B8OH 4X6MA 1O3BA 1V5LA 2W3KA 2RCEA 2O9QA 3LH3A 2M3MA 1C5OH 1SB1H 4ZHMU 3SUGA 5A0CA 2AWUA 1O2LA 1H4WA 2YNAA 3MU4A 4E34A 2FM2A 3HGNA 4AMHA 2VWLA 3BIUH 4H11A 3MYWA 2FOGA 2QV1A 3VGCC 1K28D 1NZQH 1GMDG 1O2XA 3BG4C 5DP5A 1TGSZ 3RU4D 2BZ6H 3KHFA 1PPBH 1TAWA 3SNDA 3IWMA 3AXAA 1A0LA 1WUNH 1AE8H 2NU4E 5GWZA 1ZMJA 1Y5AT 1O2JA 2O8LA 1W7GH 1AN1E 2SGQE 1C2KA 4K5ZA 4VGCC 4E7RG 5EYZA 1CBWC 1G36A 1O32A 1BTWA 3GYMA 4OAJA 3ITIA 4Y71A 1GGDC 2ALPA 1A5IA 1LCYA 3D23A 1L4DA 1Z86A 8ESTE 1A46H 3PO1C 1BBRK 2AMPA 1C2LA 2K1QA 1EAIA 2HGTH 3SUDA 1SLVB 5E2PA 4GLYA 2OC7A 2R2WU 2BQ6B 3H7OA 1L0ZA 1LKBA 2WPHS 4JORA 3PMJA 1SGIB 1TNGA 4TPIZ 1TQ0B 4JOHA 1Y3XA 3HGPA 2UWPA 5I25A 1ZZZA 3PMBB 1ELCA 4WY3A 1I92A 4BNRA 1IQEA 1MAXA 1UTKA 2FI4E 2VB0A 1TONA 1Y3YA 2J95A 2Q1JA 2KG2A 4KTSA 3O5NA 5FPSA 2GCTB 1FY3A 2QBWA 2Z17A 3LGUA 1ZRBA 5EGMA 1IU0A 3SN8A 3A7XA 1XZ9A 1A7SA 1F0UA 1BTPA 1MFGA 1FC7A 1FI8A 7GCHG 1P8VC 3GCNA 2A2QH 3FANA 2SGFE 1LPZB 4GVUA 1KXAA 1C1VH 3RXQA 1GMDF 1KLJH 2I0IA 1K1JA 1D6WA 1FMGA 3K82A 2FOBA 1O5GH 1D3TB 1AFQC 1UTJA 1EZQA 2HRVA 3MNXA 2A5IA 1QNJA 2EI7A 2A7CA 2JINA 1O2UA 2OC0A 5ETXA 2YTWA 3DJ1A 1QJ7B 3LGIA 3RXGA 4F4OC 8LPRA 1GG6B 4PROA 1QJ6B 3SU2A 1C4Y2 3JZ2B 3B23B 4FUBA 5L30H 1XM1A 3K6YA 2AWXA 1K9OE 1MUEB 5DGJA 4I31A 3ZVAA 2WL7A 2AGIX 3F9GA 3FAOA 4ZROA 3A88A 4O97A 2GT7A 4ZKRU 1T2MA 1DDJA 2ZFQH 2ZHEH 1TGCA 4I8HA 5PTPA 2XBWA 2W7SA 5A0BA 2O8MA 3R0HA 1GI6A 1AQ7A 3I77A 4YZUA 1A3BH 4NA8A 4E3BA 1HFDA 3DA9B 1WBGB 3M35A 2H5DA 1O5CB 4JYVH 1O3HA 4O9VA 1HAHH 4DCDA 1QRXA 1W0ZU 2CHAC 1EB1H 2QXGA 1ETTH 3VB6A 3A83A 1JRTA 2FS9A 1OP0A 3U69H 2NWNA 1S0RA 3QUMP 4NFEA 1C2DA 4BTTB 1WSSH 3TIUA 5DK1A 4DOQA 2G8TA 4UD9H 1NRQH 3F9HA 4AYYB 3SHUA 1GJCB 1ARBA 3ZZ5A 4I8KA 3SJ9A 4FUHA 3KEEA 1JRSA 3TSVA 2BXUH 2XRCA 3E0NB 3DUXH 1XVOA 1GBIA 2BDBA 4IW4E 2BYAX 2H1UA 1C5QA 1NTPA 1SGFA 3K2UA 3M5OA 3MFJA 3T28A 1U37A 5FB8C 1X8SA 1Y3UA 2R0LA 1BJVA 1E36B 2KBSA 1RTKA 1C5SA 1YPEH 2GDDA 4MDSA 3TJVA 1UVOA 5FBIA 1Z6JH 4K3JA 2UUKB 3SNBA 4ISOA 3URCA 3GY4A 3GISB 1OKXA 3HK3B 3KCGH 4Q7YA 4BAOB 2GGVB 1MTSA 3QX5H 4WYTA 1GHWH 2ESTE 1KDQB 1H8DH 2IWOA 1HJ8A 1SGRE 4GCHF 2GZVA 5GCHG 1MMJN 1GJ4H 3OX7U 2O8UA 5GPIB 2M10A 2KA9A 3R69A 5FHTA 1GJ9B 3WKLA 2Y7XA 2KOMA 3ZV9A 3LU9B 1KXFA 1QQUA 2SNWA 3N7OA 3B76A 1X5QA 3M3VA 1BQYA 3GY8A 4AOQA 1GI7B 1P57B 1QFKH 3BG8A 1DS2E 5EQSA 1DVAH 1T8LA 2NU2E 3KQEA 2BDAA 1IOEA 1UTLM 2ZHFH 1FNIA 1IQJA 2BVSH 4Q80A 2P94A 3BV9B 2M0UA 1D5GA 1HXFH 2Q6FA 3AASA 3MNBA 3NK8A 1WCZA 4U32A 2F9OA 2ZQ1A 4ESTE 4O03A 2FX6A 3RXIA 5E11A 3L6PA 4I8GA 5FX6A 3BF6H 2HNTE 2YUBA 3P8GA 1JWTA 1OBYA 1TGTA 2R0KA 1TNHA 1TBZH 2Y7ZA 5AHGH 4DG4A 3RLEA 3E90B 1AUTC 2CSSA 3ODFA 5C5NA 1O3GA 3LNXA 1C1SA 5DPAA 1EUFA 4X2WA 4D9RA 4CHAB 4WVPE 1RTLA 1V2TT 3FP6E 1ZMNA 3P95A 1V2JT 1V2UT 1AB9B 3A8BA 4MPAA 2FP7B 5HETA 3MU5A 2F0AA 3LDXH 1N8OC 4XBCA 1VJ9U 3LC5A 2UZCA 2H9EH 1MCVA 4HTCH 2G52A 1E35B 1ZSKA 1I16A 2AIQA 4F8KA 1UM1A 1ANEA 1D9IA 4WYUA 2KOHA 2GZ9A 1M5ZA 3ZZ8A 1T4UH 3A85A 1UHPA 1ZSJA 4K72A 4Z8JA 5LH8A 1HAIH 1TPPA 4HOPB 3R68A 2YOLA 2KJDA 1K1IA 2GTBA 1P10A 2VINA 1KLTA 5HFFA 1KY9A 4NMTA 1GCDA 1L1GA 2Q6DA 3U8TH 2OQSA 2ZGCA 3ZVBA 3ZZ3A 2RA3A 1O3LA 1GI2A 3RXCA 1O2ZA 3NCLA 1DICA 2B9LA 2VGCC 1W13U 1ZJKA 1W0YH 5FXLA 5K0HA 4ZHLU 1PDRA 3GCTF 1A0HB 4ZH8A 3BTGE 1SGPE 3KQDA 1QB9A 4KTCA 1SLUB 3AW1A 3TGKE 4WMFA 5JBTA 2H9TH 2ZHDA 2H6MA 1SOZA 3QZQA 3E0PB 1G9IE 3FVFB 4IS5A 1OX1A 3MH5A 3UNQA 1NRSH 3CH8A 3EGKH 1O2KA 2JETB 2ZU2A 3H5CB 2PKSB 2ZQ2A 3R0FA 4GVDA 1BT7A 4RN6A 2BOKA 5T3HA 3V12A 1SLWB 2ANYA 4OS2A 1O3OA 2REYA 2GP9B 3VFEA 3UQOA 3PLPA 3GY3A 3TGIE 1UJ1A 1O33A 2VWNA 2ALVA 4MPXA 2BDIA 2I6SA 1P2KA 4O3UA 1YPHE 4NNLA 2C8WB 1MBMA 1LHDH 1KSNA 3TPIZ 2WPIS 4MLFB 5JB9S 2BQWB 5GLJA 1RRKA 1V2QT 1RZXA 1WH1A 1OWJA 2GDEH 2VU8E 1FIWA 1C5YB 2H2ZA 2GKVE 2P8OC 1MBQA 5HEYA 3LIWA 1C2JA 1WIFA 3A7VA 3NWUA 1JMOH 1J14A 3ZZ4A 2V35A 4KKDA 1BTXA 1DX5M 1SFIA 1O31A 3MH6A 4K6YA 1KTTB 3TNTA 2FXRA 1C1PA 2FPZA 1DXWA 2JREA 1FY1A 1FAXA 3MO3A 2KYLA 5FX5A 1BBRH 1NTEA 5EXMA 1BMMH 2OCVB 2EDVA 2PZDA 2ENOA 1J8AA 2PV9B 1ZHPA 2ZIQH 4YOJA 1MD7A 3PDZA 3LGTA 1UO6A 1O5EH 5JYIA 2VPHA 2FNEA 5I7ZA 4WWYA 1OPHB 5HYOA 3SV2H 1X45A 1MD8A 4NIXA 4X8SH 1SSXA 4ZXYH 3SUZA 3EQ0H 3SBKA 2I4SA 1Y8TA 4BANB 1AIXH 1TGBA 2DM8A 2Z3DA 2AINA 2BX3A 4Y7AA 3VEQB 1ELBA 4DIIH 1NN6A 2AH4X 4K1SA 1ORFA 4G69A 1V2RT 3CP7A 2TGPZ 3SV8A 3GCOA 2AIPA 2Y6TA 2WPKS 5F8ZA 2YUYA 1C5MD 2ZHWH 1P2QA 1O2NA 4OS6A 4X6OA 1GI9B 5J4QA 1YGCH 4ZKNU 2UUFB 3BEIB 2VNTA 4M7GA 7LPRA 3A86A 2P3WA 3QIKA 1ETSH 4A1TA 2OINA 1CA8B 2KAWA 4LMMA 4BTIB 2PUQH 3UY9A 3I1EA 4MNVA 3QN7A 1U38A 1MKWH 1UK4A 1ARCA 1O3KA 1K22H 4CRAA 4X1RU 1PYTC 2Q6GA 3OY5U 2G5MB 1SBWA 4GVCA 5CHAB 1ZOKA 1SHYA 2OBOA 1EP5A 1GJ8B 3BIVH 2BVRH 1P2NA 4JZDH 1V2OT 2ZTYA 5LGOA 2XCFA 3A8DA 1H8IH 2CMYA 4Y8XA 1C1UH 2OC8A 1GI8B 3GCHC 1PYTD 5GIBA 1SGEE 4DJZB 4OEPA 2PR3A 4NMSA 5HFBA 3PV5A 4IMQA 4XOJA 3U8OH 3ZZBA 3RDZA 4KFVA 2I6VA 5EZ0A 1ESBA 1VITG 3LKWA 3STIA 2VWOA 4PQWA 3V3MA 3O8BA 5G4BA 4X8UH 1SGCA 1EQ9A 1ZPCA 2H3LA 1P04A 2QKVA 1WQSA 2PTNA 2STBE 1K1PA 3M5NA 3RMLH 4ABIA 2G81E 1BJUA 5LPEA 4TYDA 3TNSA 2D8WA 3BTFE 1OWIA 3SNEA 4A1VA 4CRDA 3RXEA 5EW2H 1LPKB 4JZEH 3F6UH 2VH6A 1QGFA 1WG6A 1DE7H 3GYLB 2CN0H 1YBOA 5F8TA 1YBWA 2AGEX 5SGAE 1GJDB 2FOFA 5DP4A 3KL6A 1GQ5A 3UPEA 4Y8ZA 3TH3H 2XXLA 5CE1A 1SPJA 3S0NA 1AFEH 3CYYA 4UU6A 4OS5A 2PSXA 2QG1A 1DXPA 1AI8H 5TJXA 2Z6BD 2ZA5A 3UIRA 3T29A 5A09A 1TNJA 2ZGJA 1PPGE 3ZVGA 1WF7A 3KQBA 3LJOA 4GHNA 1MTNB 1TMBH 3LC3A 1ABJH 4A7IB 1LHEH 3PWBA 3RXTA 3T25A 2PGBB 2ULLA 3T2NA 1N6EA 2VJ1A 2GX4A 1Y3VA 2KPLA 1L4ZA 3UOPA 3O8RA 4A1XA 1NRNH 2W7UA 3WY8A 1GDNA 2B0FA 5EQRA 1IHSH 1FCFA 1T8OA 3M3SA 4ZUHA 2BB4A 4Y11E 3RU4T 4NSYA 4BOHA 1O5BB 4WXIA 1EJAA 4A92A 4JZ1A 2SGEE 2MHOA 1S84A 1LHGH 3QTVH 4NSVA 4ZAEA 1GHZA 4FUFA 3AW0A 2HVXA 4X2VA 3RU4E 2FOAA 1LTOA 4JYTA 4JCNA 1GL0E 1DSTA 3UOUA 4YO9A 2VVVA 2SGAA 3FY5A 1TNIA 1IQGA 1HJAB 1BITA 1SFQB 3A7YA 3AAUA 6CHAC 3A7WA 3VGCB 3RXSA 5J4SA 1D6RA 3BG4B 5EXLA 1G3BA 2ZG0H 1AO5A 1EJMA 2YT7A 2AMQA 1WYKA 2PW8H 4TY6A 3GY7A 2IWPA 5B6LA 2ANWA 1DM4B 3MH4A 3A87A 2A4GA 1KXCA 2THFB 2ZU4A 2HNTF 1NFYA 1C5TA 3SGBE 3GDUA 1FDPA 3U8RH 1EP6A 4K8YA 1BZXE 1WV7H 1V62A 2I1NA 3OSYA 2KJPA 1BRUP 4VGCB 3V13A 1ANCA 1CBWB 3T27A 4XHVA 5C67A 1GBEA 1Y5BT 1TNKA 3E1XB 1ZTLA 1GGDB 1WAYB 2L97A 2WUCA 4FU9A 3R3GB 1OWDA 1FV9A 2ZGBH 1P09A 2V6NA 1C4U2 1PJPA 1P01A 2V1WA 3P70B 1V2PT 3PO1B 2A45B 1GBKA 4NA7A 1RD3B 2Y80A 1G9OA 1YPLH 4YYXA 4XBBA 1FPCH 1E0FD 8GCHG 2GMTB 1VR1H 1W9OA 2F9VA 1GHAG 1C9PA 2VIPA 1W9EA 1F0RA 3EAJA 1ZGIA 3KN2A 1QL7A 2A7HA 4X6NA 4JK5A 1QHRB 1GHXH 3KIDU 3PM3A 2H2BA 1TQ7B 3RM2H 5A0AE 1H9IE 2JXOA 4R0IA 3PLBA 1FN6A 2FOHA 4NMOA 3BN9A 1BMAA 1ESTA 4DVAU 4B2CA 1PPFE 3ZZ9A 3LGVA 4ABHA 2CGAA 2BDCA 4D8NA 1HBTH 2BD5A 4JZFH 1NT1A 1UMAH 1ID5H 4U30A 3MO9A 1WHDA 3BTQE 3Q76A 2Z9LA 1ZHMA 1K1OA 1SQAA 3SW2B 3K9XB 4GSOA 2CV3A 1AFQB 2OCSA 3EE0B 3VB4A 1O3IA 3TJNA 3IITA 1AY6H 2IN2A 1BMNH 1EPTB 3SJ8A 1HPGA 1L1JA 2FWWA 5BRRE 4CH2B 4P2AB 3GSLA 4ASHA 3BEUA 2V90A 1H1BA 5EODA 1NY22 1ABIH 2HLCA 3M7TA 1K2I1 3NFKA 3EA7A 5AF9H 2Z9IA 2FESH 1N7TA 1W2KH 3PS4A 4Q2NA 4MTBA 2KRGA 1GPZA 1YF4A 4NWKA 1EZUC 2RDLA 3TJUA 1IU2A 1HYLA 2QY0B 4E7NA 3QWCH 2KPKA 1G32B 1HDTH 1KDQA 3VQGA 2YNBA 3TITA 3GY2A 4BTUB 2R3UA 1GHAF 4Q3HA 2QF0A 4IC6A 1EAWA 4WH6A 4AFZA 1TIOA 2F3CE 4WH8A 1Y5UT 2EGOA 1F5LA 2PFEA 1RIWC 1C5LH 1O2IA 5I46H 1NFUA 1A61H 4Y8YA 2GCTC 4AFSA 1B7XB 2A2XH 2ZFRH 3M3TA 4A6LA 3UNRA 1RGRA 1A0JA 2J92A 2GZ8A 1V2ST 4RSPA 4FUEA 2BMGB 1ZJDA 1ZHRA 1TYNA 2HWLB 1C2HA 3SU5A 4JK6A 4DGJA 1Q7XA 3PLKA 3SUFA 1GDQA 1GI4A 3O8CA 1YPKH 3DORA 5HXFA 1HAVB 3RMNH 3A89A 4SGBE 2D2DA 2BVXH 1GJAB 1BE9A 1MCTA 1C5NH 1UCYH 2UUJB 1TP5A 2FX4A 1O3EA 1EZSC 4UFDH 1XX9A 2MX6A 4RKOB 2KOJA 3F68H 4NZLA 1O36A 3NZIA 1INCA 2ZO3H 4BAHB 2J94A 4FUIA 3S7KB 1KWAA 7GCHF 1VJ6A 1DLKB 1O30A 3GOVB 2PKTA 2EDZA 2DLUA 1F5RA 2J38A 1QY6A 1XKAC 2XC4A 2LC7A 3P92A 3SOEA 2EI8A 5DP6A 2BD3A 5AVDA 1RS0A 1YM0A 3RLWH 1E38B 2H9HA 2A7JA 2EHRA 3EGGC 3E16B 1SOTA 1GHBG 1O2QA 2WV4A 1NU7B 2PSYA 2W4FA 1W10U 1GI1A 1O2GH 1ANDA 4NCYA 2O8TA 1WOFA 5GJ4B 3TU7H 1C5WB 4AYVB 3K1RA 3GGEA 2EDPA 1YPGH 2ZPSA 1V2VT 3RUOA 4YOGA 2BY9X 3RMOH 4HOPA 1TABE 2PNTA 4EDJA 1GBLA 1UVPA 1XKBC 1B0FA 1OWEA 1GMCG 1MTVA 3RL8A 4NA9H 2Y5GA 4THNH 3DIWA 3S69A 3SNAA 4Y0ZE 4NXQA 4E35A 2F9NA 3ZZDA 3TJOA 3OTJE 1EZXC 3RXHA 2AWWA 4ZXXH 4REYA 2QXIA 4MPWA 4GUXA 2KAIB 1UVSH 1Y59T 2NU1E 1GVLA 4UE7H 2V0BA 3QLPH 4MVNA 1HXEH 3KQCA 2OQ5A 2LA8A 3SV6A 3NFLA 1AUJA 1K32A 1UTMA 1EX3A 1G37A 2HOBA 1FC6A 1A5HA 5HF1A 2UWOA 4YDPA 4FVBA 4NMPA 1F2SE 1MC7A 1P02A 1SHHB 1V1TA 2K1ZA 3SZNA 3U98H 1DY8A 2P95A 1UITA 1RTFB 1SVPA 1SQOA 1Z8JB 4Z6AH 2PDZA 3BTDE 4UONA 5EPNA 1ELAA 4CRBA 2EEIA 3I29A 1XVMA 3SI4H 2FLBH 1C2MA 5K7RA 1C1NA 1V2MT 2OSGA 5HDYA 1TALA 2R4HA 4B1TA 4NFFA 1F0SA 5E1YA 1HB0B 3TVJB 2ANKH 5GCHF 3DFJA 2XWAA 2OC1A 2Y81A 4E06H 1EB2A 6ESTA 1QAUA 3HATH 1ZOMA 1UK2A 1XUFA 1QQ4A 3QGNB 4Q2QA 1EKBB 1G3DA 4B2BA 1D3PB 1GVZA 4ABBA 1AHTH 3ATIA 3MNSA 3TK5A 3GDSA 1AWFH 3EA9A 2FTLE 1O35A 2HNTC 1YLDA 1VCQA 4CR9A 2EJYA 4BXSA 2Q9VA 4Y79A 1WQVH 3O8DA 5ESBA 2BYGA 1WU1A 1GHVH 3A82A 1FN8A 1HCGA 4CHAC 4TWYA 3DJ3A 1AVXA 5C1UA 1O2OA 3A80A 1C5ZB 4ISHH 9LPRA 2XW9A 2LNCA 2OGPA 1BIOA 1CGIE 2GZ7A 4K1TA 1CA0B 2D1JA 2OBQA 3QDZB 5A8XA 4B76A 4NG9H 3SU3A 1C1QA 1TPSA 2GV6A 2ZU1A 1RFNA 2BY6X 1C1RA 2QCYA 3RLYH 1Q3OA 1UVUH 5T6GA 4HFPB 3I18A 1HAZB 2ZKSA 3S7HB 3SQEE 3O46A 2FYQA 1NRRH 3PMAB 2KV8A 2BD4A 2XWBI 2HPPH 1S5SA 1T32A 5EOKA 1TPOA 2ZNKH 1TA2A 5D13A 5T6DA 2VSVA 1A1RA 2OS6A 2FYRA 3M61U 4I32A 1OZIA 2X7ZA 2F91A 1HIAB 1BRBE 2QXJA 3RC5A 3SQHE 1EOJA 1O39A 3VB7A 3CBYA 2F9UA 3OU0A 3K65B 2H3MA 1DITH 5ABWA 3LGWA 1TX8A 5JBCS 4B2AA 5JDUB 3KF2A 4H6TA 1IQNA 4JMYA 1VA8A 1BMLA 2Z9JA 3ZVDA 1ANBA 4AORA 2SFAA 5FCRA 2P16A 4JOPA 1C2FA 1OXGA 1TFXA 1AZZA 3SOSA 2H2CA 4JOGA 4IN1A 2JETC 2JKHA 1THRH 1UJVA 1AE5A 1GJBB 4K60A 5LPFA 4H6SB 3A7TA 1SI5H 1T8NA 1BHXB 4UFGH 1QTFA 3UR9A 2OQUA 1IAUA 4LOYH 2Z3EA 1AKSB 1BOQA 1ZPZA 5BPEA 1JOUB 4OGYA 1N7EA 2DC2A 2AMDA 4NGAH 1J15A 1HAPH 2C8ZB 3ELAH 4AB8A 2R2MB 1O3MA 2QIQA 4Q2PA 2PTCE 4Y10E 5ESTE 1O2RA 3M7UA 4KP0A 4B71A 1AZ8A 1CVWH 1OP8A 3Q77A 2EXGA 1ELFA 1P03A 2G4UA 1C9TA 1U39A 4KFWA 3ZZAA 3BTWE 6GCHG 1TGNA 1GBCA 1VGCB 4R8TB 4H42U 1V6BA 4MPUA 4L8NA 4IN2A 3SHAH 4E05H 3TGJE 1N6YA 4O3TA 1GI3A 2DE9A 2OP9A 3FZDA 4AX9H 1MTWA 1V2NT 3V7TA 2QKTA 4IBLH 4ZKSU 1LKAA 4NXPA 1NESE 1Z87A 2XTTB 2BTCE 4Q2KA 1CSOE 1ZYOA 4I8LA 3SU0A 1P2OA 4X1NU 3RXFA 2DMZA 1GM1A 5HGGA 2OTVA 5A2PA 3ZYEA 3HK6B 4Q6SA 1O2TA 3V0XA 3QDOA 1J16A 1C2IA 1V2LT 1P12E 4KTUA 1GBTA 2ZI2H 1YKTA 4Q7ZA 4UU5A 1TNLA 3ODDA 3MU1A 1DUAA 1GBDA 3I78A 4WF8A 3RXBA 1G30B 2OXSA 2GV7A 5H4IB 1O2HA 1V5QA 2YT8A 1O3DA 3SHWA 1BA8B 2FOEA 1GQ4A 5E22A 5JBBS 1P2MA 1EAUA 2ZPQA 2Y5HA 5E6PB 1BUIA 4FU8A 4UFFH 1A2CH 2A31A 2BD9A 1DWBH 1ZPBA 2AGGX 2VIDA 3GY5A 2VZ5A 3MMGA 1Q31A 2WV5A 4ABEA 1NRPH 3RXOA 3W95A 1BTZA 1KLIH 2W5EA 1OBXA 1D3QB 1ELVA 2EA3A 5E0GA 1O5FH 3A81A 4ABFA 2FCFA 1R6JA 5F6MA 1J9CH 3KZEA 1P9UA 2DAZA 2GCHG 3WKMA 5H3JA 2B5TB 4D9QA 2BLWA 1QL8A 1MTUA 5F67A 3PV4A 1MAYA 1S6HA 3VPKA 3Q00A 4J1YA 5EG4A 1DWEH 1Z8GA 2WUBA 1TOCB 1NROH 6GCHF 2BX4A 2W3IA 4X1QU 3PMHB 3DJAA 1KXDA 3TK6A 4NXRA 1TRYA 4NIVA 3A8CA 1V2KT 3KGPA 2V3HH 2O8WA 5CHAC 2BLQA 3SGAE 1OS8A 4Q7XA 1ELGA 2L4SA 3DHKH 3RXDA 4WMDA 1GBFA 1CE5A 2JH6D 1GI5A 2ZPMA 3CENA 1O3NA 4WXVA 5DP7A 4HZHA 2FN5A 4JOJA 5DTHA 2HPQH 5FPYA 1NM6A 5C1XA 3BSQA 1FXYA 3H7TA 1DWCH 4YT7H 1P11E 5F8XA 2G5NA 1QL9A 1IQHA 1ZLRA 3NPSA 3RXAA 1N6XA 1QA7A 2GT8A 1SQTA 1UHBB 1VITH 1X7AC 1YCPK 3LOXA 4NIWA 4MPVA 2D92A 1NU9A 3F9EA 2F83A 2ZTXA 5DP8A 2ZDNA 1W12U 5EXNA 1PQ8A 2VWMA 1LQEA 3D65E 1UEPA 1FY8E 1P9SA 2JH0D 2FODA 2ZCKP 1C5UA 1P3EA 3QO6A 2TGAA 1GJ6A 2LOBA 4O06A 1VITF 2TPIZ 3D62A 1D3DB 1D4PB 3ZYDA 3EDXB 1TQ3A 4ABAA 3E6PH 3SNCA 1RJXB 2GCHF 3LGYA 4GHTA 1ETRH 3PB1E 1FPHH 1Q3PA 1QLCA 2BDYA 4K2YA 4OGXA 2BOHB 2VVCA 4Y6DA 2G55A 3UWIA 3S9BA 1THSH 2LPRA 1F7ZA 1PPZA 3TH2H 1HNEE 2ODYB 1GBJA 3SJKA 1EASA 2IPHA 5HM2A 4ABGA 4SGAE 1PQAA 4OEOA 3W94A 4DY7B 2I6QA 3D49H 3ZVEA 4X1SU 1LQDB 2A4RA 2EGNA 3GICB 3RL7A 1QRZA 5EQQA 3MTYA 3PDVA 2P59A 2J9NA 1PQ7A 1N7FA 2XC0A 2PLXA 1VZQH 1EJNA 2J2UA 2PA1A 2F9PA 5GDSH 1LHCH 1KTSB 4NNMA 1N6DA 1DSUA 1TPAE 1ZSLA 1EPTA 1P0SH 4MNWA 3RXUA 3PTNA 4K75A 2XC5A 1MQ6A 1N1LA 2OLGA 2TBSA 4FUGA 1HJ9A 5GNDA 1VB7A 2CSJA 4TPYA 2KJKA 3BTKE 1SL3A 2ZFFH 4INLA 3C27B 2A5KA 1BCUH 3BTEE 3QGJA 3FP7E 1GCTC 2ZU5A 2ZP0H 4UEHH 2VIVA 5TCAA 3SJOA 3UTUH 4YT6H 1KIGH 4P0CA 1O3AA 1S81A 3SV7A 3T26A 1A3EH 3ZVCA 2A4QA 1HJAC 3KHVA 1LO6A 2G51A 1DPOA 1MZDA 2QKUA 1NPMA 1TRNA 5EPYA 2QN5T 3FFGA 1TBRH 3SUEA 2EEKA 3MOCA 2TIOA 1ZGVA 2TGDA 4IC5A 3PV2A 1WF8A 4ABJA 3SGQE 4Y0YE 1P1DA 1W14U 3GDVA 3GJ9A 1BBRE 1XUIA 1DWDH 1PPEE 4AG1A 3RXRA 4B73A 1XUGA 5FBEA 2RG3A 3RXMA 2EGKA 2K20A 4TY7A 2EI6A 1HAOH 5F03A 1NFWA 4X8TH 3HPTB 2I0LA 1SGNE 2P3UB 3TLOA 3ID3A 1L1NA 2FOCA 3CBZA 4NWLA 2EV8A 1E37B 2C4FH 1EXFA 2AS9A 4BAKB 1LVBA 3S9AA 1KXBA 1HAVA 4K76A 1RGQA 1QJ1B 1UM7A 3E17A 1CGJE 1S82A 3QZRA 4XE4A 3U1JB 1QCPA 1O37A 5E0HA 2PKAB 5AFYH 1GJ7B 3QE1A 2GMTC 2OMJA 2Q3GA 1Z7KA 3RC6A 5E8EH 2A4OA 3LNYA 3UWJH 1IQFA 5L2YH 1O3PB 2Z94A 1RIWB 3RXVA 1DFPA 2XBXA 1VAEA 4K8BA 5HFEA 2IWNA 3U1IB 1C5RA 3GY6A 4MQAA 2ODPA 4DIHH 3ZZCA 5HF4A 1X5NA 2F9BH 3LONA 1WJLA 5C3NA 1MU8B 1UF1A 1TBQH 8GCHF 3NXPA 1W11U 1EAXA 4N6XA 1OP2A 3ATLA 1CQQA 1SC8U 1TX6A 1RY4A 4TWWA 2CHAB 3DT0H 5C1YA 2CF9H 1FUJA 1XUHA 5AFZH 3LPRA 1DLEA 1MQ5A 1EPTC 1QBVH 2BXTH 3UUZA 1O2SA 4X6PA 1G2LA 1NC6A 2HALA 4GCHG 1SGQE 3SI3H 2BLVA 1BTYA 1U3BA 1UK3A 3HVQC 2ZTZA 2WPLS 3HPKA 1BHXF 2ILNA 2M0ZA 2VIOA 2C3SA 2ZDAH 5IYTA 3HKIB 4DT7B 2CJIA 4GAWA 2KAIA 2DKRA 5TCCA 5L6NH 1CU1A 1YP9A 2VSPA 1FIZA 1MKWK 3T5FH 3B8JA 5E2OA 1CT4E 4NMQA 4IMZA 1XXDA 3L4FD 1S85A 2FLRH 3M36A 1LDTT 4NMVA 3EA8A 2ZGHA 1GG6C 1VCPA 3LH1A 3VB3A 1XMNB 2IWQA 3NKKA 3SO3A 1B8QA 4K1EA 3ID2A 1DUEA 2ZF0H 3BTME 4MNYA 3MI4A 5DJ7A 4CH8B 2ZU3A 4H4FA 5DP3A 3RXLA 2BDHA 2FS8A 1K1MA 2FTMA 3RC4A 4FUDA 3SU6A 5C5OA 2VRFA 1AD8H 2F5YA 3EGHC 1C5PA 2V3OH 1MFLA 3EYDA 1WI4A 4DURA 5DG6A 1Z71A 1BRCE 4RKJB 1H9HE 5E21A 2SNVA 1TE0A 1UTOA 2CS5A 2QAAA 1OYQA 3SV9A 1FJSA 4YM9A 1V6DA 4X2YA 4INKA 2RCZA 2BY5X 2FOMB 2WYJA 1OSSA 1XUKA 3DFLA 4J2YB 2IOTA 3VQFA 1TA6A 2KL1A 4Q2OA 3L3TA 2DB5A 2W26A 3MHWU 1E34B 3QTOH 2C8XB 4AN7A 2JILA 3FP8E 3HKJB 1K21H 1Z1IA 2G00A 2JH5D 1MKXK 3Q3YA 4CREA 2LUIA 2BD2A 4BAMB 2J4IA 1U6QA 1GBBA 1N8OB 2JIKA 5HEBA 1A4WH 5C20A 5EW1H 1JIMA 4XDEA 2DUCA 3P8OA 5B6OA 1Z8IB 4FU7A 5HMAA 2A5AA 4R2ZA 4INHA 2OZFA 1UTNA 2I04A 1F0TA 3ATWA 4AG2A 4XBDA 1KXEA 7KMEH 1TX7A 1YYY1 4JOKA 3GCTG 1CHOG 5GXPA 4X0WU 4CBOA 1C1MA 1FLEE 2GVFA 3ZV8A 3DD2H 1TP3A 2ZPLA 1WFGA 1ZR0A 3UREA 1YCPH 1GHBF 2EEHA 1TWXB 2Z9KA 4LXBH 3M5MA 3JXTA 1M9UA 2PUXB 1P2IA 1C5XB 1FONA 5G1EA 1GJ5H 2OPGA 5HFCA 1BTHH 1HRTH 4DW2U 2EEJA 1WHAA 1B5GH 1THPB 4K69A 2ZDVH 3UR6A 3UFAA 1BRAA 3TSWA 2WINI 3OTPA 3CBXA 1HIAA 4Y76A 3TH4H 1H9LB 4CR5A 3K6ZA 1HGTH 4KELA 2VGCB 1QA0A 3ATMA 5A8YA 4RI0A 2AYWA 2PKUA 2TRMA 4D76A 2BLOA 1QBOA 2ZFPH 1Y7NA 2SGDE 2IJOB 2ZCHP 4ZHAA 2VIWA 4F49A 1GMCF 2M5TA 2AERH 2QC2A 1UJDA 1BFEA 3QK1A 1AWHB 2G4TA 3ESTA 3ATKA 3MNCA 4BXWA 1AMHA 1GMHG 1TMUH 3PROA 2RRMA 1QIXB 4I8JA 3BPUA 2AFQB 1IQKA 4WJG2 2ANMH 1L2EA 4QT8C 2BQ7B 2FMJA 4KGAA 4ISLA 2HE2A 1AB9C 2G5VA 4ISNA 1N6FA 1QBNA 1FY5A 1AKSA 2QA9E 4FUCA 1GL1A 1HAXB 2OD3B 1YCPM 3JZ1B 1CO7E 5DKMA 3P17H 4D7FA 1G3CA 3I4WA 1W9QA 2G2LA 1QRWA 1UEZA 3E91A 4ISIH 4OS7A 5DP9A 1N99A 2HE4A 3ID1A 1O3FA 1O38A 4NZQA 3M5LA 3ENSB 2P8OB 1DT2A 3MWIU 2DJTA 2JOAA 3AVZA 2DE8A 2W7RA 1CHOF 4X1PU 3ZVFA 1ZRKA 2L4TA 1GHYH 1IHJA 3U9AH 1NS3A 4AFUA 3HPMA 2WPJS 1P1EA 1OWHA 1TLDA 4JOFA 2R9PA 3SORA 1RXPA 1GDUA 2PWXA 4CBNA 2A0QB 1G2MA 4AGJA 2QYIA 1ZTKA 1O5AB 3RXJA 5E0JA 2ZHQH 1P05A 4ZKOU 1AVGH 1W8BH 2PHBA 1YPMH 2FE5A 3M7QA 2EAQA 1FC9A 4A5TS 1IQLA 3RMMH 1O5DH 1CA0C 4NIYA 1NO9H 1FZZA 4GHQA 2RA0A 4U01A 1C1WH 1W3CA 1KYNA 1F92A 2BY7X 3CS0A 2PKSC 1GMHF 1QURH 2KQFA 4HGCA 4OS4A 4FUJA 1P3CA 1QR3E 4NMRA 1UTPA 2ZZUH 1EOLA 2JWEA 1ESAA 1GBHA 1NF3C 2ZPRA 1T7CA 2QGRA 4LZ1H 1HLTH 1P2JA 2P3TB 2M0TA 1DOJA 3MH7A 1IQIA 1YPHC 1OYTH 1T31A 1WFVA 5A8ZA 5FCKA 2ZC9H 2ZDMA 3QGLA 2CF8H 2NU3E 3MO6A 3NUMA 1GWAA 3PYHA 5FAHA 2J34A 3Q3XA 4D7GA 1PFXC 1WTGH 1CHGA 2FIRH 1X6DA 5HM9A 1C1TA 3PWCA 1G3EA 2Y5FA 1LMWB 1GVKB 2C90B 1FY4A 5F3XA 5LPRA 3VXEH 2C8YB 1XXFA 2CXVA 1HAGE 4FVDA 2UWLA 3CS7A 3QJNA 5HFDA 3PTBA 1GBAA 3TSZA 4Z0KA 1BB0B 1T4VH 4B75A 2VWRA 1AVWA 3IG6B 1VJAU 1W7XH 3OYPA 1TB6H 3SJIA 3ZZ6A 2D90A 1Y3WA 2QT5A 1UCYE 1Q3XA 4CRFA 3KZDA 2O2TA 2NU0E 3LJJA 2H5CA 1PPHE 2ZFTA 2XBYA 5T6FA 4JOEA 1Z1JA 1SR5C 1FQ3A 2ZFSA 1BTUA 1Q2WA 3GCHB 4I33A 1EATA 2EC9H 4YLUA 3M37A 1LVMA 1DANH 1BDAA 1LHFH 1SGYE 4I7YH 4FXGH 3MU0A 3RXPA 2BD7A 2BHGA 2BZAA 4IGDA 1O3JA 3TMHA 2M0VA 3FZZA 1C5VA 1LVYA 2EEGA 2ZCLP 1P06A 3P8NA 1ELDE 1J17T 4JYUH 1UCYK 2P93A 8KME2 1ELTA 4LK4A 1UHBA 2A32A 4UDWH 1VGCC 3T62A 4U2WA 2Z7FE 2QXHA 3B9FH 3AAVA 2AEIH 1HAYB 3RXKA 1O0DH 1ELEE 5DO4H 3L33A 1TRMA 3CC0A 1SMFE 3VB5A 2PGQB 1VCWA 1JIRA 4MG3A 1F5KU 5IDKA 1IHTH 1HV7A 4YLQH 1K1LA 2FI3E 2TGTA 1S6FA 1YLCA 3A8AA 2BD8A 4ABDA 2ZDLA 2Z9GA 3QJMA 2VIQA 4UFEH 1B0EA 1O34A 1IQMA 1L6OA 1UJUA 2WPMS 2D8IA 1QB1A 1Z8RA 2XYAA 2B7DH 4XSKU 1MH0A 3MU8A 2BM2A 3SHCH 1T8MA 4XFQA 1Z6EA 4CRCA 2UUYA 1RGWA 1PPCE 5C2ZA 5JBAS 3A7ZA 1SG8B 1SGDE 1UTQA 3BEFB 3RM0H 2ASUB
chains in the Genus database with same CATH superfamily
4BAQB 1ZTJA 2ZDKA 2WYGA 4Z1MD 2FEQH 2VH0A 1JXPA 4B74A 1UVTH 1LPGB 5HJ1A 2FDAA 5JPMH 1QAVA 1XUJA 1OOKB 4Z33A 1S83A 2FI5E 3E3TA 3OY6U 1CGHA 3Q3KA 2P3FH 3F1SB 4JL7A 1TOMH 1UEQA 1C4V2 2ZWLH 6LPRA 1O3CA 2OUAA 3URDA 2WZQA 3SU1A 2BDGA 4ZMAH 4JZIA 5A2MH 3SFJA 3RP2A 1S0QA 1OWKA 4Q6HA 2A1DB 1NFXA 4GPGA 4X2XA 4X8VH 3STJA 1UEWA 1MKXH 5FPTA 1O2MA 5EU8A 1O2VA 2FO9A 3ZZ7A 1AU8A 1GI0A 1X5RA 1SGFG 3LT3A 3UQVA 1OBZA 2E7KA 1MU6B 5CMXH 3ID4A 3ZRTA 1K1NA 2ZEBA 1ZMLA 1ZUBA 3NGHA 2ZECA 4YOIA 1SLXB 3SU4A 3BTHE 6CHAB 1AGJA 2GD4B 4YTAA 1QB6A 1V2WT 2HGAA 3TK9A 2R3YA 1WTHD 3KDGA 2YMSB 1UFXA 1GBMA 2KCAA 1CT0E 2FZZA 4LZ4B 2VVUA 1C1OA 3E8LA 7ESTE 4MNXA 1PQ5A 4OS1A 1KEFA 1O2PA 1LVOA 1O2WA 2XCNA 2QF3A 2STAE 3P8FA 1MTNC 5G1DA 3KNXA 4AFQA 1HUTH 4AZ2B 1SGTA 1C2GA 1JBUH 4YESB 4FGMA 1DY9A 1O2YA 5HEDA 3P6ZB 2BY8X 4WMEA 4XD7D 3UNSA 3VXFH 1YC0A 1CT2E 2XNIA 5L2ZH 1V3XA 1QAVB 2LC6A 1C2EA 1GCTB 4AGKA 4Y7BA 1FAKH 4HI3A 3K50A 9ESTA 3S9CA 2Y82A 3A84A 3BTTE 1ACBE 2ODQA 2DLSA 1A5GH 1MZAA 2D26C 4CRGA 3F9FA 2SGPE 2Z3CA 2PKAA 3G01A 3N7DA 2C93B 3C1KA 4AB9A 2ZGXH 1TMTH 1WI2A 5T1VA 5JB8S 4K78A 2XBVA 1YPJH 5JXBA 2QF4A 2B8OH 4X6MA 1O3BA 1V5LA 2W3KA 2RCEA 2O9QA 3LH3A 2M3MA 1C5OH 1SB1H 4ZHMU 3SUGA 5A0CA 2AWUA 1O2LA 1H4WA 2WHXA 2YNAA 3MU4A 4E34A 2FM2A 3WW7A 3HGNA 4AMHA 4F48B 2VWLA 3BIUH 4H11A 3MYWA 2FOGA 2QV1A 3VGCC 1K28D 1NZQH 1GMDG 1O2XA 3BG4C 5DP5A 1TGSZ 3RU4D 2BZ6H 3KHFA 1PPBH 1TAWA 3SNDA 3IWMA 3AXAA 1A0LA 1WUNH 1AE8H 2NU4E 5GWZA 1ZMJA 1Y5AT 1O2JA 2O8LA 1W7GH 1AN1E 2SGQE 1C2KA 4K5ZA 4VGCC 4E7RG 5EYZA 1CBWC 1G36A 1O32A 1BTWA 3GYMA 4OAJA 3ITIA 4Y71A 1GGDC 2ALPA 1A5IA 1LCYA 3D23A 1L4DA 1Z86A 8ESTE 1A46H 3PO1C 1BBRK 2V7QD 2AMPA 1C2LA 2K1QA 1EAIA 2HGTH 3SUDA 1SLVB 5E2PA 4GLYA 2OC7A 2R2WU 2BQ6B 4FLNA 3H7OA 1L0ZA 1LKBA 2WPHS 4JORA 3PMJA 1SGIB 1TNGA 4TPIZ 1TQ0B 4JOHA 1Y3XA 3HGPA 4ACBA 2UWPA 5I25A 1ZZZA 3PMBB 1ELCA 4WY3A 1I92A 4BNRA 1IQEA 1MAXA 1UTKA 2FI4E 2VB0A 1TONA 1Y3YA 2J95A 2Q1JA 3DCLA 2KG2A 4KTSA 3O5NA 5FPSA 2GCTB 1FY3A 2QBWA 2Z17A 3LGUA 1ZRBA 5EGMA 1IU0A 2QE7D 3SN8A 3A7XA 1XZ9A 1A7SA 1F0UA 1BTPA 1MFGA 1FC7A 1FI8A 3OAAD 7GCHG 1P8VC 3GCNA 2A2QH 3FANA 2SGFE 2VBCA 1LPZB 4GVUA 1KXAA 1C1VH 3RXQA 1GMDF 1KLJH 2I0IA 1K1JA 1D6WA 1FMGA 3K82A 2FOBA 2KCYA 5EIYA 1O5GH 1D3TB 1AFQC 1UTJA 2JSNA 1EZQA 2HRVA 3MNXA 2A5IA 1QNJA 2EI7A 2A7CA 2JINA 1O2UA 2OC0A 5ETXA 2YTWA 3DJ1A 1QJ7B 3LGIA 3RXGA 4F4OC 8LPRA 1GG6B 4PROA 1QJ6B 3SU2A 1C4Y2 3JZ2B 3B23B 4FUBA 5L30H 2XNDD 1XM1A 3K6YA 4ACAA 2AWXA 1K9OE 1MUEB 5DGJA 4I31A 3ZVAA 2WL7A 2AGIX 3F9GA 3FAOA 4ZROA 3A88A 4O97A 2GT7A 4ZKRU 1T2MA 1DDJA 2ZFQH 2ZHEH 1TGCA 4I8HA 5PTPA 2XBWA 2W7SA 5A0BA 2O8MA 3R0HA 1GI6A 1AQ7A 3I77A 4YZUA 1A3BH 4NA8A 4E3BA 1HFDA 3DA9B 1WBGB 3M35A 2H5DA 1O5CB 4JYVH 1O3HA 4O9VA 1HAHH 4DCDA 1QRXA 1W0ZU 2CHAC 1EB1H 2QXGA 1ETTH 3VB6A 3A83A 1JRTA 2FS9A 1OP0A 3U69H 2NWNA 1S0RA 3QUMP 4NFEA 1C2DA 4BTTB 1WSSH 3TIUA 5DK1A 4DOQA 2G8TA 4UD9H 1NRQH 3F9HA 4AYYB 3SHUA 1BMFD 1GJCB 1ARBA 3ZZ5A 4I8KA 3SJ9A 4FUHA 3KEEA 1JRSA 3TSVA 2BXUH 2XRCA 3E0NB 3DUXH 1XVOA 1GBIA 2BDBA 4IW4E 2BYAX 2H1UA 1C5QA 1NTPA 1SGFA 3K2UA 3M5OA 3MFJA 3T28A 1U37A 5DN6D 5FB8C 1X8SA 1Y3UA 2R0LA 1BJVA 1E36B 2KBSA 1RTKA 1C5SA 1YPEH 2GDDA 4MDSA 3TJVA 1UVOA 5FBIA 1Z6JH 4HG6A 4K3JA 2UUKB 3SNBA 4ISOA 3URCA 3GY4A 3GISB 1OKXA 3HK3B 3KCGH 4Q7YA 4BAOB 2GGVB 1MTSA 3QX5H 4WYTA 1GHWH 2ESTE 1KDQB 1H8DH 2IWOA 1HJ8A 1SGRE 4GCHF 2GZVA 5GCHG 1MMJN 1GJ4H 3OX7U 2O8UA 5GPIB 2M10A 2KA9A 3R69A 5FHTA 1GJ9B 3WKLA 2Y7XA 2KOMA 3ZV9A 3LU9B 1KXFA 1QQUA 2SNWA 3N7OA 3B76A 1X5QA 3M3VA 1BQYA 3GY8A 4AOQA 1GI7B 1P57B 1QFKH 3BG8A 1DS2E 1EFRD 5EQSA 1DVAH 1T8LA 2NU2E 3KQEA 2BDAA 1IOEA 1UW7A 1UTLM 2ZHFH 1FNIA 1IQJA 2BVSH 4Q80A 2P94A 3BV9B 2M0UA 1D5GA 1HXFH 2Q6FA 3AASA 3MNBA 3NK8A 1WCZA 4U32A 2F9OA 2ZQ1A 4ESTE 4O03A 2XOKD 2FX6A 3RXIA 5E11A 3L6PA 4I8GA 5FX6A 3BF6H 2HNTE 2YUBA 3P8GA 1JWTA 1OBYA 1TGTA 2R0KA 1TBZH 1TNHA 2Y7ZA 3KQ5A 5AHGH 4DG4A 3RLEA 3E90B 1AUTC 2CSSA 3ODFA 5C5NA 1O3GA 3LNXA 1C1SA 5DPAA 1EUFA 2J5UA 4X2WA 4D9RA 4CHAB 4WVPE 1RTLA 1V2TT 3FP6E 1ZMNA 3P95A 1V2JT 1V2UT 1AB9B 3A8BA 2WPDD 4MPAA 2FP7B 5HETA 3MU5A 2F0AA 3LDXH 1N8OC 4XBCA 1VJ9U 3LC5A 2UZCA 2H9EH 1MCVA 4HTCH 2G52A 1E35B 1ZSKA 3N7EA 1I16A 2AIQA 4F8KA 1UM1A 1ANEA 1D9IA 4WYUA 2KOHA 2GZ9A 1M5ZA 3ZZ8A 4DT4A 1T4UH 3A85A 1UHPA 1ZSJA 4K72A 4Z8JA 5LH8A 1HAIH 1TPPA 4HOPB 3R68A 2YOLA 2KJDA 1K1IA 2GTBA 1P10A 2VINA 1KLTA 5HFFA 1KY9A 2WV9A 4NMTA 1GCDA 1L1GA 2Q6DA 3U8TH 2OQSA 2ZGCA 3ZVBA 3ZZ3A 2RA3A 1O3LA 1GI2A 3RXCA 1O2ZA 3NCLA 1DICA 2B9LA 2VGCC 5F53A 1W13U 1ZJKA 1W0YH 5FXLA 5K0HA 4ZHLU 1PDRA 3GCTF 1A0HB 4ZH8A 3BTGE 1NBME 1SGPE 3KQDA 1QB9A 4KTCA 1SLUB 3AW1A 3OEHD 3TGKE 4WMFA 5JBTA 2H9TH 2ZHDA 2H6MA 1SOZA 3QZQA 3E0PB 1G9IE 3FVFB 4IS5A 1OX1A 3MH5A 3UNQA 1NRSH 3CH8A 3EGKH 1O2KA 2JETB 2ZU2A 3H5CB 2PKSB 2ZQ2A 3R0FA 4GVDA 1BT7A 4RN6A 2BOKA 5T3HA 3V12A 1SLWB 2ANYA 4OS2A 1O3OA 2REYA 2GP9B 5EJZA 3VFEA 3UQOA 3PLPA 3GY3A 3TGIE 1UJ1A 1O33A 2VWNA 2ALVA 1E1RD 4MPXA 2BDIA 2I6SA 1P2KA 4O3UA 1YPHE 4NNLA 2C8WB 1MBMA 1LHDH 5DSFA 1KSNA 3TPIZ 2WPIS 4JJ3A 4MLFB 2BQWB 5JB9S 5GLJA 1RRKA 1V2QT 1RZXA 1WH1A 1OWJA 2GDEH 2VU8E 1FIWA 1C5YB 2H2ZA 2GKVE 2P8OC 1MBQA 5HEYA 3LIWA 1C2JA 1WIFA 3A7VA 3NWUA 1JMOH 1J14A 3ZZ4A 2V35A 4KKDA 1BTXA 1DX5M 1SFIA 1O31A 3MH6A 4K6YA 1KTTB 3TNTA 2FXRA 1C1PA 2FPZA 1DXWA 2M2AA 2JREA 1FY1A 1FAXA 2CK3D 3MO3A 2KYLA 5FX5A 1BBRH 1NTEA 5EXMA 1BMMH 2OCVB 2EDVA 2PZDA 2ENOA 1J8AA 2EY4C 1ZHPA 2PV9B 2ZIQH 4YOJA 1MD7A 3PDZA 3LGTA 1UO6A 1O5EH 5JYIA 2VPHA 2FNEA 5I7ZA 4WWYA 1OPHB 5HYOA 3SV2H 3W1EA 1X45A 1MD8A 4NIXA 4X8SH 4AC9A 1SSXA 2JJ1D 4ZXYH 3SUZA 3EQ0H 3SBKA 2I4SA 1Y8TA 4BANB 1AIXH 1TGBA 2DM8A 2Z3DA 2AINA 2BX3A 4Y7AA 3VEQB 1ELBA 4DIIH 1NN6A 2AH4X 4K1SA 1ORFA 4G69A 1V2RT 3CP7A 2TGPZ 3FOAA 3SV8A 4Q63A 3GCOA 2AIPA 2Y6TA 2WPKS 5F8ZA 2YUYA 1C5MD 2ZHWH 1P2QA 1O2NA 4OS6A 4X6OA 1GI9B 5J4QA 1YGCH 4ZKNU 2UUFB 3BEIB 2VNTA 4M7GA 7LPRA 3A86A 2P3WA 3QIKA 1ETSH 4A1TA 2OINA 1CA8B 3WWBA 2KAWA 4LMMA 4BTIB 2PUQH 3UY9A 3I1EA 4MNVA 3QN7A 1U38A 1MKWH 1UK4A 1ARCA 1O3KA 1K22H 4CRAA 4X1RU 3F0OA 1PYTC 2Q6GA 3OY5U 2G5MB 1SBWA 4GVCA 5CHAB 1ZOKA 1VKYA 1SHYA 2OBOA 1EP5A 1GJ8B 3BIVH 2BVRH 3EE7A 1P2NA 4JZDH 1V2OT 2ZTYA 5LGOA 2XCFA 3A8DA 1H8IH 2CMYA 4Y8XA 1C1UH 2OC8A 1GI8B 3GCHC 1PYTD 5GIBA 1SGEE 4DJZB 4OEPA 2PR3A 4NMSA 5HFBA 3PV5A 4IMQA 4XOJA 3SYJA 3U8OH 3ZZBA 3RDZA 4KFVA 2I6VA 5EZ0A 1ESBA 1VITG 3WWFA 3LKWA 3STIA 2VWOA 4PQWA 3V3MA 3O8BA 5G4BA 4X8UH 1SGCA 1EQ9A 1ZPCA 2H3LA 3OEED 1P04A 2QKVA 1WQSA 2PTNA 2KFWA 2STBE 1K1PA 3M5NA 3RMLH 4ABIA 2G81E 1BJUA 5LPEA 4TYDA 3TNSA 2D8WA 3KDKA 3BTFE 1OWIA 3SNEA 4A1VA 4CRDA 3RXEA 5EW2H 1LPKB 4JZEH 3F6UH 2VH6A 1QGFA 1WG6A 1DE7H 3GYLB 2CN0H 1YBOA 5F8TA 1YBWA 2AGEX 5SGAE 1GJDB 2FOFA 5DP4A 3KL6A 1GQ5A 3UPEA 4Y8ZA 3TH3H 2XXLA 5CE1A 1SPJA 3S0NA 2GEFA 3CYYA 4UU6A 1AFEH 2KCOA 4OS5A 2PSXA 2QG1A 1DXPA 1AI8H 5TJXA 2Z6BD 2ZA5A 3UIRA 3T29A 5A09A 1TNJA 2ZGJA 1PPGE 3ZVGA 1WF7A 3KQBA 3LJOA 4GHNA 1MTNB 1TMBH 3LC3A 1ABJH 2JIZD 4A7IB 1LHEH 3PWBA 3RXTA 3T25A 2PGBB 2ULLA 1COWD 4ASUD 3T2NA 1N6EA 2VJ1A 2GX4A 1Y3VA 2KPLA 1L4ZA 3UOPA 3O8RA 4A1XA 1NRNH 2W7UA 3WY8A 1GDNA 2B0FA 5EQRA 1IHSH 1FCFA 1T8OA 3M3SA 4ZUHA 2BB4A 4Y11E 3RU4T 3H09A 4NSYA 4BOHA 2KCPA 1O5BB 4WXIA 2OK5A 1EJAA 4JJ0A 4A92A 4JZ1A 2SGEE 5C94A 2MHOA 1S84A 1LHGH 3QTVH 2WSSD 4NSVA 4ZAEA 1GHZA 4FUFA 3AW0A 2HVXA 4X2VA 3RU4E 2FOAA 1LTOA 3DSOA 4JYTA 4JCNA 1GL0E 1DSTA 3UOUA 4YO9A 2VVVA 2SGAA 3FY5A 1TNIA 1IQGA 1HJAB 1BITA 1SFQB 3A7YA 3AAUA 6CHAC 3A7WA 3VGCB 3RXSA 5J4SA 1D6RA 2YMSC 3BG4B 5EXLA 1G3BA 5HIYA 2ZG0H 1AO5A 1EJMA 2YT7A 2AMQA 5EJ1A 1WYKA 2PW8H 2KM0A 3GY7A 4TY6A 2IWPA 5B6LA 2ANWA 1DM4B 3MH4A 3A87A 3U28C 2A4GA 1KXCA 2THFB 2ZU4A 2HNTF 1NFYA 1C5TA 3SGBE 3GDUA 1FDPA 3U8RH 1EP6A 2YMSD 3F2FA 4K8YA 1BZXE 1WV7H 1V62A 2I1NA 3OSYA 2KJPA 1BRUP 4VGCB 3V13A 1ANCA 1CBWB 3T27A 4XHVA 5C67A 1GBEA 1Y5BT 1TNKA 3E1XB 1ZTLA 1GGDB 1WAYB 2L97A 2WUCA 4XRNA 4FU9A 3R3GB 1OWDA 1FV9A 2ZGBH 1P09A 2V6NA 1C4U2 1PJPA 1P01A 2V1WA 3FN8A 3P70B 1V2PT 3PO1B 2A45B 1GBKA 4NA7A 1RD3B 2Y80A 1G9OA 1YPLH 1WDIA 4YYXA 4XBBA 1FPCH 1E0FD 8GCHG 2GMTB 1VR1H 1W9OA 1H8HD 2F9VA 1GHAG 1C9PA 2VIPA 1W9EA 1F0RA 3EAJA 1ZGIA 3KN2A 1QL7A 2A7HA 4X6NA 4JK5A 1QHRB 1GHXH 3KIDU 3PM3A 2H2BA 1TQ7B 3RM2H 5A0AE 1H9IE 2JXOA 4R0IA 3PLBA 1FN6A 2FOHA 4NMOA 3BN9A 1BMAA 1ESTA 4DVAU 3CNRA 4B2CA 1PPFE 3ZZ9A 3LGVA 4ABHA 2CGAA 2BDCA 4D8NA 1HBTH 2BD5A 4JZFH 1NT1A 1UMAH 2J97A 1ID5H 4U30A 3MO9A 1WHDA 3BTQE 3Q76A 2Z9LA 1ZHMA 1K1OA 1SQAA 3SW2B 3K9XB 4GSOA 2CV3A 1AFQB 2OCSA 3EE0B 3VB4A 1O3IA 3TJNA 3IITA 1AY6H 1OHHD 2IN2A 1BMNH 1EPTB 3SJ8A 5HKKD 1HPGA 1L1JA 2FWWA 5BRRE 4CH2B 4P2AB 1YLNA 3GSLA 4ASHA 3BEUA 4M9FA 2V90A 1H1BA 5EODA 1NY22 1ABIH 2HLCA 3M7TA 3OE7D 1K2I1 3NFKA 3EA7A 5AF9H 2Z9IA 2FESH 1N7TA 1W2KH 3PS4A 4Q2NA 4MTBA 2KRGA 1GPZA 1YF4A 3UAIC 2KZ4A 4NWKA 1EZUC 2RDLA 3TJUA 1IU2A 1HYLA 2QY0B 4E7NA 3QWCH 2KPKA 1G32B 1HDTH 1KDQA 3VQGA 2YNBA 3TITA 3GY2A 4BTUB 2R3UA 1GHAF 4Q3HA 2QF0A 4IC6A 1EAWA 4WH6A 4AFZA 1TIOA 2F3CE 4WH8A 1Y5UT 2EGOA 1F5LA 2PFEA 1RIWC 1C5LH 1O2IA 5I46H 1NFUA 1A61H 4Y8YA 2GCTC 4AFSA 1B7XB 2A2XH 2ZFRH 3M3TA 4A6LA 3UNRA 1RGRA 1A0JA 2J92A 2GZ8A 1V2ST 4RSPA 2LELA 4FUEA 2BMGB 1ZJDA 1ZHRA 1TYNA 2HWLB 1C2HA 3SU5A 4JK6A 4P02A 4DGJA 1Q7XA 3PLKA 3SUFA 1GDQA 1GI4A 3O8CA 1YPKH 3DORA 5HXFA 1HAVB 3RMNH 3A89A 4SGBE 2D2DA 3N99A 2BVXH 1GJAB 1BE9A 1MCTA 1C5NH 1UCYH 2UUJB 1TP5A 2FX4A 1O3EA 1EZSC 4UFDH 1XX9A 2MX6A 4RKOB 2KOJA 3F68H 4NZLA 1O36A 3NZIA 1INCA 2ZO3H 4BAHB 2J94A 4FUIA 3S7KB 1KWAA 7GCHF 1VJ6A 1H8ED 1DLKB 1O30A 3GOVB 2PKTA 2EDZA 2DLUA 1F5RA 2J38A 1QY6A 1XKAC 2XC4A 2LC7A 3P92A 3SOEA 2EI8A 5DP6A 2BD3A 5AVDA 1RS0A 1YM0A 3RLWH 1E38B 2H9HA 2A7JA 2EHRA 3EGGC 3E16B 1SOTA 1GHBG 1O2QA 2WV4A 1NU7B 2PSYA 2W4FA 5CHBA 1W10U 1GI1A 1O2GH 1ANDA 4NCYA 2O8TA 1WOFA 5GJ4B 3TU7H 1C5WB 2IPQX 3OFND 4AYVB 3K1RA 3GGEA 2EDPA 1YPGH 2ZPSA 1V2VT 3RUOA 4YOGA 2BY9X 3RMOH 1MABB 4HOPA 1TABE 2PNTA 4EDJA 1GBLA 1UVPA 1XKBC 1B0FA 1OWEA 1GMCG 1MTVA 3RL8A 4NA9H 2Y5GA 4THNH 3DIWA 3S69A 4FETA 3SNAA 4Y0ZE 4NXQA 4E35A 2F9NA 3ZZDA 3TJOA 3OTJE 1EZXC 3RXHA 2AWWA 4ZXXH 4REYA 2QXIA 4MPWA 4GUXA 2KAIB 1UVSH 1Y59T 2NU1E 1GVLA 4UE7H 2V0BA 3QLPH 4MVNA 1HXEH 3KQCA 4TT3D 2OQ5A 2LA8A 3SV6A 3NFLA 1AUJA 1K32A 1UTMA 1EX3A 2W6JD 1G37A 2RFKC 2HOBA 1FC6A 1A5HA 5HF1A 2UWOA 4YDPA 4FVBA 4NMPA 1F2SE 1MC7A 1P02A 1SHHB 1V1TA 2K1ZA 3SZNA 3U98H 1DY8A 2P95A 1UITA 1RTFB 1SVPA 1SQOA 1Z8JB 3DSPA 3F2GA 4Z6AH 2PDZA 1QZ8A 3BTDE 4UONA 5EPNA 1ELAA 4CRBA 2EEIA 3I29A 1XVMA 5EJLA 5C17A 3SI4H 2FLBH 1C2MA 5K7RA 1C1NA 1E1QD 1FX0B 2OSGA 5HDYA 1TALA 2R4HA 1V2MT 4B1TA 4NFFA 1F0SA 5E1YA 1HB0B 3TVJB 2ANKH 5GCHF 3DFJA 2XWAA 2OC1A 2Y81A 4E06H 1EB2A 6ESTA 1QAUA 3HATH 1ZOMA 1UK2A 1XUFA 1QQ4A 3QGNB 4Q2QA 1EKBB 3KYFA 1G3DA 4B2BA 2V3MA 1D3PB 1GVZA 4ABBA 1AHTH 4B6FA 3ATIA 3MNSA 3TK5A 3GDSA 1AWFH 3EA9A 2FTLE 1O35A 2HNTC 1YLDA 1VCQA 4CR9A 2EJYA 4BXSA 5IK2D 2Q9VA 4Y79A 1WQVH 3O8DA 5ESBA 2BYGA 1WU1A 1GHVH 3A82A 1FN8A 1HCGA 4CHAC 4TWYA 3DJ3A 1AVXA 5C1UA 1O2OA 3A80A 1C5ZB 4ISHH 9LPRA 2XW9A 2LNCA 2OGPA 1BIOA 1CGIE 2GZ7A 4K1TA 1CA0B 2D1JA 2OBQA 3QDZB 5A8XA 4B76A 4NG9H 3SU3A 1C1QA 1TPSA 2GV6A 2ZU1A 1RFNA 2BY6X 1C1RA 2QCYA 3RLYH 1Q3OA 1UVUH 5T6GA 4HFPB 3I18A 1HAZB 2ZKSA 3S7HB 3SQEE 1E79D 3O46A 2FYQA 1NRRH 3PMAB 2KV8A 2BD4A 2XWBI 2HPPH 1S5SA 1T32A 5EOKA 1TPOA 2ZNKH 1TA2A 5D13A 2LP6A 5T6DA 2VSVA 1A1RA 2OS6A 2FYRA 3M61U 4I32A 1OZIA 2X7ZA 2F91A 1HIAB 1BRBE 2QXJA 3RC5A 3SQHE 1EOJA 1O39A 3VB7A 3CBYA 2F9UA 3OU0A 3K65B 2H3MA 1DITH 5ABWA 3LGWA 3MQKC 1TX8A 5JBCS 4B2AA 5JDUB 3KF2A 4H6TA 1IQNA 4ZCNA 4JMYA 1VA8A 1BMLA 2Z9JA 3ZVDA 1ANBA 2W6ID 4AORA 2SFAA 5FCRA 2P16A 4JOPA 1C2FA 1OXGA 1TFXA 1AZZA 3ZIAD 3SOSA 2J98B 2H2CA 4JOGA 4IN1A 2JETC 2JKHA 1THRH 1UJVA 1AE5A 1GJBB 4K60A 5LPFA 4H6SB 3A7TA 1SI5H 1T8NA 1BHXB 4UFGH 1QTFA 3UR9A 2OQUA 1IAUA 4LOYH 2Z3EA 1AKSB 1BOQA 1ZPZA 5BPEA 1JOUB 4OGYA 1N7EA 2DC2A 2AMDA 4NGAH 1J15A 2PP6A 1HAPH 2C8ZB 3ELAH 4AB8A 2R2MB 1O3MA 2QIQA 4Q2PA 2PTCE 4Y10E 5ESTE 1O2RA 3M7UA 4KP0A 4B71A 1AZ8A 1CVWH 1OP8A 3Q77A 2EXGA 1ELFA 5ILBA 1P03A 2G4UA 1C9TA 2KR7A 1U39A 3FKSD 4KFWA 3ZZAA 3BTWE 6GCHG 1TGNA 1GBCA 1VGCB 4R8TB 4H42U 1V6BA 4MPUA 4L8NA 4IN2A 3SHAH 4E05H 5IL9A 1N6YA 3TGJE 4O3TA 1GI3A 2DE9A 2OP9A 3FZDA 4AX9H 1MTWA 1V2NT 3V7TA 2QKTA 4IBLH 4ZKSU 1LKAA 4NXPA 1NESE 1Z87A 2XTTB 2BTCE 4Q2KA 1CSOE 1ZYOA 4I8LA 3SU0A 1P2OA 4X1NU 3RXFA 2DMZA 1GM1A 5HGGA 2OTVA 5A2PA 3ZYEA 3HK6B 4Q6SA 1O2TA 3V0XA 3QDOA 1J16A 1C2IA 1V2LT 1P12E 4KTUA 1GBTA 2ZI2H 1YKTA 4Q7ZA 4UU5A 1TNLA 3ODDA 3MU1A 1DUAA 1GBDA 3I78A 4WF8A 3RXBA 1G30B 2OXSA 2GV7A 5H4IB 1O2HA 1V5QA 2YT8A 1O3DA 5C0UA 3SHWA 1BA8B 2FOEA 1GQ4A 5E22A 5JBBS 1P2MA 1EAUA 2ZPQA 2Y5HA 5E6PB 1BUIA 4FU8A 4UFFH 1A2CH 2A31A 2BD9A 1DWBH 1YWUA 1ZPBA 2AGGX 2VIDA 2VZ5A 3GY5A 3MMGA 1Q31A 2WV5A 4ABEA 1NRPH 3RXOA 3W95A 1BTZA 1KLIH 2W5EA 1OBXA 1D3QB 1ELVA 2EA3A 5E0GA 1O5FH 3A81A 4ABFA 2FCFA 1R6JA 5F6MA 1J9CH 3KZEA 1P9UA 2DAZA 2GCHG 3WKMA 5H3JA 2B5TB 4D9QA 2BLWA 1QL8A 1MTUA 5F67A 3PV4A 1MAYA 1S6HA 3VPKA 3Q00A 4J1YA 5EG4A 1DWEH 1Z8GA 2WUBA 1TOCB 1NROH 6GCHF 2BX4A 2W3IA 4X1QU 3PMHB 3DJAA 1KXDA 3TK6A 4NXRA 1TRYA 4NIVA 3A8CA 1V2KT 3KGPA 2V3HH 2O8WA 5CHAC 2BLQA 3SGAE 2RDEA 1OS8A 4Q7XA 1ELGA 3VG8A 2L4SA 4RT1A 3DHKH 3RXDA 4WMDA 1GBFA 1CE5A 2JH6D 1GI5A 2ZPMA 3CENA 1O3NA 4WXVA 5DP7A 4HZHA 2FN5A 4JOJA 5DTHA 2HPQH 5FPYA 1NM6A 5C1XA 3BSQA 1FXYA 5FL7D 3H7TA 1DWCH 4YT7H 1P11E 5F8XA 2G5NA 1QL9A 1IQHA 1ZLRA 3NPSA 3RXAA 1N6XA 1QA7A 2GT8A 1SQTA 1UHBB 1VITH 1X7AC 1YCPK 3LOXA 4I86A 2K0QA 4NIWA 4MPVA 2D92A 1NU9A 3F9EA 2F83A 2ZTXA 5DP8A 2ZDNA 1W12U 5EXNA 1PQ8A 2VWMA 1LQEA 3D65E 1UEPA 1FY8E 1P9SA 2JH0D 2FODA 2ZCKP 1C5UA 1P3EA 5C0TA 3QO6A 2TGAA 1GJ6A 2LOBA 4O06A 1VITF 2TPIZ 3D62A 1D3DB 1D4PB 3ZYDA 3EDXB 1TQ3A 4ABAA 3E6PH 3SNCA 1RJXB 2GCHF 3LGYA 4GHTA 1ETRH 3PB1E 1FPHH 1Q3PA 1QLCA 2BDYA 4K2YA 4OGXA 2BOHB 2VVCA 4Y6DA 2G55A 3UWIA 3S9BA 1THSH 2LPRA 1F7ZA 1PPZA 3TH2H 1HNEE 2ODYB 1GBJA 3SJKA 1EASA 2IPHA 5HM2A 4ABGA 4SGAE 1PQAA 4OEOA 3W94A 4DY7B 2I6QA 3D49H 3ZVEA 4X1SU 1LQDB 2A4RA 2EGNA 3GICB 2KX4A 3RL7A 1QRZA 5HIZA 5EQQA 3MTYA 3PDVA 2P59A 2J9NA 1PQ7A 1N7FA 2F4LA 2XC0A 2PLXA 1VZQH 1EJNA 2J2UA 2PA1A 2F9PA 5GDSH 1LHCH 1KTSB 4NNMA 3PRDA 1N6DA 1DSUA 1TPAE 1ZSLA 1EPTA 1P0SH 4MNWA 3RXUA 3PTNA 4K75A 5KGOA 2XC5A 1MQ6A 1N1LA 2OLGA 2TBSA 4FUGA 1HJ9A 5GNDA 1VB7A 2CSJA 2JJ2D 4TPYA 2KJKA 3BTKE 1SL3A 2ZFFH 4INLA 3C27B 2A5KA 1BCUH 3BTEE 3QGJA 3FP7E 1GCTC 2ZU5A 2ZP0H 4UEHH 2VIVA 5TCAA 3SJOA 3UTUH 4YT6H 1KIGH 4P0CA 1O3AA 1S81A 3SV7A 3T26A 1A3EH 3ZVCA 2A4QA 1HJAC 3KHVA 1LO6A 2G51A 1DPOA 1MZDA 2QKUA 1NPMA 1TRNA 5EPYA 2QN5T 3FFGA 3PRBA 1TBRH 3SUEA 3GABA 2EEKA 3MOCA 2TIOA 1ZGVA 2TGDA 4IC5A 3PV2A 1WF8A 4ABJA 3SGQE 4Y0YE 1P1DA 1W14U 3GDVA 3GJ9A 1BBRE 1XUIA 1DWDH 1PPEE 4AG1A 1KMHB 3RXRA 4B73A 1XUGA 5FBEA 2RG3A 3RXMA 2EGKA 2K20A 2F43B 4TY7A 2EI6A 1HAOH 5F03A 1NFWA 4X8TH 3HPTB 2I0LA 1SGNE 2P3UB 3TLOA 3ID3A 1L1NA 2FOCA 3CBZA 4NWLA 2EV8A 1E37B 2C4FH 1EXFA 2AS9A 4BAKB 1LVBA 3S9AA 1KXBA 1HAVA 4K76A 1RGQA 1QJ1B 1UM7A 3E17A 1CGJE 1S82A 3QZRA 4XE4A 3U1JB 1QCPA 1O37A 5E0HA 2PKAB 5AFYH 1GJ7B 3QE1A 2GMTC 2AHME 2OMJA 2Q3GA 1Z7KA 3RC6A 5E8EH 2A4OA 3LNYA 3UWJH 1IQFA 5L2YH 1O3PB 2Z94A 1RIWB 3RXVA 1DFPA 2XBXA 1VAEA 4K8BA 5HFEA 2IWNA 3U1IB 1C5RA 3GY6A 4MQAA 2ODPA 3F0PA 4DIHH 3ZZCA 5HF4A 1X5NA 2F9BH 3LONA 1WJLA 5C3NA 1MU8B 1UF1A 1TBQH 8GCHF 3NXPA 1W11U 1EAXA 4N6XA 1OP2A 3ATLA 1CQQA 1SC8U 1TX6A 1RY4A 4TWWA 2CHAB 5KECA 3DT0H 5C1YA 2CF9H 1FUJA 1XUHA 5AFZH 3LPRA 3SZEA 1DLEA 1MQ5A 1EPTC 1QBVH 2BXTH 3UUZA 1O2SA 4X6PA 1G2LA 1NC6A 2HALA 4GCHG 1SGQE 3SI3H 2BLVA 1BTYA 1U3BA 1UK3A 3HVQC 2ZTZA 2WPLS 3HPKA 1BHXF 2ILNA 2M0ZA 2VIOA 2C3SA 2ZDAH 5IYTA 3HKIB 4DT7B 2CJIA 4GAWA 2KAIA 2DKRA 5TCCA 5L6NH 1CU1A 1YP9A 2VSPA 1FIZA 1MKWK 3T5FH 3B8JA 5E2OA 1CT4E 4NMQA 4IMZA 1XXDA 3L4FD 1S85A 2FLRH 3M36A 1LDTT 4NMVA 3EA8A 2ZGHA 1GG6C 1VCPA 3LH1A 3VB3A 1XMNB 2IWQA 3NKKA 3SO3A 1B8QA 4K1EA 3ID2A 1DUEA 2ZF0H 3BTME 4MNYA 3MI4A 5DJ7A 4CH8B 2ZU3A 4H4FA 5DP3A 3RXLA 2HVYB 2BDHA 2FS8A 1K1MA 2FTMA 3RC4A 4FUDA 3SU6A 3NRLA 4OM9A 5C5OA 2VRFA 1AD8H 2F5YA 3EGHC 1W0JD 1C5PA 2V3OH 3GS9A 1MFLA 3EYDA 1WI4A 4DURA 5DG6A 1Z71A 4P00A 1BRCE 4RKJB 1H9HE 5E21A 2SNVA 1TE0A 1UTOA 2CS5A 2QAAA 1OYQA 3SV9A 1FJSA 4YM9A 4RT0A 1SKYE 1V6DA 4X2YA 4INKA 2RCZA 2BY5X 2FOMB 2WYJA 1OSSA 1XUKA 3DFLA 4J2YB 2IOTA 3VQFA 1TA6A 2KL1A 4Q2OA 3L3TA 2DB5A 2W26A 3MHWU 1E34B 3QTOH 2C8XB 4TSFD 4AN7A 2JILA 3FP8E 3HKJB 2IJD1 1K21H 1Z1IA 2G00A 2JH5D 1MKXK 4FOUC 3Q3YA 4CREA 2LUIA 2BD2A 4BAMB 2J4IA 5KEDA 1U6QA 1GBBA 1N8OB 3NCVA 2JIKA 5HEBA 1A4WH 2L74A 5C20A 5EW1H 1JIMA 4XDEA 2DUCA 3P8OA 1SQRA 5B6OA 1Z8IB 4FU7A 3F3BA 5HMAA 2A5AA 4R2ZA 4INHA 2OZFA 1UTNA 2I04A 1F0TA 3ATWA 4AG2A 1K0HA 4XBDA 1KXEA 7KMEH 1TX7A 1YYY1 4JOKA 3GCTG 1CHOG 5GXPA 3KYGA 4X0WU 4CBOA 1C1MA 1FLEE 2GVFA 3ZV8A 3DD2H 1TP3A 2ZPLA 2QF5A 1WFGA 1ZR0A 3UREA 1YCPH 1GHBF 2EEHA 1TWXB 2Z9KA 3DSGA 4LXBH 3M5MA 3JXTA 1M9UA 2PUXB 1P2IA 1C5XB 1FONA 5G1EA 1GJ5H 2OPGA 5HFCA 1BTHH 1HRTH 4DW2U 2EEJA 1WHAA 1B5GH 1THPB 4K69A 2ZDVH 3UR6A 3UFAA 1BRAA 3TSWA 2WINI 3OTPA 3CBXA 1HIAA 4Y76A 3TH4H 1H9LB 4CR5A 3K6ZA 1HGTH 4F55A 4KELA 2VGCB 1QA0A 3ATMA 5A8YA 4RI0A 2AYWA 2PKUA 2TRMA 4D76A 1YY3A 1QBOA 2BLOA 2ZFPH 1Y7NA 2SGDE 2IJOB 2ZCHP 4ZHAA 2VIWA 4F49A 1GMCF 2M5TA 2AERH 2QC2A 5B42A 1UJDA 1BFEA 3QK1A 1AWHB 2G4TA 3ESTA 3ATKA 3MNCA 4BXWA 1AMHA 1GMHG 1TMUH 2J98A 3PROA 2RRMA 1QIXB 4I8JA 3BPUA 2AFQB 1IQKA 2K8IA 2ANMH 4WJG2 1L2EA 4QT8C 2BQ7B 2FMJA 4KGAA 4ISLA 2HE2A 1AB9C 2G5VA 4ISNA 1N6FA 1QBNA 1FY5A 1AKSA 2QA9E 4FUCA 1GL1A 1HAXB 2OD3B 1YCPM 3JZ1B 1CO7E 5DKMA 3P17H 4D7FA 1G3CA 3I4WA 1W9QA 2G2LA 1QRWA 1UEZA 3E91A 4ISIH 4OS7A 5DP9A 1N99A 2HE4A 3ID1A 1O3FA 1O38A 2GJGA 3M5LA 4NZQA 3ENSB 2P8OB 1DT2A 3MWIU 2DJTA 2JOAA 3AVZA 2DE8A 2W7RA 1CHOF 1S6LA 4X1PU 3ZVFA 1ZRKA 2L4TA 1GHYH 1IHJA 3U9AH 1NS3A 4AFUA 3HPMA 2WPJS 1P1EA 1OWHA 1TLDA 4JOFA 2R9PA 3SORA 1RXPA 1GDUA 2PWXA 4CBNA 2A0QB 1G2MA 4AGJA 2QYIA 1ZTKA 5CDFE 1O5AB 3RXJA 5E0JA 2ZHQH 1P05A 4ZKOU 1AVGH 1W8BH 2PHBA 1YPMH 2FE5A 3M7QA 2EAQA 1X9ZA 1FC9A 4A5TS 1IQLA 3RMMH 1O5DH 1CA0C 4NIYA 1NO9H 1FZZA 4GHQA 2RA0A 4U01A 1C1WH 1W3CA 1KYNA 1F92A 1W0KD 2BY7X 3CS0A 2PKSC 1GMHF 1QURH 2KQFA 2L6OA 4HGCA 4OS4A 4FUJA 1P3CA 1QR3E 4NMRA 1UTPA 2ZZUH 1EOLA 2JWEA 1NBMD 1ESAA 1GBHA 1NF3C 2ZPRA 1T7CA 2QGRA 4LZ1H 1HLTH 1P2JA 2P3TB 2M0TA 1DOJA 3MH7A 1IQIA 1YPHC 1OYTH 1T31A 1WFVA 5A8ZA 5FCKA 2ZC9H 2ZDMA 3QGLA 2CF8H 3F2HA 2NU3E 3MO6A 3NUMA 1GWAA 3PYHA 5FAHA 2J34A 3Q3XA 4D7GA 1PFXC 1WTGH 1CHGA 3AK5A 2FIRH 1X6DA 5HM9A 1C1TA 3PWCA 1G3EA 2Y5FA 1LMWB 1GVKB 2C90B 1FY4A 5F3XA 5LPRA 3VXEH 2C8YB 1XXFA 2CXVA 1HAGE 4FVDA 2UWLA 3CS7A 3QJNA 5HFDA 3PTBA 1GBAA 3TSZA 4Z0KA 1BB0B 1T4VH 4B75A 2VWRA 1AVWA 3IG6B 1VJAU 2JDID 1W7XH 3OYPA 1TB6H 3SJIA 3ZZ6A 2D90A 1Y3WA 2QT5A 1UCYE 1Q3XA 4CRFA 3KZDA 2HLDD 2O2TA 2NU0E 3LJJA 2H5CA 1PPHE 2ZFTA 2XBYA 5T6FA 4JOEA 4YXWD 1Z1JA 1SR5C 1FQ3A 2ZFSA 1BTUA 1Q2WA 3GCHB 4I33A 1EATA 2EC9H 4YLUA 3M37A 1LVMA 1DANH 1BDAA 1LHFH 1SGYE 4I7YH 4FXGH 3MU0A 3RXPA 2BD7A 2BHGA 2BZAA 4IGDA 1O3JA 3TMHA 2M0VA 3FZZA 1C5VA 1LVYA 2EEGA 2ZCLP 1P06A 3P8NA 1ELDE 1J17T 4JYUH 1UCYK 2P93A 8KME2 2EQNA 1ELTA 4LK4A 1UHBA 2A32A 4UDWH 1VGCC 3T62A 4U2WA 1WXRA 2Z7FE 2QXHA 3B9FH 3AAVA 2AEIH 1HAYB 3RXKA 1O0DH 1ELEE 5DO4H 3L33A 1TRMA 3CC0A 1SMFE 3VB5A 2PGQB 1VCWA 1JIRA 4MG3A 1F5KU 5IDKA 1IHTH 1HV7A 3FO8D 1K1LA 2FI3E 2TGTA 1S6FA 1YLCA 3A8AA 2BD8A 4YLQH 4ABDA 2ZDLA 2Z9GA 4B6EA 3QJMA 2VIQA 4UFEH 1B0EA 1O34A 1IQMA 1L6OA 1UJUA 2WPMS 2D8IA 1QB1A 1Z8RA 2XYAA 2B7DH 4XSKU 1MH0A 3MU8A 2BM2A 3SHCH 1T8MA 4XFQA 1Z6EA 4CRCA 2UUYA 4Q4LA 1RGWA 1PPCE 3UB0A 5C2ZA 5JBAS 3A7ZA 1SG8B 1SGDE 1UTQA 3BEFB 3RM0H 2ASUB
chains in the Genus database with same CATH topology
4BAQB 1ZTJA 2ZDKA 2WYGA 2FEQH 2VH0A 1JXPA 4B74A 1UVTH 1LPGB 5HJ1A 2FDAA 5JPMH 1QAVA 1XUJA 1OOKB 4Z33A 1S83A 2FI5E 3E3TA 3OY6U 1CGHA 3Q3KA 2P3FH 3F1SB 4JL7A 1TOMH 1UEQA 1C4V2 2ZWLH 6LPRA 1O3CA 2OUAA 3URDA 3SU1A 2BDGA 4ZMAH 4JZIA 5A2MH 3SFJA 3RP2A 1S0QA 1OWKA 4Q6HA 2A1DB 1NFXA 4GPGA 4X2XA 4X8VH 3STJA 1UEWA 1MKXH 5FPTA 1O2MA 5EU8A 1O2VA 2FO9A 3ZZ7A 1AU8A 1GI0A 1X5RA 1SGFG 3LT3A 3UQVA 1OBZA 2E7KA 1MU6B 5CMXH 3ID4A 3ZRTA 1K1NA 2ZEBA 1ZMLA 1ZUBA 3NGHA 2ZECA 4YOIA 1SLXB 3SU4A 3BTHE 6CHAB 1AGJA 2GD4B 4YTAA 1QB6A 1V2WT 2HGAA 3TK9A 2R3YA 1WTHD 3KDGA 1UFXA 1GBMA 1CT0E 2FZZA 4LZ4B 2VVUA 1C1OA 3E8LA 7ESTE 4MNXA 1PQ5A 4OS1A 1KEFA 1O2PA 1LVOA 1O2WA 2XCNA 2QF3A 2STAE 3P8FA 1MTNC 5G1DA 3KNXA 4AFQA 1HUTH 4AZ2B 1SGTA 1C2GA 1JBUH 4YESB 4FGMA 1DY9A 1O2YA 5HEDA 3P6ZB 2BY8X 4WMEA 3UNSA 3VXFH 1YC0A 1CT2E 2XNIA 5L2ZH 1V3XA 1QAVB 2LC6A 1C2EA 1GCTB 4AGKA 4Y7BA 1FAKH 4HI3A 3K50A 9ESTA 3S9CA 2Y82A 3A84A 3BTTE 1ACBE 2ODQA 2DLSA 1A5GH 1MZAA 2D26C 4CRGA 3F9FA 2SGPE 2Z3CA 2PKAA 3G01A 2C93B 3C1KA 4AB9A 2ZGXH 1TMTH 1WI2A 5JB8S 4K78A 2XBVA 1YPJH 5JXBA 2B8OH 4X6MA 1O3BA 1V5LA 2W3KA 2RCEA 2O9QA 3LH3A 2M3MA 1C5OH 1SB1H 4ZHMU 3SUGA 5A0CA 2AWUA 1O2LA 1H4WA 2YNAA 3MU4A 4E34A 2FM2A 3HGNA 4AMHA 2VWLA 3BIUH 4H11A 3MYWA 2FOGA 2QV1A 3VGCC 1K28D 1NZQH 1GMDG 1O2XA 3BG4C 5DP5A 1TGSZ 3RU4D 2BZ6H 3KHFA 1PPBH 1TAWA 3SNDA 3IWMA 3AXAA 1A0LA 1WUNH 1AE8H 2NU4E 5GWZA 1ZMJA 1Y5AT 1O2JA 2O8LA 1W7GH 1AN1E 2SGQE 1C2KA 4K5ZA 4VGCC 4E7RG 5EYZA 1CBWC 1G36A 1O32A 1BTWA 3GYMA 4OAJA 3ITIA 4Y71A 1GGDC 2ALPA 1A5IA 1LCYA 3D23A 1L4DA 1Z86A 8ESTE 1A46H 3PO1C 1BBRK 2AMPA 1C2LA 2K1QA 1EAIA 2HGTH 3SUDA 1SLVB 5E2PA 4GLYA 2OC7A 2R2WU 2BQ6B 4FLNA 3H7OA 1L0ZA 1LKBA 2WPHS 4JORA 3PMJA 1SGIB 1TNGA 4TPIZ 1TQ0B 4JOHA 1Y3XA 3HGPA 2UWPA 5I25A 1ZZZA 3PMBB 1ELCA 4WY3A 1I92A 4BNRA 1IQEA 1MAXA 1UTKA 2FI4E 2VB0A 1TONA 1Y3YA 2J95A 2Q1JA 2KG2A 4KTSA 3O5NA 5FPSA 2GCTB 1FY3A 2QBWA 2Z17A 3LGUA 1ZRBA 5EGMA 1IU0A 3SN8A 3A7XA 1XZ9A 1A7SA 1F0UA 1BTPA 1MFGA 1FC7A 1FI8A 7GCHG 1P8VC 3GCNA 2A2QH 3FANA 2SGFE 1LPZB 4GVUA 1KXAA 1C1VH 3RXQA 1GMDF 1KLJH 2I0IA 1K1JA 1D6WA 1FMGA