5HEYA

The third pdz domain from the synaptic protein psd-95 (g330t mutant) in complex with a c-terminal peptide derived from cript
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
SPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Origins of Allostery and Evolvability in Proteins: A Case Study.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5heyA00
2VPHA 3KZEA 1I92A 3TMHA 2F5YA 1U37A 1B8QA 2PKUA 3NFKA 1UF1A 4NMQA 3DJ3A 3NFLA 2DM8A 2YT7A 3O5NA 4K76A 1X6DA 2EGNA 2VSVA 1N7TA 4NMTA 2JIKA 2WL7A 4JOPA 1WI4A 4JOKA 2H2BA 3I1EA 1UHPA 1GQ4A 2EGKA 2QKTA 1X5QA 4K75A 5E1YA 1LCYA 4GVCA 2QG1A 2KQFA 2EDZA 3MH6A 4NNLA 4YDPA 2VZ5A 2K20A 1Y8TA 2H3LA 3B76A 3GDSA 3R68A 5A2PA 2UZCA 5HEBA 1N6FA 3GDVA 4H11A 2V90A 4NMVA 1Z87A 2LOBA 3PV5A 3R0HA 2DJTA 3WKLA 1X5NA 4Q6HA 3LNXA 1GQ5A 1N7EA 1W9EA 2GZVA 2MHOA 2I1NA 2I4SA 4HOPB 2PZDA 5JXBA 2EEGA 2CSSA 3SHUA 2RRMA 5HEYA 2JREA 2DC2A 1RGWA 2Z17A 1R6JA 2OMJA 1V5LA 5HETA 3GJ9A 1V5QA 2P3WA 4NXQA 2JWEA 1N99A 2Z9IA 3VQGA 5G1EA 2EJYA 2R3YA 2MX6A 1Z86A 3PDVA 3GGEA 1WIFA 4XHVA 3QO6A 4EDJA 5HEDA 3CBZA 3LNYA 1M5ZA 4UU5A 3QE1A 4P0CA 3OU0A 2FNEA 1RY4A 2I6VA 1FC6A 2L4SA 1WI2A 5E6PB 2EEJA 2DLSA 2OS6A 1IU2A 3CS0A 2KJKA 2ZPMA 2FE5A 1KEFA 1RGRA 2JINA 3GDUA 1VJ6A 3QIKA 1Y7NA 3QJNA 2KA9A 1FC9A 1V6BA 1UITA 5HF1A 4Q2QA 2KBSA 4AMHA 4O06A 1IU0A 5H3JA 4OEPA 3K82A 1P1DA 1V62A 5EYZA 1OBYA 4PQWA 5HJ1A 3E17A 2YUBA 4IC6A 2VWRA 4N6XA 2LC7A 1KWAA 1U3BA 3PV2A 1FC7A 1UM7A 2D92A 3OTPA 4G69A 4NNMA 3K1RA 1YBOA 5HFEA 2K1ZA 3TSVA 1TP5A 4JOJA 2QBWA 1V1TA 1PDRA 1Q3OA 1WH1A 2LUIA 3R69A 2EAQA 2RCZA 1X8SA 2REYA 3ID1A 1UJUA 5HFBA 1TP3A 1X45A 3AXAA 1NF3C 2R4HA 2OQSA 4MPAA 2KAWA 1VAEA 4Z8JA 5D13A 2PDZA 3O46A 2IWNA 2W4FA 3RLEA 2KPLA 3CBXA 3K50A 2I0LA 1WJLA 1QLCA 2PNTA 3GSLA 4HOPA 1MFGA 1VA8A 2V1WA 4RI0A 2JOAA 2ZPLA 1BFEA 4P2AB 2M3MA 3JXTA 1UEWA 1Q7XA 2OCSA 1N7FA 4NMSA 1P1EA 3HVQC 1SOTA 2KJDA 2M0VA 4UU6A 1WFGA 5FHTA 4NXPA 3BPUA 2G5MB 4JORA 2X7ZA 3MH7A 1N6DA 4F8KA 2EGOA 3ID3A 4KFWA 4E3BA 1WG6A 2DAZA 2YT8A 5G1DA 5I7ZA 2QKVA 1QAVB 1KY9A 2KOHA 5B6LA 2KV8A 2YUYA 3HPMA 3I4WA 5GNDA 3CBYA 3SOEA 1G9OA 2KRGA 5FB8C 2AWXA 1UJDA 2BYGA 1OZIA 4E34A 4K72A 2KPKA 3CC0A 2EHRA 2PA1A 2AINA 4OEOA 4NMPA 3TSWA 2VRFA 2D90A 1ZUBA 4LMMA 1W9QA 3L4FD 2KG2A 2O2TA 2I0IA 1RZXA 2KL1A 2CS5A 3ID2A 2Q3GA 1MC7A 4R2ZA 3KHFA 2FCFA 4JOGA 4NMOA 2G2LA 2Q9VA 1WHDA 5HFDA 1UJVA 2CSJA 2M0ZA 1WHAA 2I04A 3SFJA 5E22A 1N6EA 3ID4A 3GCOA 1NTEA 2HE2A 2DMZA 3CYYA 4JOEA 4KFVA 2L97A 3DJ1A 3FY5A 3CH8A 2F0AA 2PKTA 2H2CA 3EGHC 5E11A 5HFFA 1OBZA 1TE0A 2EDPA 3WKMA 3GCNA 4Q2OA 1XZ9A 5DTHA 1U38A 3DORA 4JOFA 1VB7A 2KOJA 3TSZA 3EGGC 4Q3HA 2IWQA 3I18A 2VSPA 3HPKA 2IWOA 1FCFA 2M0TA 3SHWA 2ENOA 1Q3PA 2AWWA 2FN5A 5F3XA 1TQ3A 2QKUA 1U39A 4K78A 5HDYA 1T2MA 2EDVA 1WF8A 2KYLA 3RL7A 1QAUA 3VQFA 2HE4A 2QT5A 1MFLA 4GVDA 2IWPA 5GLJA 4NXRA 2EEIA 1L6OA 4L8NA 4JOHA 1IHJA 2DB5A 1GM1A 2KOMA 4WYTA 2DLUA 1D5GA 5EZ0A 3DJAA 1QAVA 4E35A 3PS4A 1OBXA 5E21A 1SOZA 2EXGA 2H3MA 2M10A 3PV4A 3STJA 2L4TA 3ZRTA 2OPGA 4OAJA 2AWUA 1VCWA 4NMRA 3QJMA 3QGLA 3QDOA 2D8IA 5HF4A 3DIWA 4Q2PA 3KZDA 2OZFA 2JXOA 2KJPA 1BE9A 2EEHA 1UEPA 4WYUA 1W9OA 2LA8A 3NGHA 2JILA 4Z33A 2M0UA 1ZOKA 2HGAA 2OGPA 1UM1A 4YYXA 5HFCA 2OSGA 1UFXA 4REYA 2YTWA 5F67A 2E7KA 1WFVA 1UEZA 1UEQA 1WF7A 3PDZA 3SUZA 4GHNA 1X5RA 3MH4A 3RL8A 2LC6A 2EV8A 4JL7A 2DKRA 4FGMA 1I16A 1K32A 4Q6SA 2W7RA 4K6YA 4Q2NA
chains in the Genus database with same CATH superfamily
2VPHA 3KZEA 1I92A 3TMHA 2F5YA 1U37A 1B8QA 2PKUA 3NFKA 1UF1A 4NMQA 3DJ3A 3NFLA 2DM8A 2YT7A 3O5NA 4K76A 1X6DA 2EGNA 2VSVA 1N7TA 4NMTA 2JIKA 2WL7A 4JOPA 1WI4A 4JOKA 2H2BA 3I1EA 1UHPA 1GQ4A 2EGKA 2QKTA 1X5QA 4K75A 5E1YA 1LCYA 4GVCA 2QG1A 2KQFA 2EDZA 3MH6A 4NNLA 4YDPA 2VZ5A 2K20A 1Y8TA 2H3LA 3B76A 3GDSA 3R68A 5A2PA 2UZCA 5HEBA 1N6FA 3GDVA 4H11A 2V90A 4NMVA 1Z87A 2LOBA 3PV5A 3R0HA 2DJTA 3WKLA 1X5NA 4Q6HA 3LNXA 1GQ5A 1N7EA 1W9EA 2GZVA 2MHOA 2I1NA 5ILBA 2I4SA 4HOPB 2PZDA 5JXBA 2EEGA 3KDGA 2CSSA 3SHUA 2RRMA 5HEYA 2JREA 2DC2A 1RGWA 2Z17A 1R6JA 2OMJA 1V5LA 5HETA 3GJ9A 1V5QA 2P3WA 4NXQA 2JWEA 1N99A 2Z9IA 3VQGA 5G1EA 2EJYA 2R3YA 2MX6A 1Z86A 3PDVA 3GGEA 1WIFA 4XHVA 3QO6A 4EDJA 3KDKA 5HEDA 3CBZA 3LNYA 1M5ZA 4UU5A 3QE1A 4P0CA 3OU0A 2FNEA 1RY4A 2I6VA 1FC6A 2L4SA 1WI2A 5E6PB 5IL9A 2EEJA 2DLSA 2OS6A 1IU2A 3CS0A 2KJKA 2ZPMA 2FE5A 1KEFA 1RGRA 2JINA 2JSNA 3GDUA 1VJ6A 3QIKA 1Y7NA 3QJNA 2KA9A 4JJ0A 1FC9A 1V6BA 1UITA 5HF1A 4Q2QA 2KBSA 2GEFA 4AMHA 4O06A 1IU0A 5H3JA 4OEPA 3K82A 1P1DA 1V62A 5EYZA 1OBYA 4PQWA 5HJ1A 3E17A 2YUBA 4FLNA 2VWRA 4IC6A 4N6XA 2LC7A 1KWAA 1U3BA 3PV2A 1FC7A 1UM7A 2D92A 3OTPA 4G69A 4NNMA 3K1RA 1YBOA 5HFEA 2K1ZA 3TSVA 1TP5A 4JOJA 2QBWA 1V1TA 1PDRA 1Q3OA 1WH1A 2LUIA 3R69A 2EAQA 2RCZA 1X8SA 2REYA 3ID1A 1UJUA 5HFBA 1TP3A 1X45A 3AXAA 1NF3C 2R4HA 2OQSA 4MPAA 2KAWA 1VAEA 4Z8JA 5D13A 2PDZA 3O46A 2IWNA 2W4FA 4JJ3A 3RLEA 2KPLA 3CBXA 3K50A 2I0LA 1WJLA 1QLCA 2PNTA 3GSLA 4HOPA 1MFGA 1VA8A 2V1WA 4RI0A 2JOAA 2ZPLA 1BFEA 4P2AB 2M3MA 3JXTA 1UEWA 1Q7XA 2OCSA 1N7FA 4NMSA 1P1EA 3HVQC 1SOTA 2KJDA 2M0VA 4UU6A 1WFGA 5FHTA 4NXPA 3BPUA 2G5MB 4JORA 2X7ZA 3MH7A 1N6DA 4F8KA 2EGOA 3ID3A 4KFWA 4E3BA 1WG6A 2DAZA 2YT8A 5G1DA 5I7ZA 2QKVA 1QAVB 1KY9A 2KOHA 5B6LA 2KV8A 2YUYA 3HPMA 3I4WA 5GNDA 3CBYA 3SOEA 1G9OA 2KRGA 5FB8C 2AWXA 1UJDA 2BYGA 1OZIA 4E34A 4K72A 2KPKA 3CC0A 2EHRA 2PA1A 2AINA 4OEOA 4NMPA 3TSWA 2VRFA 2D90A 1ZUBA 4LMMA 1W9QA 3L4FD 2KG2A 2O2TA 2I0IA 1RZXA 2KL1A 2CS5A 3ID2A 2Q3GA 1MC7A 4R2ZA 3KHFA 2FCFA 4JOGA 4NMOA 2G2LA 2Q9VA 1WHDA 5HFDA 1UJVA 2CSJA 2M0ZA 1WHAA 2I04A 3SFJA 5E22A 1N6EA 3ID4A 3GCOA 1NTEA 2HE2A 2DMZA 3CYYA 4JOEA 4KFVA 2L97A 3DJ1A 3FY5A 3CH8A 2F0AA 2PKTA 2H2CA 3EGHC 5E11A 5HFFA 1OBZA 1TE0A 2EDPA 3WKMA 3GCNA 4Q2OA 1XZ9A 5DTHA 1U38A 3DORA 4JOFA 1VB7A 2KOJA 3TSZA 3EGGC 4Q3HA 2IWQA 3I18A 2VSPA 3HPKA 2IWOA 1FCFA 2M0TA 3SHWA 2ENOA 1Q3PA 5B42A 2AWWA 2FN5A 5F3XA 1TQ3A 2QKUA 1U39A 4K78A 5HDYA 1T2MA 2EDVA 1WF8A 2KYLA 3RL7A 1QAUA 3VQFA 2HE4A 2QT5A 1MFLA 4GVDA 2IWPA 5GLJA 4NXRA 2EEIA 1L6OA 4L8NA 4JOHA 1IHJA 2DB5A 1X9ZA 1GM1A 2KOMA 4WYTA 2DLUA 1D5GA 5EZ0A 3DJAA 1QAVA 4E35A 3PS4A 1OBXA 5E21A 1SOZA 2EXGA 2H3MA 2M10A 3PV4A 3STJA 2L4TA 3ZRTA 2OPGA 4OAJA 2AWUA 1VCWA 4NMRA 3QJMA 3QGLA 3QDOA 2D8IA 5HF4A 3DIWA 4Q2PA 3KZDA 2OZFA 2JXOA 2KJPA 1BE9A 2EEHA 1UEPA 4WYUA 1W9OA 2LA8A 3NGHA 2JILA 4Z33A 2M0UA 3NCVA 1ZOKA 2HGAA 2OGPA 1UM1A 4YYXA 5HFCA 2OSGA 1UFXA 4REYA 2YTWA 5F67A 2E7KA 1WFVA 1UEZA 1UEQA 1WF7A 3PDZA 3SUZA 4GHNA 3GABA 1X5RA 3MH4A 3RL8A 2LC6A 2EV8A 4JL7A 2DKRA 4FGMA 1I16A 1K32A 4Q6SA 2W7RA 4K6YA 4Q2NA
chains in the Genus database with same CATH topology
2VPHA 3KZEA 1I92A 3TMHA 2F5YA 1U37A 1B8QA 2PKUA 3NFKA 1UF1A 4NMQA 3DJ3A 3NFLA 2DM8A 2YT7A 3O5NA 4K76A 1X6DA 2EGNA 2VSVA 1N7TA 4NMTA 2JIKA 2WL7A 4JOPA 1WI4A 4JOKA 2H2BA 3I1EA 1UHPA 1GQ4A 2EGKA 2QKTA 1X5QA 4K75A 5E1YA 1LCYA 4GVCA 2QG1A 2KQFA 2EDZA 3MH6A 4NNLA 4YDPA 2VZ5A 2K20A 1Y8TA 2H3LA 3B76A 3GDSA 3R68A 5A2PA 2UZCA 5HEBA 1N6FA 3GDVA 4H11A 2V90A 4NMVA 1Z87A 2LOBA 3PV5A 3R0HA 2DJTA 3WKLA 1X5NA 4Q6HA 3LNXA 1GQ5A 1N7EA 1W9EA 2GZVA 2MHOA 2I1NA 5ILBA 2I4SA 4HOPB 2PZDA 5JXBA 2EEGA 3KDGA 2CSSA 3SHUA 2RRMA 5HEYA 2JREA 2DC2A 1RGWA 2Z17A 1R6JA 2OMJA 1V5LA 5HETA 3GJ9A 1V5QA 2P3WA 4NXQA 2JWEA 1N99A 2Z9IA 3VQGA 5G1EA 2EJYA 2R3YA 2MX6A 1Z86A 3PDVA 3GGEA 1WIFA 4XHVA 3QO6A 4EDJA 3KDKA 5HEDA 3CBZA 3LNYA 1M5ZA 4UU5A 3QE1A 4P0CA 3OU0A 2FNEA 1RY4A 2I6VA 1FC6A 2L4SA 1WI2A 5E6PB 5IL9A 2EEJA 2DLSA 2OS6A 1IU2A 3CS0A 2KJKA 2ZPMA 2FE5A 1KEFA 1RGRA 2JINA 2JSNA 3GDUA 1VJ6A 3QIKA 1Y7NA 3QJNA 2KA9A 4JJ0A 1FC9A 1V6BA 1UITA 5HF1A 4Q2QA 2KBSA 2GEFA 4AMHA 4O06A 1IU0A 5H3JA 4OEPA 3K82A 1P1DA 1V62A 5EYZA 1OBYA 4PQWA 5HJ1A 3E17A 2YUBA 4FLNA 2VWRA 4IC6A 4N6XA 2LC7A 1KWAA 1U3BA 3PV2A 1FC7A 1UM7A 2D92A 3OTPA 4G69A 4NNMA 3K1RA 1YBOA 5HFEA 2K1ZA 3TSVA 1TP5A 4JOJA 2QBWA 1V1TA 1PDRA 1Q3OA 1WH1A 2LUIA 3R69A 2EAQA 2RCZA 1X8SA 2REYA 3ID1A 1UJUA 5HFBA 1TP3A 1X45A 3AXAA 1NF3C 2R4HA 2OQSA 4MPAA 2KAWA 1VAEA 4Z8JA 5D13A 2PDZA 3O46A 2IWNA 2W4FA 4JJ3A 3RLEA 2KPLA 3CBXA 3K50A 2I0LA 1WJLA 1QLCA 2PNTA 3GSLA 4HOPA 1MFGA 1VA8A 2V1WA 4RI0A 2JOAA 2ZPLA 1BFEA 4P2AB 2M3MA 3JXTA 1UEWA 1Q7XA 2OCSA 1N7FA 4NMSA 1P1EA 3HVQC 1SOTA 2KJDA 2M0VA 4UU6A 1WFGA 5FHTA 4NXPA 3BPUA 2G5MB 4JORA 2X7ZA 3MH7A 1N6DA 4F8KA 2EGOA 3ID3A 4KFWA 4E3BA 1WG6A 2DAZA 2YT8A 5G1DA 5I7ZA 2QKVA 1QAVB 1KY9A 2KOHA 5B6LA 2KV8A 2YUYA 3HPMA 3I4WA 5GNDA 3CBYA 3SOEA 1G9OA 2KRGA 5FB8C 2AWXA 1UJDA 2BYGA 1OZIA 4E34A 4K72A 2KPKA 3CC0A 2EHRA 2PA1A 2AINA 4OEOA 4NMPA 3TSWA 2VRFA 2D90A 1ZUBA 4LMMA 1W9QA 3L4FD 2KG2A 2O2TA 2I0IA 1RZXA 2KL1A 2CS5A 3ID2A 2Q3GA 1MC7A 4R2ZA 3KHFA 2FCFA 4JOGA 4NMOA 2G2LA 2Q9VA 1WHDA 5HFDA 1UJVA 2CSJA 2M0ZA 1WHAA 2I04A 3SFJA 5E22A 1N6EA 3ID4A 3GCOA 1NTEA 2HE2A 2DMZA 3CYYA 4JOEA 4KFVA 2L97A 3DJ1A 3FY5A 3CH8A 2F0AA 2PKTA 2H2CA 3EGHC 5E11A 5HFFA 1OBZA 1TE0A 2EDPA 3WKMA 3GCNA 4Q2OA 1XZ9A 5DTHA 1U38A 3DORA 4JOFA 1VB7A 2KOJA 3TSZA 3EGGC 4Q3HA 2IWQA 3I18A 2VSPA 3HPKA 2IWOA 1FCFA 2M0TA 3SHWA 2ENOA 1Q3PA 5B42A 2AWWA 2FN5A 5F3XA 1TQ3A 2QKUA 1U39A 4K78A 5HDYA 1T2MA 2EDVA 1WF8A 2KYLA 3RL7A 1QAUA 3VQFA 2HE4A 2QT5A 1MFLA 4GVDA 2IWPA 5GLJA 4NXRA 2EEIA 1L6OA 4L8NA 4JOHA 1IHJA 2DB5A 1X9ZA 1GM1A 2KOMA 4WYTA 2DLUA 1D5GA 5EZ0A 3DJAA 1QAVA 4E35A 3PS4A 1OBXA 5E21A 1SOZA 2EXGA 2H3MA 2M10A 3PV4A 3STJA 2L4TA 3ZRTA 2OPGA 4OAJA 2AWUA 1VCWA 4NMRA 3QJMA 3QGLA 3QDOA 2D8IA 5HF4A 3DIWA 4Q2PA 3KZDA 2OZFA 2JXOA 2KJPA 1BE9A 2EEHA 1UEPA 4WYUA 1W9OA 2LA8A 3NGHA 2JILA 4Z33A 2M0UA 3NCVA 1ZOKA 2HGAA 2OGPA 1UM1A 4YYXA 5HFCA 2OSGA 1UFXA 4REYA 2YTWA 5F67A 2E7KA 1WFVA 1UEZA 1UEQA 1WF7A 3PDZA 3SUZA 4GHNA 3GABA 1X5RA 3MH4A 3RL8A 2LC6A 2EV8A 4JL7A 2DKRA 4FGMA 1I16A 1K32A 4Q6SA 2W7RA 4K6YA 4Q2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPH A;  3KZE A;  1I92 A;  3TMH A;  2F5Y A;  1U37 A;  1B8Q A;  2PKU A;  3NFK A;  1UF1 A;  4NMQ A;  3DJ3 A;  3NFL A;  2DM8 A;  2YT7 A;  3O5N A;  4K76 A;  1X6D A;  2EGN A;  2VSV A;  1N7T A;  4NMT A;  2JIK A;  2WL7 A;  4JOP A;  1WI4 A;  4JOK A;  2H2B A;  3I1E A;  1UHP A;  1GQ4 A;  2EGK A;  2QKT A;  1X5Q A;  4K75 A;  5E1Y A;  1LCY A;  4GVC A;  2QG1 A;  2KQF A;  2EDZ A;  3MH6 A;  4NNL A;  4YDP A;  2VZ5 A;  2K20 A;  1Y8T A;  2H3L A;  3B76 A;  3GDS A;  3R68 A;  5A2P A;  2UZC A;  5HEB A;  1N6F A;  3GDV A;  4H11 A;  2V90 A;  4NMV A;  1Z87 A;  2LOB A;  3PV5 A;  3R0H A;  2DJT A;  3WKL A;  1X5N A;  4Q6H A;  3LNX A;  1GQ5 A;  1N7E A;  1W9E A;  2GZV A;  2MHO A;  2I1N A;  2I4S A;  4HOP B;  2PZD A;  5JXB A;  2EEG A;  2CSS A;  3SHU A;  2RRM A;  5HEY A;  2JRE A;  2DC2 A;  1RGW A;  2Z17 A;  1R6J A;  2OMJ A;  1V5L A;  5HET A;  3GJ9 A;  1V5Q A;  2P3W A;  4NXQ A;  2JWE A;  1N99 A;  2Z9I A;  3VQG A;  5G1E A;  2EJY A;  2R3Y A;  2MX6 A;  1Z86 A;  3PDV A;  3GGE A;  1WIF A;  4XHV A;  3QO6 A;  4EDJ A;  5HED A;  3CBZ A;  3LNY A;  1M5Z A;  4UU5 A;  3QE1 A;  4P0C A;  3OU0 A;  2FNE A;  1RY4 A;  2I6V A;  1FC6 A;  2L4S A;  1WI2 A;  5E6P B;  2EEJ A;  2DLS A;  2OS6 A;  1IU2 A;  3CS0 A;  2KJK A;  2ZPM A;  2FE5 A;  1KEF A;  1RGR A;  2JIN A;  3GDU A;  1VJ6 A;  3QIK A;  1Y7N A;  3QJN A;  2KA9 A;  1FC9 A;  1V6B A;  1UIT A;  5HF1 A;  4Q2Q A;  2KBS A;  4AMH A;  4O06 A;  1IU0 A;  5H3J A;  4OEP A;  3K82 A;  1P1D A;  1V62 A;  5EYZ A;  1OBY A;  4PQW A;  5HJ1 A;  3E17 A;  2YUB A;  4IC6 A;  2VWR A;  4N6X A;  2LC7 A;  1KWA A;  1U3B A;  3PV2 A;  1FC7 A;  1UM7 A;  2D92 A;  3OTP A;  4G69 A;  4NNM A;  3K1R A;  1YBO A;  5HFE A;  2K1Z A;  3TSV A;  1TP5 A;  4JOJ A;  2QBW A;  1V1T A;  1PDR A;  1Q3O A;  1WH1 A;  2LUI A;  3R69 A;  2EAQ A;  2RCZ A;  1X8S A;  2REY A;  3ID1 A;  1UJU A;  5HFB A;  1TP3 A;  1X45 A;  3AXA A;  1NF3 C;  2R4H A;  2OQS A;  4MPA A;  2KAW A;  1VAE A;  4Z8J A;  5D13 A;  2PDZ A;  3O46 A;  2IWN A;  2W4F A;  3RLE A;  2KPL A;  3CBX A;  3K50 A;  2I0L A;  1WJL A;  1QLC A;  2PNT A;  3GSL A;  4HOP A;  1MFG A;  1VA8 A;  2V1W A;  4RI0 A;  2JOA A;  2ZPL A;  1BFE A;  4P2A B;  2M3M A;  3JXT A;  1UEW A;  1Q7X A;  2OCS A;  1N7F A;  4NMS A;  1P1E A;  3HVQ C;  1SOT A;  2KJD A;  2M0V A;  4UU6 A;  1WFG A;  5FHT A;  4NXP A;  3BPU A;  2G5M B;  4JOR A;  2X7Z A;  3MH7 A;  1N6D A;  4F8K A;  2EGO A;  3ID3 A;  4KFW A;  4E3B A;  1WG6 A;  2DAZ A;  2YT8 A;  5G1D A;  5I7Z A;  2QKV A;  1QAV B;  1KY9 A;  2KOH A;  5B6L A;  2KV8 A;  2YUY A;  3HPM A;  3I4W A;  5GND A;  3CBY A;  3SOE A;  1G9O A;  2KRG A;  5FB8 C;  2AWX A;  1UJD A;  2BYG A;  1OZI A;  4E34 A;  4K72 A;  2KPK A;  3CC0 A;  2EHR A;  2PA1 A;  2AIN A;  4OEO A;  4NMP A;  3TSW A;  2VRF A;  2D90 A;  1ZUB A;  4LMM A;  1W9Q A;  3L4F D;  2KG2 A;  2O2T A;  2I0I A;  1RZX A;  2KL1 A;  2CS5 A;  3ID2 A;  2Q3G A;  1MC7 A;  4R2Z A;  3KHF A;  2FCF A;  4JOG A;  4NMO A;  2G2L A;  2Q9V A;  1WHD A;  5HFD A;  1UJV A;  2CSJ A;  2M0Z A;  1WHA A;  2I04 A;  3SFJ A;  5E22 A;  1N6E A;  3ID4 A;  3GCO A;  1NTE A;  2HE2 A;  2DMZ A;  3CYY A;  4JOE A;  4KFV A;  2L97 A;  3DJ1 A;  3FY5 A;  3CH8 A;  2F0A A;  2PKT A;  2H2C A;  3EGH C;  5E11 A;  5HFF A;  1OBZ A;  1TE0 A;  2EDP A;  3WKM A;  3GCN A;  4Q2O A;  1XZ9 A;  5DTH A;  1U38 A;  3DOR A;  4JOF A;  1VB7 A;  2KOJ A;  3TSZ A;  3EGG C;  4Q3H A;  2IWQ A;  3I18 A;  2VSP A;  3HPK A;  2IWO A;  1FCF A;  2M0T A;  3SHW A;  2ENO A;  1Q3P A;  2AWW A;  2FN5 A;  5F3X A;  1TQ3 A;  2QKU A;  1U39 A;  4K78 A;  5HDY A;  1T2M A;  2EDV A;  1WF8 A;  2KYL A;  3RL7 A;  1QAU A;  3VQF A;  2HE4 A;  2QT5 A;  1MFL A;  4GVD A;  2IWP A;  5GLJ A;  4NXR A;  2EEI A;  1L6O A;  4L8N A;  4JOH A;  1IHJ A;  2DB5 A;  1GM1 A;  2KOM A;  4WYT A;  2DLU A;  1D5G A;  5EZ0 A;  3DJA A;  1QAV A;  4E35 A;  3PS4 A;  1OBX A;  5E21 A;  1SOZ A;  2EXG A;  2H3M A;  2M10 A;  3PV4 A;  3STJ A;  2L4T A;  3ZRT A;  2OPG A;  4OAJ A;  2AWU A;  1VCW A;  4NMR A;  3QJM A;  3QGL A;  3QDO A;  2D8I A;  5HF4 A;  3DIW A;  4Q2P A;  3KZD A;  2OZF A;  2JXO A;  2KJP A;  1BE9 A;  2EEH A;  1UEP A;  4WYU A;  1W9O A;  2LA8 A;  3NGH A;  2JIL A;  4Z33 A;  2M0U A;  1ZOK A;  2HGA A;  2OGP A;  1UM1 A;  4YYX A;  5HFC A;  2OSG A;  1UFX A;  4REY A;  2YTW A;  5F67 A;  2E7K A;  1WFV A;  1UEZ A;  1UEQ A;  1WF7 A;  3PDZ A;  3SUZ A;  4GHN A;  1X5R A;  3MH4 A;  3RL8 A;  2LC6 A;  2EV8 A;  4JL7 A;  2DKR A;  4FGM A;  1I16 A;  1K32 A;  4Q6S A;  2W7R A;  4K6Y A;  4Q2N A; 
#chains in the Genus database with same CATH topology
 2VPH A;  3KZE A;  1I92 A;  3TMH A;  2F5Y A;  1U37 A;  1B8Q A;  2PKU A;  3NFK A;  1UF1 A;  4NMQ A;  3DJ3 A;  3NFL A;  2DM8 A;  2YT7 A;  3O5N A;  4K76 A;  1X6D A;  2EGN A;  2VSV A;  1N7T A;  4NMT A;  2JIK A;  2WL7 A;  4JOP A;  1WI4 A;  4JOK A;  2H2B A;  3I1E A;  1UHP A;  1GQ4 A;  2EGK A;  2QKT A;  1X5Q A;  4K75 A;  5E1Y A;  1LCY A;  4GVC A;  2QG1 A;  2KQF A;  2EDZ A;  3MH6 A;  4NNL A;  4YDP A;  2VZ5 A;  2K20 A;  1Y8T A;  2H3L A;  3B76 A;  3GDS A;  3R68 A;  5A2P A;  2UZC A;  5HEB A;  1N6F A;  3GDV A;  4H11 A;  2V90 A;  4NMV A;  1Z87 A;  2LOB A;  3PV5 A;  3R0H A;  2DJT A;  3WKL A;  1X5N A;  4Q6H A;  3LNX A;  1GQ5 A;  1N7E A;  1W9E A;  2GZV A;  2MHO A;  2I1N A;  5ILB A;  2I4S A;  4HOP B;  2PZD A;  5JXB A;  2EEG A;  3KDG A;  2CSS A;  3SHU A;  2RRM A;  5HEY A;  2JRE A;  2DC2 A;  1RGW A;  2Z17 A;  1R6J A;  2OMJ A;  1V5L A;  5HET A;  3GJ9 A;  1V5Q A;  2P3W A;  4NXQ A;  2JWE A;  1N99 A;  2Z9I A;  3VQG A;  5G1E A;  2EJY A;  2R3Y A;  2MX6 A;  1Z86 A;  3PDV A;  3GGE A;  1WIF A;  4XHV A;  3QO6 A;  4EDJ A;  3KDK A;  5HED A;  3CBZ A;  3LNY A;  1M5Z A;  4UU5 A;  3QE1 A;  4P0C A;  3OU0 A;  2FNE A;  1RY4 A;  2I6V A;  1FC6 A;  2L4S A;  1WI2 A;  5E6P B;  5IL9 A;  2EEJ A;  2DLS A;  2OS6 A;  1IU2 A;  3CS0 A;  2KJK A;  2ZPM A;  2FE5 A;  1KEF A;  1RGR A;  2JIN A;  2JSN A;  3GDU A;  1VJ6 A;  3QIK A;  1Y7N A;  3QJN A;  2KA9 A;  4JJ0 A;  1FC9 A;  1V6B A;  1UIT A;  5HF1 A;  4Q2Q A;  2KBS A;  2GEF A;  4AMH A;  4O06 A;  1IU0 A;  5H3J A;  4OEP A;  3K82 A;  1P1D A;  1V62 A;  5EYZ A;  1OBY A;  4PQW A;  5HJ1 A;  3E17 A;  2YUB A;  4FLN A;  2VWR A;  4IC6 A;  4N6X A;  2LC7 A;  1KWA A;  1U3B A;  3PV2 A;  1FC7 A;  1UM7 A;  2D92 A;  3OTP A;  4G69 A;  4NNM A;  3K1R A;  1YBO A;  5HFE A;  2K1Z A;  3TSV A;  1TP5 A;  4JOJ A;  2QBW A;  1V1T A;  1PDR A;  1Q3O A;  1WH1 A;  2LUI A;  3R69 A;  2EAQ A;  2RCZ A;  1X8S A;  2REY A;  3ID1 A;  1UJU A;  5HFB A;  1TP3 A;  1X45 A;  3AXA A;  1NF3 C;  2R4H A;  2OQS A;  4MPA A;  2KAW A;  1VAE A;  4Z8J A;  5D13 A;  2PDZ A;  3O46 A;  2IWN A;  2W4F A;  4JJ3 A;  3RLE A;  2KPL A;  3CBX A;  3K50 A;  2I0L A;  1WJL A;  1QLC A;  2PNT A;  3GSL A;  4HOP A;  1MFG A;  1VA8 A;  2V1W A;  4RI0 A;  2JOA A;  2ZPL A;  1BFE A;  4P2A B;  2M3M A;  3JXT A;  1UEW A;  1Q7X A;  2OCS A;  1N7F A;  4NMS A;  1P1E A;  3HVQ C;  1SOT A;  2KJD A;  2M0V A;  4UU6 A;  1WFG A;  5FHT A;  4NXP A;  3BPU A;  2G5M B;  4JOR A;  2X7Z A;  3MH7 A;  1N6D A;  4F8K A;  2EGO A;  3ID3 A;  4KFW A;  4E3B A;  1WG6 A;  2DAZ A;  2YT8 A;  5G1D A;  5I7Z A;  2QKV A;  1QAV B;  1KY9 A;  2KOH A;  5B6L A;  2KV8 A;  2YUY A;  3HPM A;  3I4W A;  5GND A;  3CBY A;  3SOE A;  1G9O A;  2KRG A;  5FB8 C;  2AWX A;  1UJD A;  2BYG A;  1OZI A;  4E34 A;  4K72 A;  2KPK A;  3CC0 A;  2EHR A;  2PA1 A;  2AIN A;  4OEO A;  4NMP A;  3TSW A;  2VRF A;  2D90 A;  1ZUB A;  4LMM A;  1W9Q A;  3L4F D;  2KG2 A;  2O2T A;  2I0I A;  1RZX A;  2KL1 A;  2CS5 A;  3ID2 A;  2Q3G A;  1MC7 A;  4R2Z A;  3KHF A;  2FCF A;  4JOG A;  4NMO A;  2G2L A;  2Q9V A;  1WHD A;  5HFD A;  1UJV A;  2CSJ A;  2M0Z A;  1WHA A;  2I04 A;  3SFJ A;  5E22 A;  1N6E A;  3ID4 A;  3GCO A;  1NTE A;  2HE2 A;  2DMZ A;  3CYY A;  4JOE A;  4KFV A;  2L97 A;  3DJ1 A;  3FY5 A;  3CH8 A;  2F0A A;  2PKT A;  2H2C A;  3EGH C;  5E11 A;  5HFF A;  1OBZ A;  1TE0 A;  2EDP A;  3WKM A;  3GCN A;  4Q2O A;  1XZ9 A;  5DTH A;  1U38 A;  3DOR A;  4JOF A;  1VB7 A;  2KOJ A;  3TSZ A;  3EGG C;  4Q3H A;  2IWQ A;  3I18 A;  2VSP A;  3HPK A;  2IWO A;  1FCF A;  2M0T A;  3SHW A;  2ENO A;  1Q3P A;  5B42 A;  2AWW A;  2FN5 A;  5F3X A;  1TQ3 A;  2QKU A;  1U39 A;  4K78 A;  5HDY A;  1T2M A;  2EDV A;  1WF8 A;  2KYL A;  3RL7 A;  1QAU A;  3VQF A;  2HE4 A;  2QT5 A;  1MFL A;  4GVD A;  2IWP A;  5GLJ A;  4NXR A;  2EEI A;  1L6O A;  4L8N A;  4JOH A;  1IHJ A;  2DB5 A;  1X9Z A;  1GM1 A;  2KOM A;  4WYT A;  2DLU A;  1D5G A;  5EZ0 A;  3DJA A;  1QAV A;  4E35 A;  3PS4 A;  1OBX A;  5E21 A;  1SOZ A;  2EXG A;  2H3M A;  2M10 A;  3PV4 A;  3STJ A;  2L4T A;  3ZRT A;  2OPG A;  4OAJ A;  2AWU A;  1VCW A;  4NMR A;  3QJM A;  3QGL A;  3QDO A;  2D8I A;  5HF4 A;  3DIW A;  4Q2P A;  3KZD A;  2OZF A;  2JXO A;  2KJP A;  1BE9 A;  2EEH A;  1UEP A;  4WYU A;  1W9O A;  2LA8 A;  3NGH A;  2JIL A;  4Z33 A;  2M0U A;  3NCV A;  1ZOK A;  2HGA A;  2OGP A;  1UM1 A;  4YYX A;  5HFC A;  2OSG A;  1UFX A;  4REY A;  2YTW A;  5F67 A;  2E7K A;  1WFV A;  1UEZ A;  1UEQ A;  1WF7 A;  3PDZ A;  3SUZ A;  4GHN A;  3GAB A;  1X5R A;  3MH4 A;  3RL8 A;  2LC6 A;  2EV8 A;  4JL7 A;  2DKR A;  4FGM A;  1I16 A;  1K32 A;  4Q6S A;  2W7R A;  4K6Y A;  4Q2N A; 
#chains in the Genus database with same CATH homology
 2VPH A;  3KZE A;  1I92 A;  3TMH A;  2F5Y A;  1U37 A;  1B8Q A;  2PKU A;  3NFK A;  1UF1 A;  4NMQ A;  3DJ3 A;  3NFL A;  2DM8 A;  2YT7 A;  3O5N A;  4K76 A;  1X6D A;  2EGN A;  2VSV A;  1N7T A;  4NMT A;  2JIK A;  2WL7 A;  4JOP A;  1WI4 A;  4JOK A;  2H2B A;  3I1E A;  1UHP A;  1GQ4 A;  2EGK A;  2QKT A;  1X5Q A;  4K75 A;  5E1Y A;  1LCY A;  4GVC A;  2QG1 A;  2KQF A;  2EDZ A;  3MH6 A;  4NNL A;  4YDP A;  2VZ5 A;  2K20 A;  1Y8T A;  2H3L A;  3B76 A;  3GDS A;  3R68 A;  5A2P A;  2UZC A;  5HEB A;  1N6F A;  3GDV A;  4H11 A;  2V90 A;  4NMV A;  1Z87 A;  2LOB A;  3PV5 A;  3R0H A;  2DJT A;  3WKL A;  1X5N A;  4Q6H A;  3LNX A;  1GQ5 A;  1N7E A;  1W9E A;  2GZV A;  2MHO A;  2I1N A;  5ILB A;  2I4S A;  4HOP B;  2PZD A;  5JXB A;  2EEG A;  3KDG A;  2CSS A;  3SHU A;  2RRM A;  5HEY A;  2JRE A;  2DC2 A;  1RGW A;  2Z17 A;  1R6J A;  2OMJ A;  1V5L A;  5HET A;  3GJ9 A;  1V5Q A;  2P3W A;  4NXQ A;  2JWE A;  1N99 A;  2Z9I A;  3VQG A;  5G1E A;  2EJY A;  2R3Y A;  2MX6 A;  1Z86 A;  3PDV A;  3GGE A;  1WIF A;  4XHV A;  3QO6 A;  4EDJ A;  3KDK A;  5HED A;  3CBZ A;  3LNY A;  1M5Z A;  4UU5 A;  3QE1 A;  4P0C A;  3OU0 A;  2FNE A;  1RY4 A;  2I6V A;  1FC6 A;  2L4S A;  1WI2 A;  5E6P B;  5IL9 A;  2EEJ A;  2DLS A;  2OS6 A;  1IU2 A;  3CS0 A;  2KJK A;  2ZPM A;  2FE5 A;  1KEF A;  1RGR A;  2JIN A;  2JSN A;  3GDU A;  1VJ6 A;  3QIK A;  1Y7N A;  3QJN A;  2KA9 A;  4JJ0 A;  1FC9 A;  1V6B A;  1UIT A;  5HF1 A;  4Q2Q A;  2KBS A;  2GEF A;  4AMH A;  4O06 A;  1IU0 A;  5H3J A;  4OEP A;  3K82 A;  1P1D A;  1V62 A;  5EYZ A;  1OBY A;  4PQW A;  5HJ1 A;  3E17 A;  2YUB A;  4FLN A;  2VWR A;  4IC6 A;  4N6X A;  2LC7 A;  1KWA A;  1U3B A;  3PV2 A;  1FC7 A;  1UM7 A;  2D92 A;  3OTP A;  4G69 A;  4NNM A;  3K1R A;  1YBO A;  5HFE A;  2K1Z A;  3TSV A;  1TP5 A;  4JOJ A;  2QBW A;  1V1T A;  1PDR A;  1Q3O A;  1WH1 A;  2LUI A;  3R69 A;  2EAQ A;  2RCZ A;  1X8S A;  2REY A;  3ID1 A;  1UJU A;  5HFB A;  1TP3 A;  1X45 A;  3AXA A;  1NF3 C;  2R4H A;  2OQS A;  4MPA A;  2KAW A;  1VAE A;  4Z8J A;  5D13 A;  2PDZ A;  3O46 A;  2IWN A;  2W4F A;  4JJ3 A;  3RLE A;  2KPL A;  3CBX A;  3K50 A;  2I0L A;  1WJL A;  1QLC A;  2PNT A;  3GSL A;  4HOP A;  1MFG A;  1VA8 A;  2V1W A;  4RI0 A;  2JOA A;  2ZPL A;  1BFE A;  4P2A B;  2M3M A;  3JXT A;  1UEW A;  1Q7X A;  2OCS A;  1N7F A;  4NMS A;  1P1E A;  3HVQ C;  1SOT A;  2KJD A;  2M0V A;  4UU6 A;  1WFG A;  5FHT A;  4NXP A;  3BPU A;  2G5M B;  4JOR A;  2X7Z A;  3MH7 A;  1N6D A;  4F8K A;  2EGO A;  3ID3 A;  4KFW A;  4E3B A;  1WG6 A;  2DAZ A;  2YT8 A;  5G1D A;  5I7Z A;  2QKV A;  1QAV B;  1KY9 A;  2KOH A;  5B6L A;  2KV8 A;  2YUY A;  3HPM A;  3I4W A;  5GND A;  3CBY A;  3SOE A;  1G9O A;  2KRG A;  5FB8 C;  2AWX A;  1UJD A;  2BYG A;  1OZI A;  4E34 A;  4K72 A;  2KPK A;  3CC0 A;  2EHR A;  2PA1 A;  2AIN A;  4OEO A;  4NMP A;  3TSW A;  2VRF A;  2D90 A;  1ZUB A;  4LMM A;  1W9Q A;  3L4F D;  2KG2 A;  2O2T A;  2I0I A;  1RZX A;  2KL1 A;  2CS5 A;  3ID2 A;  2Q3G A;  1MC7 A;  4R2Z A;  3KHF A;  2FCF A;  4JOG A;  4NMO A;  2G2L A;  2Q9V A;  1WHD A;  5HFD A;  1UJV A;  2CSJ A;  2M0Z A;  1WHA A;  2I04 A;  3SFJ A;  5E22 A;  1N6E A;  3ID4 A;  3GCO A;  1NTE A;  2HE2 A;  2DMZ A;  3CYY A;  4JOE A;  4KFV A;  2L97 A;  3DJ1 A;  3FY5 A;  3CH8 A;  2F0A A;  2PKT A;  2H2C A;  3EGH C;  5E11 A;  5HFF A;  1OBZ A;  1TE0 A;  2EDP A;  3WKM A;  3GCN A;  4Q2O A;  1XZ9 A;  5DTH A;  1U38 A;  3DOR A;  4JOF A;  1VB7 A;  2KOJ A;  3TSZ A;  3EGG C;  4Q3H A;  2IWQ A;  3I18 A;  2VSP A;  3HPK A;  2IWO A;  1FCF A;  2M0T A;  3SHW A;  2ENO A;  1Q3P A;  5B42 A;  2AWW A;  2FN5 A;  5F3X A;  1TQ3 A;  2QKU A;  1U39 A;  4K78 A;  5HDY A;  1T2M A;  2EDV A;  1WF8 A;  2KYL A;  3RL7 A;  1QAU A;  3VQF A;  2HE4 A;  2QT5 A;  1MFL A;  4GVD A;  2IWP A;  5GLJ A;  4NXR A;  2EEI A;  1L6O A;  4L8N A;  4JOH A;  1IHJ A;  2DB5 A;  1X9Z A;  1GM1 A;  2KOM A;  4WYT A;  2DLU A;  1D5G A;  5EZ0 A;  3DJA A;  1QAV A;  4E35 A;  3PS4 A;  1OBX A;  5E21 A;  1SOZ A;  2EXG A;  2H3M A;  2M10 A;  3PV4 A;  3STJ A;  2L4T A;  3ZRT A;  2OPG A;  4OAJ A;  2AWU A;  1VCW A;  4NMR A;  3QJM A;  3QGL A;  3QDO A;  2D8I A;  5HF4 A;  3DIW A;  4Q2P A;  3KZD A;  2OZF A;  2JXO A;  2KJP A;  1BE9 A;  2EEH A;  1UEP A;  4WYU A;  1W9O A;  2LA8 A;  3NGH A;  2JIL A;  4Z33 A;  2M0U A;  3NCV A;  1ZOK A;  2HGA A;  2OGP A;  1UM1 A;  4YYX A;  5HFC A;  2OSG A;  1UFX A;  4REY A;  2YTW A;  5F67 A;  2E7K A;  1WFV A;  1UEZ A;  1UEQ A;  1WF7 A;  3PDZ A;  3SUZ A;  4GHN A;  3GAB A;  1X5R A;  3MH4 A;  3RL8 A;  2LC6 A;  2EV8 A;  4JL7 A;  2DKR A;  4FGM A;  1I16 A;  1K32 A;  4Q6S A;  2W7R A;  4K6Y A;  4Q2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...