1Q3OA

Crystal structure of the shank pdz-ligand complex reveals a class i pdz interaction and a novel pdz-pdz dimerization
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
DYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Shank1
publication title Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 20
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1q3oA00
2W7RA 2KG2A 1RY4A 4NMVA 1V5QA 1WG6A 2VRFA 2Z17A 3CBXA 2OZFA 5F67A 2EHRA 3OU0A 4NMQA 2GZVA 4WYTA 5E21A 3HPMA 4JOFA 3QDOA 1NTEA 2EDVA 5HDYA 1B8QA 2DLUA 3OTPA 1P1EA 2IWNA 1OBXA 5G1DA 1W9OA 1N6FA 3K50A 1VA8A 3GCOA 3PV4A 4Q2PA 2EJYA 2OS6A 2KAWA 2QT5A 1N7FA 2REYA 3LNXA 1V1TA 1VB7A 2V90A 2KJDA 3LNYA 3SFJA 2Q3GA 5B6LA 4Q6SA 1UITA 2I4SA 2LC7A 1WH1A 3ID4A 3RLEA 5HEYA 2KV8A 2M0ZA 3DJ1A 1P1DA 3R0HA 3DIWA 2KA9A 1YBOA 1BFEA 1L6OA 1N99A 4OAJA 2KOMA 4HOPA 1IHJA 4JOEA 2ZPLA 1WF8A 1K32A 2BYGA 1X5RA 4MPAA 3KHFA 4JOJA 3VQGA 5FB8C 1Y8TA 4NNMA 2VWRA 3GSLA 2M10A 3K82A 1UFXA 2LC6A 2F5YA 1I16A 1WFGA 4Q3HA 1U39A 2YUYA 5FHTA 2M3MA 4JOPA 1V5LA 3TSWA 1WIFA 3CYYA 1VJ6A 1X8SA 1WI2A 3DJ3A 1UEPA 2JWEA 1WHAA 2HE2A 1X5QA 2EEHA 3KZEA 1I92A 2FCFA 4K6YA 4PQWA 2AWXA 2PNTA 3AXAA 2I1NA 3VQFA 2OCSA 4HOPB 2M0VA 1Q3PA 2KOJA 4Q2OA 4YDPA 1Q3OA 5HFEA 4KFWA 3HPKA 2JOAA 5HFBA 4Q6HA 2JXOA 5E6PB 2E7KA 3KZDA 3DORA 4RI0A 2MX6A 2I0IA 3PV5A 2V1WA 1TP5A 2EAQA 4GHNA 1Z87A 5G1EA 4JORA 1UEWA 3WKLA 5HETA 2CS5A 5I7ZA 2EEIA 1T2MA 2H3LA 5HFCA 4OEOA 2UZCA 3JXTA 5HFFA 1RGRA 2G5MB 2L4TA 1D5GA 1WF7A 2KYLA 2OQSA 4NNLA 1V6BA 2CSSA 3EGGC 1X6DA 4XHVA 2KBSA 1UEQA 3MH6A 3SUZA 1W9EA 2EDZA 3QIKA 1IU2A 1WFVA 3ZRTA 1Z86A 1UM1A 4GVDA 4WYUA 4K78A 4NXRA 2EXGA 2FNEA 2JINA 4P0CA 3L4FD 2L4SA 3QJMA 3ID2A 2D90A 4JOKA 2KPKA 1WJLA 2EEGA 3E17A 3B76A 2M0UA 4E35A 1N6EA 1FC9A 2ENOA 3I18A 5HFDA 1Q7XA 4UU5A 2HE4A 2VSPA 2EGKA 1UM7A 4NXPA 5HJ1A 4R2ZA 4OEPA 1VAEA 5HEDA 4JL7A 1U37A 2QKTA 3GCNA 5E1YA 1N6DA 3CBZA 1ZOKA 2FE5A 1FCFA 3PDZA 4NXQA 4NMPA 2EGOA 2R3YA 2VPHA 1KEFA 4JOGA 4Q2NA 1IU0A 1OZIA 1SOZA 2DKRA 4UU6A 2PDZA 2RRMA 4NMRA 5HF4A 1UEZA 1WI4A 3NFKA 4K72A 3RL7A 4GVCA 2OGPA 3STJA 2EDPA 2ZPMA 1N7EA 2LA8A 1TQ3A 3GDVA 1FC6A 3WKMA 4JOHA 2M0TA 5D13A 3CBYA 3DJAA 4K76A 1FC7A 5HEBA 5HF1A 5A2PA 1G9OA 1X45A 4Z33A 2MHOA 1OBYA 2O2TA 3GDUA 2DMZA 4REYA 2LOBA 3ID3A 2VZ5A 2R4HA 4YYXA 2KOHA 3EGHC 2KJKA 2IWQA 2K1ZA 1GM1A 2G2LA 2PKUA 2F0AA 3HVQC 2PZDA 2KRGA 4LMMA 1VCWA 4F8KA 3CS0A 4L8NA 3GJ9A 2W4FA 4IC6A 1UF1A 1Y7NA 1OBZA 3TMHA 2P3WA 3ID1A 2DLSA 2DM8A 3TSZA 1MFLA 2H2CA 3SHUA 1RGWA 2EGNA 1UJVA 2WL7A 3CH8A 2LUIA 2QG1A 2IWPA 2K20A 1U38A 1M5ZA 2JILA 5GNDA 2X7ZA 1PDRA 5E11A 1QLCA 1RZXA 2OMJA 2VSVA 2YUBA 2PKTA 5GLJA 3RL8A 3MH7A 2DAZA 2QKUA 2DC2A 2JREA 4P2AB 5E22A 2Q9VA 1UJUA 4E3BA 2D92A 3TSVA 2D8IA 1QAVA 2EEJA 4E34A 2OPGA 2KL1A 4KFVA 1NF3C 3BPUA 5JXBA 2DJTA 3R69A 1GQ4A 4FGMA 2HGAA 2I04A 1KY9A 1N7TA 3SOEA 4NMTA 1V62A 2CSJA 4O06A 1TP3A 3I1EA 3O46A 3SHWA 1LCYA 1SOTA 1ZUBA 2EV8A 4AMHA 1MFGA 1WHDA 3GGEA 4H11A 1QAUA 2L97A 3K1RA 1GQ5A 1X5NA 2FN5A 4NMSA 1KWAA 2DB5A 3QO6A 1UJDA 3MH4A 1UHPA 4Q2QA 3I4WA 2JIKA 1BE9A 2YT8A 3PV2A 3R68A 5DTHA 4EDJA 2OSGA 2IWOA 3NFLA 2RCZA 2PA1A 3GDSA 1QAVB 4N6XA 3O5NA 3NGHA 5EZ0A 2YT7A 2YTWA 2Z9IA 1R6JA 2KJPA 3QJNA 3FY5A 1MC7A 2QKVA 5EYZA 2AWWA 2I0LA 2KPLA 2I6VA 5H3JA 2AINA 5F3XA 4G69A 2H3MA 3PDVA 1W9QA 1U3BA 3QGLA 3PS4A 1TE0A 2H2BA 4NMOA 4Z8JA 4K75A 1XZ9A 3QE1A 2QBWA 2KQFA 3CC0A 2AWUA
chains in the Genus database with same CATH superfamily
2W7RA 2KG2A 1RY4A 4NMVA 1V5QA 1WG6A 2VRFA 2Z17A 4FLNA 3CBXA 2OZFA 5F67A 2EHRA 3OU0A 4NMQA 2GZVA 4WYTA 5E21A 3HPMA 4JOFA 3QDOA 1NTEA 2EDVA 5HDYA 1B8QA 2DLUA 3OTPA 1P1EA 2IWNA 1OBXA 5G1DA 1W9OA 1N6FA 3K50A 1VA8A 3GCOA 3PV4A 4Q2PA 2EJYA 2OS6A 2KAWA 2QT5A 1N7FA 1X9ZA 2REYA 3LNXA 3NCVA 1V1TA 1VB7A 3GABA 2JSNA 2V90A 2KJDA 3LNYA 3SFJA 2Q3GA 5B6LA 4Q6SA 1UITA 2I4SA 2LC7A 1WH1A 3ID4A 3RLEA 5HEYA 2KV8A 2M0ZA 3DJ1A 1P1DA 3R0HA 3DIWA 2KA9A 1YBOA 1BFEA 1L6OA 1N99A 4OAJA 2KOMA 4HOPA 1IHJA 4JOEA 2ZPLA 1WF8A 1K32A 2BYGA 1X5RA 4MPAA 3KHFA 4JOJA 3VQGA 5FB8C 1Y8TA 4NNMA 2VWRA 3GSLA 2M10A 3K82A 1UFXA 2LC6A 2F5YA 1I16A 1WFGA 4Q3HA 1U39A 2YUYA 5FHTA 2M3MA 4JOPA 1V5LA 3TSWA 1WIFA 3CYYA 1VJ6A 1X8SA 1WI2A 3DJ3A 1UEPA 2JWEA 1WHAA 2HE2A 5IL9A 1X5QA 2EEHA 3KZEA 1I92A 2FCFA 4K6YA 4PQWA 2AWXA 2PNTA 3AXAA 2I1NA 3VQFA 2OCSA 4HOPB 2M0VA 1Q3PA 2KOJA 4Q2OA 4YDPA 1Q3OA 5HFEA 4KFWA 3HPKA 2JOAA 5HFBA 4Q6HA 2JXOA 5E6PB 2E7KA 3KZDA 3DORA 4RI0A 2MX6A 2I0IA 3PV5A 2V1WA 1TP5A 2EAQA 4GHNA 1Z87A 5G1EA 4JORA 1UEWA 3WKLA 5HETA 2CS5A 5I7ZA 2EEIA 1T2MA 2H3LA 5HFCA 4OEOA 2UZCA 3JXTA 5HFFA 1RGRA 2G5MB 2L4TA 1D5GA 1WF7A 2KYLA 2OQSA 4NNLA 1V6BA 2CSSA 3EGGC 1X6DA 3KDGA 4XHVA 2KBSA 1UEQA 3MH6A 3SUZA 1W9EA 2EDZA 3QIKA 1IU2A 1WFVA 3ZRTA 1Z86A 1UM1A 4GVDA 4WYUA 4K78A 4NXRA 2EXGA 2FNEA 2JINA 4P0CA 3L4FD 2L4SA 3QJMA 3ID2A 2D90A 4JOKA 2KPKA 1WJLA 2EEGA 3E17A 3B76A 2M0UA 4E35A 1N6EA 1FC9A 2ENOA 3I18A 5HFDA 1Q7XA 4UU5A 2HE4A 3KDKA 2VSPA 2EGKA 1UM7A 4NXPA 5HJ1A 4R2ZA 4OEPA 1VAEA 5HEDA 4JL7A 1U37A 2QKTA 3GCNA 5E1YA 1N6DA 3CBZA 1ZOKA 2FE5A 1FCFA 3PDZA 4NXQA 4NMPA 2EGOA 2R3YA 2VPHA 1KEFA 4JOGA 4Q2NA 1IU0A 1OZIA 1SOZA 2DKRA 4UU6A 2PDZA 2RRMA 4NMRA 5HF4A 1UEZA 1WI4A 3NFKA 4K72A 3RL7A 4GVCA 2OGPA 3STJA 2EDPA 2ZPMA 1N7EA 2LA8A 1TQ3A 3GDVA 1FC6A 3WKMA 4JOHA 2M0TA 5D13A 3CBYA 3DJAA 4K76A 1FC7A 5HEBA 5HF1A 5A2PA 1G9OA 1X45A 4Z33A 2MHOA 1OBYA 2O2TA 3GDUA 2DMZA 4REYA 2LOBA 3ID3A 2VZ5A 2R4HA 4YYXA 2KOHA 3EGHC 2KJKA 2IWQA 2K1ZA 1GM1A 2G2LA 2PKUA 2F0AA 3HVQC 2PZDA 2KRGA 4LMMA 1VCWA 4F8KA 3CS0A 4L8NA 3GJ9A 2W4FA 4IC6A 1UF1A 1Y7NA 1OBZA 3TMHA 2P3WA 3ID1A 2DLSA 2DM8A 3TSZA 1MFLA 2H2CA 3SHUA 1RGWA 2EGNA 1UJVA 2WL7A 3CH8A 2LUIA 2QG1A 2IWPA 4JJ3A 2K20A 2GEFA 1U38A 1M5ZA 2JILA 5GNDA 2X7ZA 1PDRA 5E11A 1QLCA 1RZXA 2OMJA 2VSVA 2YUBA 2PKTA 5GLJA 3RL8A 3MH7A 2DAZA 2QKUA 2DC2A 2JREA 4P2AB 5E22A 2Q9VA 1UJUA 4E3BA 2D92A 3TSVA 2D8IA 1QAVA 2EEJA 4E34A 2OPGA 2KL1A 4KFVA 1NF3C 3BPUA 5JXBA 2DJTA 3R69A 1GQ4A 4FGMA 2HGAA 2I04A 1KY9A 1N7TA 3SOEA 4NMTA 1V62A 2CSJA 4O06A 1TP3A 3I1EA 3O46A 3SHWA 1LCYA 1SOTA 1ZUBA 2EV8A 4AMHA 1MFGA 1WHDA 3GGEA 5ILBA 4H11A 1QAUA 2L97A 3K1RA 1GQ5A 1X5NA 2FN5A 4NMSA 4JJ0A 1KWAA 2DB5A 3QO6A 1UJDA 3MH4A 1UHPA 4Q2QA 3I4WA 2JIKA 1BE9A 2YT8A 3PV2A 3R68A 5DTHA 4EDJA 2OSGA 2IWOA 3NFLA 2RCZA 2PA1A 3GDSA 1QAVB 4N6XA 3O5NA 3NGHA 5EZ0A 2YT7A 2YTWA 2Z9IA 1R6JA 2KJPA 3QJNA 3FY5A 5B42A 1MC7A 2QKVA 5EYZA 2AWWA 2I0LA 2KPLA 2I6VA 5H3JA 2AINA 5F3XA 4G69A 2H3MA 3PDVA 1W9QA 1U3BA 3QGLA 3PS4A 1TE0A 2H2BA 4NMOA 4Z8JA 4K75A 1XZ9A 3QE1A 2QBWA 2KQFA 3CC0A 2AWUA
chains in the Genus database with same CATH topology
2W7RA 2KG2A 1RY4A 4NMVA 1V5QA 1WG6A 2VRFA 2Z17A 4FLNA 3CBXA 2OZFA 5F67A 2EHRA 3OU0A 4NMQA 2GZVA 4WYTA 5E21A 3HPMA 4JOFA 3QDOA 1NTEA 2EDVA 5HDYA 1B8QA 2DLUA 3OTPA 1P1EA 2IWNA 1OBXA 5G1DA 1W9OA 1N6FA 3K50A 1VA8A 3GCOA 3PV4A 4Q2PA 2EJYA 2OS6A 2KAWA 2QT5A 1N7FA 1X9ZA 2REYA 3LNXA 3NCVA 1V1TA 1VB7A 3GABA 2JSNA 2V90A 2KJDA 3LNYA 3SFJA 2Q3GA 5B6LA 4Q6SA 1UITA 2I4SA 2LC7A 1WH1A 3ID4A 3RLEA 5HEYA 2KV8A 2M0ZA 3DJ1A 1P1DA 3R0HA 3DIWA 2KA9A 1YBOA 1BFEA 1L6OA 1N99A 4OAJA 2KOMA 4HOPA 1IHJA 4JOEA 2ZPLA 1WF8A 1K32A 2BYGA 1X5RA 4MPAA 3KHFA 4JOJA 3VQGA 5FB8C 1Y8TA 4NNMA 2VWRA 3GSLA 2M10A 3K82A 1UFXA 2LC6A 2F5YA 1I16A 1WFGA 4Q3HA 1U39A 2YUYA 5FHTA 2M3MA 4JOPA 1V5LA 3TSWA 1WIFA 3CYYA 1VJ6A 1X8SA 1WI2A 3DJ3A 1UEPA 2JWEA 1WHAA 2HE2A 5IL9A 1X5QA 2EEHA 3KZEA 1I92A 2FCFA 4K6YA 4PQWA 2AWXA 2PNTA 3AXAA 2I1NA 3VQFA 2OCSA 4HOPB 2M0VA 1Q3PA 2KOJA 4Q2OA 4YDPA 1Q3OA 5HFEA 4KFWA 3HPKA 2JOAA 5HFBA 4Q6HA 2JXOA 5E6PB 2E7KA 3KZDA 3DORA 4RI0A 2MX6A 2I0IA 3PV5A 2V1WA 1TP5A 2EAQA 4GHNA 1Z87A 5G1EA 4JORA 1UEWA 3WKLA 5HETA 2CS5A 5I7ZA 2EEIA 1T2MA 2H3LA 5HFCA 4OEOA 2UZCA 3JXTA 5HFFA 1RGRA 2G5MB 2L4TA 1D5GA 1WF7A 2KYLA 2OQSA 4NNLA 1V6BA 2CSSA 3EGGC 1X6DA 3KDGA 4XHVA 2KBSA 1UEQA 3MH6A 3SUZA 1W9EA 2EDZA 3QIKA 1IU2A 1WFVA 3ZRTA 1Z86A 1UM1A 4GVDA 4WYUA 4K78A 4NXRA 2EXGA 2FNEA 2JINA 4P0CA 3L4FD 2L4SA 3QJMA 3ID2A 2D90A 4JOKA 2KPKA 1WJLA 2EEGA 3E17A 3B76A 2M0UA 4E35A 1N6EA 1FC9A 2ENOA 3I18A 5HFDA 1Q7XA 4UU5A 2HE4A 3KDKA 2VSPA 2EGKA 1UM7A 4NXPA 5HJ1A 4R2ZA 4OEPA 1VAEA 5HEDA 4JL7A 1U37A 2QKTA 3GCNA 5E1YA 1N6DA 3CBZA 1ZOKA 2FE5A 1FCFA 3PDZA 4NXQA 4NMPA 2EGOA 2R3YA 2VPHA 1KEFA 4JOGA 4Q2NA 1IU0A 1OZIA 1SOZA 2DKRA 4UU6A 2PDZA 2RRMA 4NMRA 5HF4A 1UEZA 1WI4A 3NFKA 4K72A 3RL7A 4GVCA 2OGPA 3STJA 2EDPA 2ZPMA 1N7EA 2LA8A 1TQ3A 3GDVA 1FC6A 3WKMA 4JOHA 2M0TA 5D13A 3CBYA 3DJAA 4K76A 1FC7A 5HEBA 5HF1A 5A2PA 1G9OA 1X45A 4Z33A 2MHOA 1OBYA 2O2TA 3GDUA 2DMZA 4REYA 2LOBA 3ID3A 2VZ5A 2R4HA 4YYXA 2KOHA 3EGHC 2KJKA 2IWQA 2K1ZA 1GM1A 2G2LA 2PKUA 2F0AA 3HVQC 2PZDA 2KRGA 4LMMA 1VCWA 4F8KA 3CS0A 4L8NA 3GJ9A 2W4FA 4IC6A 1UF1A 1Y7NA 1OBZA 3TMHA 2P3WA 3ID1A 2DLSA 2DM8A 3TSZA 1MFLA 2H2CA 3SHUA 1RGWA 2EGNA 1UJVA 2WL7A 3CH8A 2LUIA 2QG1A 2IWPA 4JJ3A 2K20A 2GEFA 1U38A 1M5ZA 2JILA 5GNDA 2X7ZA 1PDRA 5E11A 1QLCA 1RZXA 2OMJA 2VSVA 2YUBA 2PKTA 5GLJA 3RL8A 3MH7A 2DAZA 2QKUA 2DC2A 2JREA 4P2AB 5E22A 2Q9VA 1UJUA 4E3BA 2D92A 3TSVA 2D8IA 1QAVA 2EEJA 4E34A 2OPGA 2KL1A 4KFVA 1NF3C 3BPUA 5JXBA 2DJTA 3R69A 1GQ4A 4FGMA 2HGAA 2I04A 1KY9A 1N7TA 3SOEA 4NMTA 1V62A 2CSJA 4O06A 1TP3A 3I1EA 3O46A 3SHWA 1LCYA 1SOTA 1ZUBA 2EV8A 4AMHA 1MFGA 1WHDA 3GGEA 5ILBA 4H11A 1QAUA 2L97A 3K1RA 1GQ5A 1X5NA 2FN5A 4NMSA 4JJ0A 1KWAA 2DB5A 3QO6A 1UJDA 3MH4A 1UHPA 4Q2QA 3I4WA 2JIKA 1BE9A 2YT8A 3PV2A 3R68A 5DTHA 4EDJA 2OSGA 2IWOA 3NFLA 2RCZA 2PA1A 3GDSA 1QAVB 4N6XA 3O5NA 3NGHA 5EZ0A 2YT7A 2YTWA 2Z9IA 1R6JA 2KJPA 3QJNA 3FY5A 5B42A 1MC7A 2QKVA 5EYZA 2AWWA 2I0LA 2KPLA 2I6VA 5H3JA 2AINA 5F3XA 4G69A 2H3MA 3PDVA 1W9QA 1U3BA 3QGLA 3PS4A 1TE0A 2H2BA 4NMOA 4Z8JA 4K75A 1XZ9A 3QE1A 2QBWA 2KQFA 3CC0A 2AWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W7R A;  2KG2 A;  1RY4 A;  4NMV A;  1V5Q A;  1WG6 A;  2VRF A;  2Z17 A;  3CBX A;  2OZF A;  5F67 A;  2EHR A;  3OU0 A;  4NMQ A;  2GZV A;  4WYT A;  5E21 A;  3HPM A;  4JOF A;  3QDO A;  1NTE A;  2EDV A;  5HDY A;  1B8Q A;  2DLU A;  3OTP A;  1P1E A;  2IWN A;  1OBX A;  5G1D A;  1W9O A;  1N6F A;  3K50 A;  1VA8 A;  3GCO A;  3PV4 A;  4Q2P A;  2EJY A;  2OS6 A;  2KAW A;  2QT5 A;  1N7F A;  2REY A;  3LNX A;  1V1T A;  1VB7 A;  2V90 A;  2KJD A;  3LNY A;  3SFJ A;  2Q3G A;  5B6L A;  4Q6S A;  1UIT A;  2I4S A;  2LC7 A;  1WH1 A;  3ID4 A;  3RLE A;  5HEY A;  2KV8 A;  2M0Z A;  3DJ1 A;  1P1D A;  3R0H A;  3DIW A;  2KA9 A;  1YBO A;  1BFE A;  1L6O A;  1N99 A;  4OAJ A;  2KOM A;  4HOP A;  1IHJ A;  4JOE A;  2ZPL A;  1WF8 A;  1K32 A;  2BYG A;  1X5R A;  4MPA A;  3KHF A;  4JOJ A;  3VQG A;  5FB8 C;  1Y8T A;  4NNM A;  2VWR A;  3GSL A;  2M10 A;  3K82 A;  1UFX A;  2LC6 A;  2F5Y A;  1I16 A;  1WFG A;  4Q3H A;  1U39 A;  2YUY A;  5FHT A;  2M3M A;  4JOP A;  1V5L A;  3TSW A;  1WIF A;  3CYY A;  1VJ6 A;  1X8S A;  1WI2 A;  3DJ3 A;  1UEP A;  2JWE A;  1WHA A;  2HE2 A;  1X5Q A;  2EEH A;  3KZE A;  1I92 A;  2FCF A;  4K6Y A;  4PQW A;  2AWX A;  2PNT A;  3AXA A;  2I1N A;  3VQF A;  2OCS A;  4HOP B;  2M0V A;  1Q3P A;  2KOJ A;  4Q2O A;  4YDP A;  1Q3O A;  5HFE A;  4KFW A;  3HPK A;  2JOA A;  5HFB A;  4Q6H A;  2JXO A;  5E6P B;  2E7K A;  3KZD A;  3DOR A;  4RI0 A;  2MX6 A;  2I0I A;  3PV5 A;  2V1W A;  1TP5 A;  2EAQ A;  4GHN A;  1Z87 A;  5G1E A;  4JOR A;  1UEW A;  3WKL A;  5HET A;  2CS5 A;  5I7Z A;  2EEI A;  1T2M A;  2H3L A;  5HFC A;  4OEO A;  2UZC A;  3JXT A;  5HFF A;  1RGR A;  2G5M B;  2L4T A;  1D5G A;  1WF7 A;  2KYL A;  2OQS A;  4NNL A;  1V6B A;  2CSS A;  3EGG C;  1X6D A;  4XHV A;  2KBS A;  1UEQ A;  3MH6 A;  3SUZ A;  1W9E A;  2EDZ A;  3QIK A;  1IU2 A;  1WFV A;  3ZRT A;  1Z86 A;  1UM1 A;  4GVD A;  4WYU A;  4K78 A;  4NXR A;  2EXG A;  2FNE A;  2JIN A;  4P0C A;  3L4F D;  2L4S A;  3QJM A;  3ID2 A;  2D90 A;  4JOK A;  2KPK A;  1WJL A;  2EEG A;  3E17 A;  3B76 A;  2M0U A;  4E35 A;  1N6E A;  1FC9 A;  2ENO A;  3I18 A;  5HFD A;  1Q7X A;  4UU5 A;  2HE4 A;  2VSP A;  2EGK A;  1UM7 A;  4NXP A;  5HJ1 A;  4R2Z A;  4OEP A;  1VAE A;  5HED A;  4JL7 A;  1U37 A;  2QKT A;  3GCN A;  5E1Y A;  1N6D A;  3CBZ A;  1ZOK A;  2FE5 A;  1FCF A;  3PDZ A;  4NXQ A;  4NMP A;  2EGO A;  2R3Y A;  2VPH A;  1KEF A;  4JOG A;  4Q2N A;  1IU0 A;  1OZI A;  1SOZ A;  2DKR A;  4UU6 A;  2PDZ A;  2RRM A;  4NMR A;  5HF4 A;  1UEZ A;  1WI4 A;  3NFK A;  4K72 A;  3RL7 A;  4GVC A;  2OGP A;  3STJ A;  2EDP A;  2ZPM A;  1N7E A;  2LA8 A;  1TQ3 A;  3GDV A;  1FC6 A;  3WKM A;  4JOH A;  2M0T A;  5D13 A;  3CBY A;  3DJA A;  4K76 A;  1FC7 A;  5HEB A;  5HF1 A;  5A2P A;  1G9O A;  1X45 A;  4Z33 A;  2MHO A;  1OBY A;  2O2T A;  3GDU A;  2DMZ A;  4REY A;  2LOB A;  3ID3 A;  2VZ5 A;  2R4H A;  4YYX A;  2KOH A;  3EGH C;  2KJK A;  2IWQ A;  2K1Z A;  1GM1 A;  2G2L A;  2PKU A;  2F0A A;  3HVQ C;  2PZD A;  2KRG A;  4LMM A;  1VCW A;  4F8K A;  3CS0 A;  4L8N A;  3GJ9 A;  2W4F A;  4IC6 A;  1UF1 A;  1Y7N A;  1OBZ A;  3TMH A;  2P3W A;  3ID1 A;  2DLS A;  2DM8 A;  3TSZ A;  1MFL A;  2H2C A;  3SHU A;  1RGW A;  2EGN A;  1UJV A;  2WL7 A;  3CH8 A;  2LUI A;  2QG1 A;  2IWP A;  2K20 A;  1U38 A;  1M5Z A;  2JIL A;  5GND A;  2X7Z A;  1PDR A;  5E11 A;  1QLC A;  1RZX A;  2OMJ A;  2VSV A;  2YUB A;  2PKT A;  5GLJ A;  3RL8 A;  3MH7 A;  2DAZ A;  2QKU A;  2DC2 A;  2JRE A;  4P2A B;  5E22 A;  2Q9V A;  1UJU A;  4E3B A;  2D92 A;  3TSV A;  2D8I A;  1QAV A;  2EEJ A;  4E34 A;  2OPG A;  2KL1 A;  4KFV A;  1NF3 C;  3BPU A;  5JXB A;  2DJT A;  3R69 A;  1GQ4 A;  4FGM A;  2HGA A;  2I04 A;  1KY9 A;  1N7T A;  3SOE A;  4NMT A;  1V62 A;  2CSJ A;  4O06 A;  1TP3 A;  3I1E A;  3O46 A;  3SHW A;  1LCY A;  1SOT A;  1ZUB A;  2EV8 A;  4AMH A;  1MFG A;  1WHD A;  3GGE A;  4H11 A;  1QAU A;  2L97 A;  3K1R A;  1GQ5 A;  1X5N A;  2FN5 A;  4NMS A;  1KWA A;  2DB5 A;  3QO6 A;  1UJD A;  3MH4 A;  1UHP A;  4Q2Q A;  3I4W A;  2JIK A;  1BE9 A;  2YT8 A;  3PV2 A;  3R68 A;  5DTH A;  4EDJ A;  2OSG A;  2IWO A;  3NFL A;  2RCZ A;  2PA1 A;  3GDS A;  1QAV B;  4N6X A;  3O5N A;  3NGH A;  5EZ0 A;  2YT7 A;  2YTW A;  2Z9I A;  1R6J A;  2KJP A;  3QJN A;  3FY5 A;  1MC7 A;  2QKV A;  5EYZ A;  2AWW A;  2I0L A;  2KPL A;  2I6V A;  5H3J A;  2AIN A;  5F3X A;  4G69 A;  2H3M A;  3PDV A;  1W9Q A;  1U3B A;  3QGL A;  3PS4 A;  1TE0 A;  2H2B A;  4NMO A;  4Z8J A;  4K75 A;  1XZ9 A;  3QE1 A;  2QBW A;  2KQF A;  3CC0 A;  2AWU A; 
#chains in the Genus database with same CATH topology
 2W7R A;  2KG2 A;  1RY4 A;  4NMV A;  1V5Q A;  1WG6 A;  2VRF A;  2Z17 A;  4FLN A;  3CBX A;  2OZF A;  5F67 A;  2EHR A;  3OU0 A;  4NMQ A;  2GZV A;  4WYT A;  5E21 A;  3HPM A;  4JOF A;  3QDO A;  1NTE A;  2EDV A;  5HDY A;  1B8Q A;  2DLU A;  3OTP A;  1P1E A;  2IWN A;  1OBX A;  5G1D A;  1W9O A;  1N6F A;  3K50 A;  1VA8 A;  3GCO A;  3PV4 A;  4Q2P A;  2EJY A;  2OS6 A;  2KAW A;  2QT5 A;  1N7F A;  1X9Z A;  2REY A;  3LNX A;  3NCV A;  1V1T A;  1VB7 A;  3GAB A;  2JSN A;  2V90 A;  2KJD A;  3LNY A;  3SFJ A;  2Q3G A;  5B6L A;  4Q6S A;  1UIT A;  2I4S A;  2LC7 A;  1WH1 A;  3ID4 A;  3RLE A;  5HEY A;  2KV8 A;  2M0Z A;  3DJ1 A;  1P1D A;  3R0H A;  3DIW A;  2KA9 A;  1YBO A;  1BFE A;  1L6O A;  1N99 A;  4OAJ A;  2KOM A;  4HOP A;  1IHJ A;  4JOE A;  2ZPL A;  1WF8 A;  1K32 A;  2BYG A;  1X5R A;  4MPA A;  3KHF A;  4JOJ A;  3VQG A;  5FB8 C;  1Y8T A;  4NNM A;  2VWR A;  3GSL A;  2M10 A;  3K82 A;  1UFX A;  2LC6 A;  2F5Y A;  1I16 A;  1WFG A;  4Q3H A;  1U39 A;  2YUY A;  5FHT A;  2M3M A;  4JOP A;  1V5L A;  3TSW A;  1WIF A;  3CYY A;  1VJ6 A;  1X8S A;  1WI2 A;  3DJ3 A;  1UEP A;  2JWE A;  1WHA A;  2HE2 A;  5IL9 A;  1X5Q A;  2EEH A;  3KZE A;  1I92 A;  2FCF A;  4K6Y A;  4PQW A;  2AWX A;  2PNT A;  3AXA A;  2I1N A;  3VQF A;  2OCS A;  4HOP B;  2M0V A;  1Q3P A;  2KOJ A;  4Q2O A;  4YDP A;  1Q3O A;  5HFE A;  4KFW A;  3HPK A;  2JOA A;  5HFB A;  4Q6H A;  2JXO A;  5E6P B;  2E7K A;  3KZD A;  3DOR A;  4RI0 A;  2MX6 A;  2I0I A;  3PV5 A;  2V1W A;  1TP5 A;  2EAQ A;  4GHN A;  1Z87 A;  5G1E A;  4JOR A;  1UEW A;  3WKL A;  5HET A;  2CS5 A;  5I7Z A;  2EEI A;  1T2M A;  2H3L A;  5HFC A;  4OEO A;  2UZC A;  3JXT A;  5HFF A;  1RGR A;  2G5M B;  2L4T A;  1D5G A;  1WF7 A;  2KYL A;  2OQS A;  4NNL A;  1V6B A;  2CSS A;  3EGG C;  1X6D A;  3KDG A;  4XHV A;  2KBS A;  1UEQ A;  3MH6 A;  3SUZ A;  1W9E A;  2EDZ A;  3QIK A;  1IU2 A;  1WFV A;  3ZRT A;  1Z86 A;  1UM1 A;  4GVD A;  4WYU A;  4K78 A;  4NXR A;  2EXG A;  2FNE A;  2JIN A;  4P0C A;  3L4F D;  2L4S A;  3QJM A;  3ID2 A;  2D90 A;  4JOK A;  2KPK A;  1WJL A;  2EEG A;  3E17 A;  3B76 A;  2M0U A;  4E35 A;  1N6E A;  1FC9 A;  2ENO A;  3I18 A;  5HFD A;  1Q7X A;  4UU5 A;  2HE4 A;  3KDK A;  2VSP A;  2EGK A;  1UM7 A;  4NXP A;  5HJ1 A;  4R2Z A;  4OEP A;  1VAE A;  5HED A;  4JL7 A;  1U37 A;  2QKT A;  3GCN A;  5E1Y A;  1N6D A;  3CBZ A;  1ZOK A;  2FE5 A;  1FCF A;  3PDZ A;  4NXQ A;  4NMP A;  2EGO A;  2R3Y A;  2VPH A;  1KEF A;  4JOG A;  4Q2N A;  1IU0 A;  1OZI A;  1SOZ A;  2DKR A;  4UU6 A;  2PDZ A;  2RRM A;  4NMR A;  5HF4 A;  1UEZ A;  1WI4 A;  3NFK A;  4K72 A;  3RL7 A;  4GVC A;  2OGP A;  3STJ A;  2EDP A;  2ZPM A;  1N7E A;  2LA8 A;  1TQ3 A;  3GDV A;  1FC6 A;  3WKM A;  4JOH A;  2M0T A;  5D13 A;  3CBY A;  3DJA A;  4K76 A;  1FC7 A;  5HEB A;  5HF1 A;  5A2P A;  1G9O A;  1X45 A;  4Z33 A;  2MHO A;  1OBY A;  2O2T A;  3GDU A;  2DMZ A;  4REY A;  2LOB A;  3ID3 A;  2VZ5 A;  2R4H A;  4YYX A;  2KOH A;  3EGH C;  2KJK A;  2IWQ A;  2K1Z A;  1GM1 A;  2G2L A;  2PKU A;  2F0A A;  3HVQ C;  2PZD A;  2KRG A;  4LMM A;  1VCW A;  4F8K A;  3CS0 A;  4L8N A;  3GJ9 A;  2W4F A;  4IC6 A;  1UF1 A;  1Y7N A;  1OBZ A;  3TMH A;  2P3W A;  3ID1 A;  2DLS A;  2DM8 A;  3TSZ A;  1MFL A;  2H2C A;  3SHU A;  1RGW A;  2EGN A;  1UJV A;  2WL7 A;  3CH8 A;  2LUI A;  2QG1 A;  2IWP A;  4JJ3 A;  2K20 A;  2GEF A;  1U38 A;  1M5Z A;  2JIL A;  5GND A;  2X7Z A;  1PDR A;  5E11 A;  1QLC A;  1RZX A;  2OMJ A;  2VSV A;  2YUB A;  2PKT A;  5GLJ A;  3RL8 A;  3MH7 A;  2DAZ A;  2QKU A;  2DC2 A;  2JRE A;  4P2A B;  5E22 A;  2Q9V A;  1UJU A;  4E3B A;  2D92 A;  3TSV A;  2D8I A;  1QAV A;  2EEJ A;  4E34 A;  2OPG A;  2KL1 A;  4KFV A;  1NF3 C;  3BPU A;  5JXB A;  2DJT A;  3R69 A;  1GQ4 A;  4FGM A;  2HGA A;  2I04 A;  1KY9 A;  1N7T A;  3SOE A;  4NMT A;  1V62 A;  2CSJ A;  4O06 A;  1TP3 A;  3I1E A;  3O46 A;  3SHW A;  1LCY A;  1SOT A;  1ZUB A;  2EV8 A;  4AMH A;  1MFG A;  1WHD A;  3GGE A;  5ILB A;  4H11 A;  1QAU A;  2L97 A;  3K1R A;  1GQ5 A;  1X5N A;  2FN5 A;  4NMS A;  4JJ0 A;  1KWA A;  2DB5 A;  3QO6 A;  1UJD A;  3MH4 A;  1UHP A;  4Q2Q A;  3I4W A;  2JIK A;  1BE9 A;  2YT8 A;  3PV2 A;  3R68 A;  5DTH A;  4EDJ A;  2OSG A;  2IWO A;  3NFL A;  2RCZ A;  2PA1 A;  3GDS A;  1QAV B;  4N6X A;  3O5N A;  3NGH A;  5EZ0 A;  2YT7 A;  2YTW A;  2Z9I A;  1R6J A;  2KJP A;  3QJN A;  3FY5 A;  5B42 A;  1MC7 A;  2QKV A;  5EYZ A;  2AWW A;  2I0L A;  2KPL A;  2I6V A;  5H3J A;  2AIN A;  5F3X A;  4G69 A;  2H3M A;  3PDV A;  1W9Q A;  1U3B A;  3QGL A;  3PS4 A;  1TE0 A;  2H2B A;  4NMO A;  4Z8J A;  4K75 A;  1XZ9 A;  3QE1 A;  2QBW A;  2KQF A;  3CC0 A;  2AWU A; 
#chains in the Genus database with same CATH homology
 2W7R A;  2KG2 A;  1RY4 A;  4NMV A;  1V5Q A;  1WG6 A;  2VRF A;  2Z17 A;  4FLN A;  3CBX A;  2OZF A;  5F67 A;  2EHR A;  3OU0 A;  4NMQ A;  2GZV A;  4WYT A;  5E21 A;  3HPM A;  4JOF A;  3QDO A;  1NTE A;  2EDV A;  5HDY A;  1B8Q A;  2DLU A;  3OTP A;  1P1E A;  2IWN A;  1OBX A;  5G1D A;  1W9O A;  1N6F A;  3K50 A;  1VA8 A;  3GCO A;  3PV4 A;  4Q2P A;  2EJY A;  2OS6 A;  2KAW A;  2QT5 A;  1N7F A;  1X9Z A;  2REY A;  3LNX A;  3NCV A;  1V1T A;  1VB7 A;  3GAB A;  2JSN A;  2V90 A;  2KJD A;  3LNY A;  3SFJ A;  2Q3G A;  5B6L A;  4Q6S A;  1UIT A;  2I4S A;  2LC7 A;  1WH1 A;  3ID4 A;  3RLE A;  5HEY A;  2KV8 A;  2M0Z A;  3DJ1 A;  1P1D A;  3R0H A;  3DIW A;  2KA9 A;  1YBO A;  1BFE A;  1L6O A;  1N99 A;  4OAJ A;  2KOM A;  4HOP A;  1IHJ A;  4JOE A;  2ZPL A;  1WF8 A;  1K32 A;  2BYG A;  1X5R A;  4MPA A;  3KHF A;  4JOJ A;  3VQG A;  5FB8 C;  1Y8T A;  4NNM A;  2VWR A;  3GSL A;  2M10 A;  3K82 A;  1UFX A;  2LC6 A;  2F5Y A;  1I16 A;  1WFG A;  4Q3H A;  1U39 A;  2YUY A;  5FHT A;  2M3M A;  4JOP A;  1V5L A;  3TSW A;  1WIF A;  3CYY A;  1VJ6 A;  1X8S A;  1WI2 A;  3DJ3 A;  1UEP A;  2JWE A;  1WHA A;  2HE2 A;  5IL9 A;  1X5Q A;  2EEH A;  3KZE A;  1I92 A;  2FCF A;  4K6Y A;  4PQW A;  2AWX A;  2PNT A;  3AXA A;  2I1N A;  3VQF A;  2OCS A;  4HOP B;  2M0V A;  1Q3P A;  2KOJ A;  4Q2O A;  4YDP A;  1Q3O A;  5HFE A;  4KFW A;  3HPK A;  2JOA A;  5HFB A;  4Q6H A;  2JXO A;  5E6P B;  2E7K A;  3KZD A;  3DOR A;  4RI0 A;  2MX6 A;  2I0I A;  3PV5 A;  2V1W A;  1TP5 A;  2EAQ A;  4GHN A;  1Z87 A;  5G1E A;  4JOR A;  1UEW A;  3WKL A;  5HET A;  2CS5 A;  5I7Z A;  2EEI A;  1T2M A;  2H3L A;  5HFC A;  4OEO A;  2UZC A;  3JXT A;  5HFF A;  1RGR A;  2G5M B;  2L4T A;  1D5G A;  1WF7 A;  2KYL A;  2OQS A;  4NNL A;  1V6B A;  2CSS A;  3EGG C;  1X6D A;  3KDG A;  4XHV A;  2KBS A;  1UEQ A;  3MH6 A;  3SUZ A;  1W9E A;  2EDZ A;  3QIK A;  1IU2 A;  1WFV A;  3ZRT A;  1Z86 A;  1UM1 A;  4GVD A;  4WYU A;  4K78 A;  4NXR A;  2EXG A;  2FNE A;  2JIN A;  4P0C A;  3L4F D;  2L4S A;  3QJM A;  3ID2 A;  2D90 A;  4JOK A;  2KPK A;  1WJL A;  2EEG A;  3E17 A;  3B76 A;  2M0U A;  4E35 A;  1N6E A;  1FC9 A;  2ENO A;  3I18 A;  5HFD A;  1Q7X A;  4UU5 A;  2HE4 A;  3KDK A;  2VSP A;  2EGK A;  1UM7 A;  4NXP A;  5HJ1 A;  4R2Z A;  4OEP A;  1VAE A;  5HED A;  4JL7 A;  1U37 A;  2QKT A;  3GCN A;  5E1Y A;  1N6D A;  3CBZ A;  1ZOK A;  2FE5 A;  1FCF A;  3PDZ A;  4NXQ A;  4NMP A;  2EGO A;  2R3Y A;  2VPH A;  1KEF A;  4JOG A;  4Q2N A;  1IU0 A;  1OZI A;  1SOZ A;  2DKR A;  4UU6 A;  2PDZ A;  2RRM A;  4NMR A;  5HF4 A;  1UEZ A;  1WI4 A;  3NFK A;  4K72 A;  3RL7 A;  4GVC A;  2OGP A;  3STJ A;  2EDP A;  2ZPM A;  1N7E A;  2LA8 A;  1TQ3 A;  3GDV A;  1FC6 A;  3WKM A;  4JOH A;  2M0T A;  5D13 A;  3CBY A;  3DJA A;  4K76 A;  1FC7 A;  5HEB A;  5HF1 A;  5A2P A;  1G9O A;  1X45 A;  4Z33 A;  2MHO A;  1OBY A;  2O2T A;  3GDU A;  2DMZ A;  4REY A;  2LOB A;  3ID3 A;  2VZ5 A;  2R4H A;  4YYX A;  2KOH A;  3EGH C;  2KJK A;  2IWQ A;  2K1Z A;  1GM1 A;  2G2L A;  2PKU A;  2F0A A;  3HVQ C;  2PZD A;  2KRG A;  4LMM A;  1VCW A;  4F8K A;  3CS0 A;  4L8N A;  3GJ9 A;  2W4F A;  4IC6 A;  1UF1 A;  1Y7N A;  1OBZ A;  3TMH A;  2P3W A;  3ID1 A;  2DLS A;  2DM8 A;  3TSZ A;  1MFL A;  2H2C A;  3SHU A;  1RGW A;  2EGN A;  1UJV A;  2WL7 A;  3CH8 A;  2LUI A;  2QG1 A;  2IWP A;  4JJ3 A;  2K20 A;  2GEF A;  1U38 A;  1M5Z A;  2JIL A;  5GND A;  2X7Z A;  1PDR A;  5E11 A;  1QLC A;  1RZX A;  2OMJ A;  2VSV A;  2YUB A;  2PKT A;  5GLJ A;  3RL8 A;  3MH7 A;  2DAZ A;  2QKU A;  2DC2 A;  2JRE A;  4P2A B;  5E22 A;  2Q9V A;  1UJU A;  4E3B A;  2D92 A;  3TSV A;  2D8I A;  1QAV A;  2EEJ A;  4E34 A;  2OPG A;  2KL1 A;  4KFV A;  1NF3 C;  3BPU A;  5JXB A;  2DJT A;  3R69 A;  1GQ4 A;  4FGM A;  2HGA A;  2I04 A;  1KY9 A;  1N7T A;  3SOE A;  4NMT A;  1V62 A;  2CSJ A;  4O06 A;  1TP3 A;  3I1E A;  3O46 A;  3SHW A;  1LCY A;  1SOT A;  1ZUB A;  2EV8 A;  4AMH A;  1MFG A;  1WHD A;  3GGE A;  5ILB A;  4H11 A;  1QAU A;  2L97 A;  3K1R A;  1GQ5 A;  1X5N A;  2FN5 A;  4NMS A;  4JJ0 A;  1KWA A;  2DB5 A;  3QO6 A;  1UJD A;  3MH4 A;  1UHP A;  4Q2Q A;  3I4W A;  2JIK A;  1BE9 A;  2YT8 A;  3PV2 A;  3R68 A;  5DTH A;  4EDJ A;  2OSG A;  2IWO A;  3NFL A;  2RCZ A;  2PA1 A;  3GDS A;  1QAV B;  4N6X A;  3O5N A;  3NGH A;  5EZ0 A;  2YT7 A;  2YTW A;  2Z9I A;  1R6J A;  2KJP A;  3QJN A;  3FY5 A;  5B42 A;  1MC7 A;  2QKV A;  5EYZ A;  2AWW A;  2I0L A;  2KPL A;  2I6V A;  5H3J A;  2AIN A;  5F3X A;  4G69 A;  2H3M A;  3PDV A;  1W9Q A;  1U3B A;  3QGL A;  3PS4 A;  1TE0 A;  2H2B A;  4NMO A;  4Z8J A;  4K75 A;  1XZ9 A;  3QE1 A;  2QBW A;  2KQF A;  3CC0 A;  2AWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...