5HEYA

The third pdz domain from the synaptic protein psd-95 (g330t mutant) in complex with a c-terminal peptide derived from cript
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
b'SPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Origins of Allostery and Evolvability in Proteins: A Case Study.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 26
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5heyA00
4NMPA 3RL7A 1UHPA 4MPAA 1X5RA 2LOBA 4OEPA 3LNYA 1Z87A 1N99A 5HJ1A 4HOPB 2VZ5A 3QJMA 2RRMA 1V1TA 5HFBA 4F8KA 2D8IA 1FC6A 1VJ6A 1N6FA 1GQ4A 1TP5A 3ID4A 3MH4A 1WHAA 3CBYA 4K76A 1Y7NA 2O2TA 1BFEA 4KFWA 4Q6HA 2EGKA 1VAEA 3CS0A 2EAQA 4P2AB 3ID2A 2IWPA 2G5MB 2WL7A 1WIFA 1RY4A 1UFXA 3LNXA 3PDZA 2KPLA 3QJNA 1XZ9A 2YT7A 1U39A 2L4TA 4JOFA 4Q2QA 1IHJA 2ENOA 2ZPLA 3FY5A 5FHTA 2QT5A 5HFDA 3DJAA 5HDYA 2Z9IA 3O5NA 2DJTA 2EXGA 1OZIA 1Q3OA 3STJA 1UJVA 4OEOA 4NMVA 5D13A 3VQFA 4JOPA 3NFKA 1WH1A 1BE9A 3QIKA 5DTHA 3CBXA 3KZEA 2VSVA 5G1EA 2HE4A 2H2CA 2M0ZA 1UM7A 4R2ZA 1FCFA 2EGOA 1V6BA 2OSGA 5HFFA 2KL1A 1N7TA 2DKRA 2AWWA 3DJ1A 1N7EA 5I7ZA 3WKLA 1QAUA 3SOEA 2YUBA 2BYGA 2ZPMA 2DB5A 4Z8JA 1GM1A 2MX6A 2KA9A 5JXBA 3WKMA 1KEFA 2W7RA 1V5LA 2PZDA 4NNMA 2EEGA 2LUIA 1OBYA 4NMRA 4N6XA 2IWNA 1IU2A 2P3WA 3R69A 2R3YA 3CH8A 1UEPA 2K20A 5HETA 2CSJA 3R0HA 5E22A 1GQ5A 2IWOA 2JREA 2Z17A 2KOMA 2REYA 3K82A 2JIKA 2KV8A 4JOEA 2EDZA 3HVQC 4PQWA 4YDPA 1FC7A 1W9OA 5EYZA 3GJ9A 5H3JA 1UEWA 1U3BA 1RGWA 1WJLA 1WHDA 3SFJA 3SHWA 2Q3GA 2JOAA 1FC9A 2KPKA 2DC2A 4NMQA 2L4SA 2KJDA 3AXAA 3I1EA 1SOTA 2AINA 1Y8TA 1WF8A 1RGRA 2E7KA 3HPMA 1LCYA 2KQFA 2EDVA 2UZCA 2CSSA 3PV2A 3R68A 3CYYA 2PKUA 1QLCA 1QAVA 2M0TA 2G2LA 2PKTA 2OMJA 1ZOKA 4Q2OA 2OS6A 2FCFA 1Q7XA 4P0CA 1OBXA 3DIWA 2VSPA 4IC6A 2EDPA 1PDRA 4WYUA 2AWXA 1WI4A 1UITA 1I16A 3I4WA 2YTWA 1M5ZA 4FGMA 4G69A 4NMOA 2KAWA 1KWAA 4JORA 1U37A 3TSZA 2V1WA 2FN5A 4O06A 3JXTA 3TSVA 3TMHA 3PDVA 1WFGA 4GHNA 2H2BA 2OGPA 2HE2A 4E35A 2KYLA 4UU5A 3DORA 3L4FD 3TSWA 2YT8A 5HEDA 1I92A 2JWEA 1OBZA 3I18A 2VPHA 4EDJA 3O46A 4K6YA 2KOHA 3PV4A 5HEYA 4Q2PA 4LMMA 4JOKA 2EV8A 2X7ZA 2EGNA 1WFVA 2M10A 4YYXA 2QKVA 2LA8A 1X5NA 4NXQA 3BPUA 3QDOA 4JL7A 2DMZA 2GZVA 1UJDA 2F0AA 2PA1A 2KRGA 1MFLA 4K75A 3PS4A 4K72A 2KOJA 2H3MA 3ID3A 2M0VA 2OPGA 2EEHA 3NFLA 5E6PB 2DLSA 1D5GA 1MFGA 1UF1A 3GGEA 1TQ3A 2FNEA 4E34A 4GVCA 2K1ZA 1YBOA 4REYA 4JOHA 2I6VA 1X6DA 4HOPA 2H3LA 4NMTA 2VRFA 3NGHA 5G1DA 5GNDA 3HPKA 5E11A 2R4HA 2I1NA 1VA8A 2V90A 3CBZA 2EJYA 3OU0A 1SOZA 2CS5A 5GLJA 1NF3C 5E21A 2F5YA 5EZ0A 2KJKA 4Q2NA 1X8SA 3GCOA 3VQGA 2LC6A 1X5QA 2RCZA 3E17A 2I0IA 4GVDA 4H11A 2MHOA 5F3XA 2YUYA 2DLUA 3ZRTA 3KHFA 2EHRA 2Q9VA 3K50A 2KG2A 4JOGA 5E1YA 3GDSA 1W9QA 2FE5A 2M3MA 2OZFA 1N6EA 1UJUA 4NMSA 1WF7A 2IWQA 2I04A 2KBSA 3DJ3A 3PV5A 3GSLA 2LC7A 1NTEA 1B8QA 4JOJA 2JINA 1P1EA 3GCNA 1TP3A 3EGGC 3K1RA 1KY9A 1Z86A 5B6LA 3B76A 4OAJA 1QAVB 2EEJA 5F67A 1ZUBA 2EEIA 2QG1A 1MC7A 2DAZA 4XHVA 1N7FA 4NXPA 3CC0A 4Z33A 1RZXA 2QKTA 5HF1A 1U38A 4Q3HA 2OCSA 2I4SA 3RL8A 1G9OA 3GDUA 4WYTA 2D92A 1X45A 1V62A 5HF4A 5HFEA 3QE1A 4NNLA 3KZDA 2HGAA 5HEBA 2PDZA 1R6JA 1V5QA 1UEZA 3OTPA 1TE0A 3MH7A 1WG6A 5A2PA 4RI0A 1UM1A 5HFCA 2DM8A 2JXOA 4KFVA 3ID1A 1L6OA 2QBWA 4L8NA 3QGLA 1IU0A 1K32A 1VB7A 2M0UA 5FB8C 2AWUA 4E3BA 3SHUA 2OQSA 1Q3PA 3RLEA 2KJPA 3GDVA 2JILA 2D90A 1VCWA 4AMHA 1WI2A 2QKUA 4NXRA 3MH6A 1W9EA 2W4FA 2I0LA 3SUZA 4K78A 4UU6A 4Q6SA 3EGHC 1N6DA 1T2MA 1P1DA 1UEQA 2PNTA 2VWRA 2L97A 3QO6A
chains in the Genus database with same CATH superfamily
4NMPA 3RL7A 1UHPA 3GABA 4MPAA 1X5RA 2LOBA 4OEPA 3LNYA 1Z87A 1N99A 5HJ1A 2GEFA 4HOPB 2VZ5A 3QJMA 2RRMA 1V1TA 5HFBA 4F8KA 2D8IA 1FC6A 1VJ6A 1N6FA 1GQ4A 1TP5A 4JJ0A 3ID4A 5IL9A 3MH4A 1WHAA 3CBYA 4K76A 1Y7NA 2O2TA 1BFEA 4KFWA 4Q6HA 2EGKA 1VAEA 3CS0A 2EAQA 4P2AB 3ID2A 2IWPA 2G5MB 2WL7A 1WIFA 1RY4A 1UFXA 3LNXA 3PDZA 2KPLA 3QJNA 1XZ9A 2YT7A 1U39A 2L4TA 4JOFA 4Q2QA 1IHJA 2ENOA 2ZPLA 3FY5A 5FHTA 2QT5A 5HFDA 3DJAA 5HDYA 2Z9IA 3O5NA 2DJTA 2EXGA 1OZIA 1Q3OA 3STJA 5ILBA 1UJVA 4OEOA 4NMVA 5D13A 3VQFA 4JOPA 3NFKA 1WH1A 1BE9A 3QIKA 5DTHA 3CBXA 3KZEA 2VSVA 5G1EA 2HE4A 2H2CA 2M0ZA 1UM7A 4R2ZA 1FCFA 2EGOA 1V6BA 2OSGA 5HFFA 2KL1A 1N7TA 2DKRA 2AWWA 3DJ1A 1N7EA 5I7ZA 3WKLA 1QAUA 3SOEA 2YUBA 2BYGA 2ZPMA 2DB5A 4Z8JA 1GM1A 2MX6A 2KA9A 5JXBA 3WKMA 1KEFA 2W7RA 1V5LA 2PZDA 4NNMA 2EEGA 2LUIA 1OBYA 4NMRA 4N6XA 2IWNA 1IU2A 2P3WA 3R69A 2R3YA 3CH8A 1UEPA 2K20A 5HETA 2CSJA 3R0HA 5E22A 1GQ5A 2IWOA 2JREA 2Z17A 4FLNA 2KOMA 2REYA 3K82A 2JIKA 2KV8A 4JOEA 2EDZA 3HVQC 4PQWA 4YDPA 1FC7A 1W9OA 5EYZA 3GJ9A 5H3JA 1UEWA 1U3BA 1RGWA 1WJLA 1WHDA 3SFJA 3SHWA 2Q3GA 2JOAA 1FC9A 2KPKA 3KDGA 2DC2A 4NMQA 2L4SA 2KJDA 3AXAA 3I1EA 1SOTA 2AINA 1Y8TA 1WF8A 1RGRA 2E7KA 3HPMA 1LCYA 2KQFA 2EDVA 2UZCA 2CSSA 3PV2A 3R68A 3CYYA 2PKUA 1QLCA 1QAVA 2M0TA 2G2LA 2PKTA 2OMJA 1ZOKA 4Q2OA 2OS6A 2FCFA 1Q7XA 4P0CA 1OBXA 3DIWA 2VSPA 4IC6A 2EDPA 1PDRA 4WYUA 2AWXA 1WI4A 1UITA 1I16A 3I4WA 2YTWA 1M5ZA 4FGMA 4G69A 4NMOA 2KAWA 1KWAA 4JORA 1U37A 3TSZA 2V1WA 2FN5A 4O06A 3JXTA 3TSVA 3TMHA 3PDVA 1WFGA 4GHNA 2H2BA 2OGPA 2HE2A 4E35A 2KYLA 5B42A 4UU5A 3DORA 3L4FD 3TSWA 2YT8A 5HEDA 1I92A 2JWEA 1OBZA 3I18A 2VPHA 4EDJA 3O46A 4K6YA 2KOHA 3PV4A 5HEYA 4Q2PA 4LMMA 4JOKA 2EV8A 2X7ZA 2EGNA 1WFVA 2M10A 4YYXA 2QKVA 2LA8A 1X5NA 4NXQA 3BPUA 3QDOA 4JL7A 2DMZA 2GZVA 1UJDA 2F0AA 2PA1A 2KRGA 1MFLA 4K75A 3PS4A 4K72A 2KOJA 2H3MA 3ID3A 2M0VA 2OPGA 2EEHA 3NFLA 5E6PB 2DLSA 1D5GA 1MFGA 1UF1A 3GGEA 1TQ3A 2FNEA 4E34A 4GVCA 2K1ZA 1YBOA 4REYA 4JOHA 2I6VA 1X6DA 4HOPA 2H3LA 4NMTA 4JJ3A 2VRFA 2JSNA 3NGHA 5G1DA 5GNDA 3HPKA 5E11A 2R4HA 2I1NA 1VA8A 2V90A 3CBZA 2EJYA 3OU0A 1SOZA 2CS5A 5GLJA 1NF3C 5E21A 2F5YA 5EZ0A 2KJKA 4Q2NA 1X8SA 3GCOA 3VQGA 2LC6A 1X5QA 2RCZA 3E17A 2I0IA 4GVDA 4H11A 2MHOA 5F3XA 2YUYA 2DLUA 3ZRTA 3KHFA 2EHRA 2Q9VA 3K50A 2KG2A 4JOGA 5E1YA 3GDSA 1W9QA 2FE5A 2M3MA 2OZFA 1N6EA 1UJUA 3KDKA 4NMSA 1WF7A 2IWQA 2I04A 2KBSA 3DJ3A 3PV5A 3GSLA 2LC7A 1NTEA 1B8QA 4JOJA 2JINA 1P1EA 3GCNA 1TP3A 3EGGC 3K1RA 1KY9A 1Z86A 5B6LA 3B76A 4OAJA 1QAVB 2EEJA 5F67A 1ZUBA 2EEIA 2QG1A 1MC7A 2DAZA 4XHVA 1N7FA 4NXPA 3CC0A 4Z33A 1RZXA 2QKTA 5HF1A 1U38A 4Q3HA 2OCSA 2I4SA 3RL8A 1G9OA 3GDUA 4WYTA 2D92A 1X45A 1V62A 5HF4A 5HFEA 3QE1A 4NNLA 3KZDA 2HGAA 5HEBA 2PDZA 1R6JA 1V5QA 1UEZA 3OTPA 1TE0A 3MH7A 1WG6A 5A2PA 4RI0A 1UM1A 5HFCA 2DM8A 2JXOA 4KFVA 3ID1A 1L6OA 2QBWA 4L8NA 3QGLA 1IU0A 1K32A 1VB7A 2M0UA 5FB8C 2AWUA 4E3BA 3SHUA 2OQSA 1Q3PA 3RLEA 2KJPA 3GDVA 2JILA 2D90A 1VCWA 4AMHA 1WI2A 2QKUA 4NXRA 3MH6A 1W9EA 2W4FA 2I0LA 3SUZA 3NCVA 4K78A 4UU6A 1X9ZA 4Q6SA 3EGHC 1N6DA 1T2MA 1P1DA 1UEQA 2PNTA 2VWRA 2L97A 3QO6A
chains in the Genus database with same CATH topology
4NMPA 3RL7A 1UHPA 3GABA 4MPAA 1X5RA 2LOBA 4OEPA 3LNYA 1Z87A 1N99A 5HJ1A 2GEFA 4HOPB 2VZ5A 3QJMA 2RRMA 1V1TA 5HFBA 4F8KA 2D8IA 1FC6A 1VJ6A 1N6FA 1GQ4A 1TP5A 4JJ0A 3ID4A 5IL9A 3MH4A 1WHAA 3CBYA 4K76A 1Y7NA 2O2TA 1BFEA 4KFWA 4Q6HA 2EGKA 1VAEA 3CS0A 2EAQA 4P2AB 3ID2A 2IWPA 2G5MB 2WL7A 1WIFA 1RY4A 1UFXA 3LNXA 3PDZA 2KPLA 3QJNA 1XZ9A 2YT7A 1U39A 2L4TA 4JOFA 4Q2QA 1IHJA 2ENOA 2ZPLA 3FY5A 5FHTA 2QT5A 5HFDA 3DJAA 5HDYA 2Z9IA 3O5NA 2DJTA 2EXGA 1OZIA 1Q3OA 3STJA 5ILBA 1UJVA 4OEOA 4NMVA 5D13A 3VQFA 4JOPA 3NFKA 1WH1A 1BE9A 3QIKA 5DTHA 3CBXA 3KZEA 2VSVA 5G1EA 2HE4A 2H2CA 2M0ZA 1UM7A 4R2ZA 1FCFA 2EGOA 1V6BA 2OSGA 5HFFA 2KL1A 1N7TA 2DKRA 2AWWA 3DJ1A 1N7EA 5I7ZA 3WKLA 1QAUA 3SOEA 2YUBA 2BYGA 2ZPMA 2DB5A 4Z8JA 1GM1A 2MX6A 2KA9A 5JXBA 3WKMA 1KEFA 2W7RA 1V5LA 2PZDA 4NNMA 2EEGA 2LUIA 1OBYA 4NMRA 4N6XA 2IWNA 1IU2A 2P3WA 3R69A 2R3YA 3CH8A 1UEPA 2K20A 5HETA 2CSJA 3R0HA 5E22A 1GQ5A 2IWOA 2JREA 2Z17A 4FLNA 2KOMA 2REYA 3K82A 2JIKA 2KV8A 4JOEA 2EDZA 3HVQC 4PQWA 4YDPA 1FC7A 1W9OA 5EYZA 3GJ9A 5H3JA 1UEWA 1U3BA 1RGWA 1WJLA 1WHDA 3SFJA 3SHWA 2Q3GA 2JOAA 1FC9A 2KPKA 3KDGA 2DC2A 4NMQA 2L4SA 2KJDA 3AXAA 3I1EA 1SOTA 2AINA 1Y8TA 1WF8A 1RGRA 2E7KA 3HPMA 1LCYA 2KQFA 2EDVA 2UZCA 2CSSA 3PV2A 3R68A 3CYYA 2PKUA 1QLCA 1QAVA 2M0TA 2G2LA 2PKTA 2OMJA 1ZOKA 4Q2OA 2OS6A 2FCFA 1Q7XA 4P0CA 1OBXA 3DIWA 2VSPA 4IC6A 2EDPA 1PDRA 4WYUA 2AWXA 1WI4A 1UITA 1I16A 3I4WA 2YTWA 1M5ZA 4FGMA 4G69A 4NMOA 2KAWA 1KWAA 4JORA 1U37A 3TSZA 2V1WA 2FN5A 4O06A 3JXTA 3TSVA 3TMHA 3PDVA 1WFGA 4GHNA 2H2BA 2OGPA 2HE2A 4E35A 2KYLA 5B42A 4UU5A 3DORA 3L4FD 3TSWA 2YT8A 5HEDA 1I92A 2JWEA 1OBZA 3I18A 2VPHA 4EDJA 3O46A 4K6YA 2KOHA 3PV4A 5HEYA 4Q2PA 4LMMA 4JOKA 2EV8A 2X7ZA 2EGNA 1WFVA 2M10A 4YYXA 2QKVA 2LA8A 1X5NA 4NXQA 3BPUA 3QDOA 4JL7A 2DMZA 2GZVA 1UJDA 2F0AA 2PA1A 2KRGA 1MFLA 4K75A 3PS4A 4K72A 2KOJA 2H3MA 3ID3A 2M0VA 2OPGA 2EEHA 3NFLA 5E6PB 2DLSA 1D5GA 1MFGA 1UF1A 3GGEA 1TQ3A 2FNEA 4E34A 4GVCA 2K1ZA 1YBOA 4REYA 4JOHA 2I6VA 1X6DA 4HOPA 2H3LA 4NMTA 4JJ3A 2VRFA 2JSNA 3NGHA 5G1DA 5GNDA 3HPKA 5E11A 2R4HA 2I1NA 1VA8A 2V90A 3CBZA 2EJYA 3OU0A 1SOZA 2CS5A 5GLJA 1NF3C 5E21A 2F5YA 5EZ0A 2KJKA 4Q2NA 1X8SA 3GCOA 3VQGA 2LC6A 1X5QA 2RCZA 3E17A 2I0IA 4GVDA 4H11A 2MHOA 5F3XA 2YUYA 2DLUA 3ZRTA 3KHFA 2EHRA 2Q9VA 3K50A 2KG2A 4JOGA 5E1YA 3GDSA 1W9QA 2FE5A 2M3MA 2OZFA 1N6EA 1UJUA 3KDKA 4NMSA 1WF7A 2IWQA 2I04A 2KBSA 3DJ3A 3PV5A 3GSLA 2LC7A 1NTEA 1B8QA 4JOJA 2JINA 1P1EA 3GCNA 1TP3A 3EGGC 3K1RA 1KY9A 1Z86A 5B6LA 3B76A 4OAJA 1QAVB 2EEJA 5F67A 1ZUBA 2EEIA 2QG1A 1MC7A 2DAZA 4XHVA 1N7FA 4NXPA 3CC0A 4Z33A 1RZXA 2QKTA 5HF1A 1U38A 4Q3HA 2OCSA 2I4SA 3RL8A 1G9OA 3GDUA 4WYTA 2D92A 1X45A 1V62A 5HF4A 5HFEA 3QE1A 4NNLA 3KZDA 2HGAA 5HEBA 2PDZA 1R6JA 1V5QA 1UEZA 3OTPA 1TE0A 3MH7A 1WG6A 5A2PA 4RI0A 1UM1A 5HFCA 2DM8A 2JXOA 4KFVA 3ID1A 1L6OA 2QBWA 4L8NA 3QGLA 1IU0A 1K32A 1VB7A 2M0UA 5FB8C 2AWUA 4E3BA 3SHUA 2OQSA 1Q3PA 3RLEA 2KJPA 3GDVA 2JILA 2D90A 1VCWA 4AMHA 1WI2A 2QKUA 4NXRA 3MH6A 1W9EA 2W4FA 2I0LA 3SUZA 3NCVA 4K78A 4UU6A 1X9ZA 4Q6SA 3EGHC 1N6DA 1T2MA 1P1DA 1UEQA 2PNTA 2VWRA 2L97A 3QO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMP A;  3RL7 A;  1UHP A;  4MPA A;  1X5R A;  2LOB A;  4OEP A;  3LNY A;  1Z87 A;  1N99 A;  5HJ1 A;  4HOP B;  2VZ5 A;  3QJM A;  2RRM A;  1V1T A;  5HFB A;  4F8K A;  2D8I A;  1FC6 A;  1VJ6 A;  1N6F A;  1GQ4 A;  1TP5 A;  3ID4 A;  3MH4 A;  1WHA A;  3CBY A;  4K76 A;  1Y7N A;  2O2T A;  1BFE A;  4KFW A;  4Q6H A;  2EGK A;  1VAE A;  3CS0 A;  2EAQ A;  4P2A B;  3ID2 A;  2IWP A;  2G5M B;  2WL7 A;  1WIF A;  1RY4 A;  1UFX A;  3LNX A;  3PDZ A;  2KPL A;  3QJN A;  1XZ9 A;  2YT7 A;  1U39 A;  2L4T A;  4JOF A;  4Q2Q A;  1IHJ A;  2ENO A;  2ZPL A;  3FY5 A;  5FHT A;  2QT5 A;  5HFD A;  3DJA A;  5HDY A;  2Z9I A;  3O5N A;  2DJT A;  2EXG A;  1OZI A;  1Q3O A;  3STJ A;  1UJV A;  4OEO A;  4NMV A;  5D13 A;  3VQF A;  4JOP A;  3NFK A;  1WH1 A;  1BE9 A;  3QIK A;  5DTH A;  3CBX A;  3KZE A;  2VSV A;  5G1E A;  2HE4 A;  2H2C A;  2M0Z A;  1UM7 A;  4R2Z A;  1FCF A;  2EGO A;  1V6B A;  2OSG A;  5HFF A;  2KL1 A;  1N7T A;  2DKR A;  2AWW A;  3DJ1 A;  1N7E A;  5I7Z A;  3WKL A;  1QAU A;  3SOE A;  2YUB A;  2BYG A;  2ZPM A;  2DB5 A;  4Z8J A;  1GM1 A;  2MX6 A;  2KA9 A;  5JXB A;  3WKM A;  1KEF A;  2W7R A;  1V5L A;  2PZD A;  4NNM A;  2EEG A;  2LUI A;  1OBY A;  4NMR A;  4N6X A;  2IWN A;  1IU2 A;  2P3W A;  3R69 A;  2R3Y A;  3CH8 A;  1UEP A;  2K20 A;  5HET A;  2CSJ A;  3R0H A;  5E22 A;  1GQ5 A;  2IWO A;  2JRE A;  2Z17 A;  2KOM A;  2REY A;  3K82 A;  2JIK A;  2KV8 A;  4JOE A;  2EDZ A;  3HVQ C;  4PQW A;  4YDP A;  1FC7 A;  1W9O A;  5EYZ A;  3GJ9 A;  5H3J A;  1UEW A;  1U3B A;  1RGW A;  1WJL A;  1WHD A;  3SFJ A;  3SHW A;  2Q3G A;  2JOA A;  1FC9 A;  2KPK A;  2DC2 A;  4NMQ A;  2L4S A;  2KJD A;  3AXA A;  3I1E A;  1SOT A;  2AIN A;  1Y8T A;  1WF8 A;  1RGR A;  2E7K A;  3HPM A;  1LCY A;  2KQF A;  2EDV A;  2UZC A;  2CSS A;  3PV2 A;  3R68 A;  3CYY A;  2PKU A;  1QLC A;  1QAV A;  2M0T A;  2G2L A;  2PKT A;  2OMJ A;  1ZOK A;  4Q2O A;  2OS6 A;  2FCF A;  1Q7X A;  4P0C A;  1OBX A;  3DIW A;  2VSP A;  4IC6 A;  2EDP A;  1PDR A;  4WYU A;  2AWX A;  1WI4 A;  1UIT A;  1I16 A;  3I4W A;  2YTW A;  1M5Z A;  4FGM A;  4G69 A;  4NMO A;  2KAW A;  1KWA A;  4JOR A;  1U37 A;  3TSZ A;  2V1W A;  2FN5 A;  4O06 A;  3JXT A;  3TSV A;  3TMH A;  3PDV A;  1WFG A;  4GHN A;  2H2B A;  2OGP A;  2HE2 A;  4E35 A;  2KYL A;  4UU5 A;  3DOR A;  3L4F D;  3TSW A;  2YT8 A;  5HED A;  1I92 A;  2JWE A;  1OBZ A;  3I18 A;  2VPH A;  4EDJ A;  3O46 A;  4K6Y A;  2KOH A;  3PV4 A;  5HEY A;  4Q2P A;  4LMM A;  4JOK A;  2EV8 A;  2X7Z A;  2EGN A;  1WFV A;  2M10 A;  4YYX A;  2QKV A;  2LA8 A;  1X5N A;  4NXQ A;  3BPU A;  3QDO A;  4JL7 A;  2DMZ A;  2GZV A;  1UJD A;  2F0A A;  2PA1 A;  2KRG A;  1MFL A;  4K75 A;  3PS4 A;  4K72 A;  2KOJ A;  2H3M A;  3ID3 A;  2M0V A;  2OPG A;  2EEH A;  3NFL A;  5E6P B;  2DLS A;  1D5G A;  1MFG A;  1UF1 A;  3GGE A;  1TQ3 A;  2FNE A;  4E34 A;  4GVC A;  2K1Z A;  1YBO A;  4REY A;  4JOH A;  2I6V A;  1X6D A;  4HOP A;  2H3L A;  4NMT A;  2VRF A;  3NGH A;  5G1D A;  5GND A;  3HPK A;  5E11 A;  2R4H A;  2I1N A;  1VA8 A;  2V90 A;  3CBZ A;  2EJY A;  3OU0 A;  1SOZ A;  2CS5 A;  5GLJ A;  1NF3 C;  5E21 A;  2F5Y A;  5EZ0 A;  2KJK A;  4Q2N A;  1X8S A;  3GCO A;  3VQG A;  2LC6 A;  1X5Q A;  2RCZ A;  3E17 A;  2I0I A;  4GVD A;  4H11 A;  2MHO A;  5F3X A;  2YUY A;  2DLU A;  3ZRT A;  3KHF A;  2EHR A;  2Q9V A;  3K50 A;  2KG2 A;  4JOG A;  5E1Y A;  3GDS A;  1W9Q A;  2FE5 A;  2M3M A;  2OZF A;  1N6E A;  1UJU A;  4NMS A;  1WF7 A;  2IWQ A;  2I04 A;  2KBS A;  3DJ3 A;  3PV5 A;  3GSL A;  2LC7 A;  1NTE A;  1B8Q A;  4JOJ A;  2JIN A;  1P1E A;  3GCN A;  1TP3 A;  3EGG C;  3K1R A;  1KY9 A;  1Z86 A;  5B6L A;  3B76 A;  4OAJ A;  1QAV B;  2EEJ A;  5F67 A;  1ZUB A;  2EEI A;  2QG1 A;  1MC7 A;  2DAZ A;  4XHV A;  1N7F A;  4NXP A;  3CC0 A;  4Z33 A;  1RZX A;  2QKT A;  5HF1 A;  1U38 A;  4Q3H A;  2OCS A;  2I4S A;  3RL8 A;  1G9O A;  3GDU A;  4WYT A;  2D92 A;  1X45 A;  1V62 A;  5HF4 A;  5HFE A;  3QE1 A;  4NNL A;  3KZD A;  2HGA A;  5HEB A;  2PDZ A;  1R6J A;  1V5Q A;  1UEZ A;  3OTP A;  1TE0 A;  3MH7 A;  1WG6 A;  5A2P A;  4RI0 A;  1UM1 A;  5HFC A;  2DM8 A;  2JXO A;  4KFV A;  3ID1 A;  1L6O A;  2QBW A;  4L8N A;  3QGL A;  1IU0 A;  1K32 A;  1VB7 A;  2M0U A;  5FB8 C;  2AWU A;  4E3B A;  3SHU A;  2OQS A;  1Q3P A;  3RLE A;  2KJP A;  3GDV A;  2JIL A;  2D90 A;  1VCW A;  4AMH A;  1WI2 A;  2QKU A;  4NXR A;  3MH6 A;  1W9E A;  2W4F A;  2I0L A;  3SUZ A;  4K78 A;  4UU6 A;  4Q6S A;  3EGH C;  1N6D A;  1T2M A;  1P1D A;  1UEQ A;  2PNT A;  2VWR A;  2L97 A;  3QO6 A; 
#chains in the Genus database with same CATH topology
 4NMP A;  3RL7 A;  1UHP A;  3GAB A;  4MPA A;  1X5R A;  2LOB A;  4OEP A;  3LNY A;  1Z87 A;  1N99 A;  5HJ1 A;  2GEF A;  4HOP B;  2VZ5 A;  3QJM A;  2RRM A;  1V1T A;  5HFB A;  4F8K A;  2D8I A;  1FC6 A;  1VJ6 A;  1N6F A;  1GQ4 A;  1TP5 A;  4JJ0 A;  3ID4 A;  5IL9 A;  3MH4 A;  1WHA A;  3CBY A;  4K76 A;  1Y7N A;  2O2T A;  1BFE A;  4KFW A;  4Q6H A;  2EGK A;  1VAE A;  3CS0 A;  2EAQ A;  4P2A B;  3ID2 A;  2IWP A;  2G5M B;  2WL7 A;  1WIF A;  1RY4 A;  1UFX A;  3LNX A;  3PDZ A;  2KPL A;  3QJN A;  1XZ9 A;  2YT7 A;  1U39 A;  2L4T A;  4JOF A;  4Q2Q A;  1IHJ A;  2ENO A;  2ZPL A;  3FY5 A;  5FHT A;  2QT5 A;  5HFD A;  3DJA A;  5HDY A;  2Z9I A;  3O5N A;  2DJT A;  2EXG A;  1OZI A;  1Q3O A;  3STJ A;  5ILB A;  1UJV A;  4OEO A;  4NMV A;  5D13 A;  3VQF A;  4JOP A;  3NFK A;  1WH1 A;  1BE9 A;  3QIK A;  5DTH A;  3CBX A;  3KZE A;  2VSV A;  5G1E A;  2HE4 A;  2H2C A;  2M0Z A;  1UM7 A;  4R2Z A;  1FCF A;  2EGO A;  1V6B A;  2OSG A;  5HFF A;  2KL1 A;  1N7T A;  2DKR A;  2AWW A;  3DJ1 A;  1N7E A;  5I7Z A;  3WKL A;  1QAU A;  3SOE A;  2YUB A;  2BYG A;  2ZPM A;  2DB5 A;  4Z8J A;  1GM1 A;  2MX6 A;  2KA9 A;  5JXB A;  3WKM A;  1KEF A;  2W7R A;  1V5L A;  2PZD A;  4NNM A;  2EEG A;  2LUI A;  1OBY A;  4NMR A;  4N6X A;  2IWN A;  1IU2 A;  2P3W A;  3R69 A;  2R3Y A;  3CH8 A;  1UEP A;  2K20 A;  5HET A;  2CSJ A;  3R0H A;  5E22 A;  1GQ5 A;  2IWO A;  2JRE A;  2Z17 A;  4FLN A;  2KOM A;  2REY A;  3K82 A;  2JIK A;  2KV8 A;  4JOE A;  2EDZ A;  3HVQ C;  4PQW A;  4YDP A;  1FC7 A;  1W9O A;  5EYZ A;  3GJ9 A;  5H3J A;  1UEW A;  1U3B A;  1RGW A;  1WJL A;  1WHD A;  3SFJ A;  3SHW A;  2Q3G A;  2JOA A;  1FC9 A;  2KPK A;  3KDG A;  2DC2 A;  4NMQ A;  2L4S A;  2KJD A;  3AXA A;  3I1E A;  1SOT A;  2AIN A;  1Y8T A;  1WF8 A;  1RGR A;  2E7K A;  3HPM A;  1LCY A;  2KQF A;  2EDV A;  2UZC A;  2CSS A;  3PV2 A;  3R68 A;  3CYY A;  2PKU A;  1QLC A;  1QAV A;  2M0T A;  2G2L A;  2PKT A;  2OMJ A;  1ZOK A;  4Q2O A;  2OS6 A;  2FCF A;  1Q7X A;  4P0C A;  1OBX A;  3DIW A;  2VSP A;  4IC6 A;  2EDP A;  1PDR A;  4WYU A;  2AWX A;  1WI4 A;  1UIT A;  1I16 A;  3I4W A;  2YTW A;  1M5Z A;  4FGM A;  4G69 A;  4NMO A;  2KAW A;  1KWA A;  4JOR A;  1U37 A;  3TSZ A;  2V1W A;  2FN5 A;  4O06 A;  3JXT A;  3TSV A;  3TMH A;  3PDV A;  1WFG A;  4GHN A;  2H2B A;  2OGP A;  2HE2 A;  4E35 A;  2KYL A;  5B42 A;  4UU5 A;  3DOR A;  3L4F D;  3TSW A;  2YT8 A;  5HED A;  1I92 A;  2JWE A;  1OBZ A;  3I18 A;  2VPH A;  4EDJ A;  3O46 A;  4K6Y A;  2KOH A;  3PV4 A;  5HEY A;  4Q2P A;  4LMM A;  4JOK A;  2EV8 A;  2X7Z A;  2EGN A;  1WFV A;  2M10 A;  4YYX A;  2QKV A;  2LA8 A;  1X5N A;  4NXQ A;  3BPU A;  3QDO A;  4JL7 A;  2DMZ A;  2GZV A;  1UJD A;  2F0A A;  2PA1 A;  2KRG A;  1MFL A;  4K75 A;  3PS4 A;  4K72 A;  2KOJ A;  2H3M A;  3ID3 A;  2M0V A;  2OPG A;  2EEH A;  3NFL A;  5E6P B;  2DLS A;  1D5G A;  1MFG A;  1UF1 A;  3GGE A;  1TQ3 A;  2FNE A;  4E34 A;  4GVC A;  2K1Z A;  1YBO A;  4REY A;  4JOH A;  2I6V A;  1X6D A;  4HOP A;  2H3L A;  4NMT A;  4JJ3 A;  2VRF A;  2JSN A;  3NGH A;  5G1D A;  5GND A;  3HPK A;  5E11 A;  2R4H A;  2I1N A;  1VA8 A;  2V90 A;  3CBZ A;  2EJY A;  3OU0 A;  1SOZ A;  2CS5 A;  5GLJ A;  1NF3 C;  5E21 A;  2F5Y A;  5EZ0 A;  2KJK A;  4Q2N A;  1X8S A;  3GCO A;  3VQG A;  2LC6 A;  1X5Q A;  2RCZ A;  3E17 A;  2I0I A;  4GVD A;  4H11 A;  2MHO A;  5F3X A;  2YUY A;  2DLU A;  3ZRT A;  3KHF A;  2EHR A;  2Q9V A;  3K50 A;  2KG2 A;  4JOG A;  5E1Y A;  3GDS A;  1W9Q A;  2FE5 A;  2M3M A;  2OZF A;  1N6E A;  1UJU A;  3KDK A;  4NMS A;  1WF7 A;  2IWQ A;  2I04 A;  2KBS A;  3DJ3 A;  3PV5 A;  3GSL A;  2LC7 A;  1NTE A;  1B8Q A;  4JOJ A;  2JIN A;  1P1E A;  3GCN A;  1TP3 A;  3EGG C;  3K1R A;  1KY9 A;  1Z86 A;  5B6L A;  3B76 A;  4OAJ A;  1QAV B;  2EEJ A;  5F67 A;  1ZUB A;  2EEI A;  2QG1 A;  1MC7 A;  2DAZ A;  4XHV A;  1N7F A;  4NXP A;  3CC0 A;  4Z33 A;  1RZX A;  2QKT A;  5HF1 A;  1U38 A;  4Q3H A;  2OCS A;  2I4S A;  3RL8 A;  1G9O A;  3GDU A;  4WYT A;  2D92 A;  1X45 A;  1V62 A;  5HF4 A;  5HFE A;  3QE1 A;  4NNL A;  3KZD A;  2HGA A;  5HEB A;  2PDZ A;  1R6J A;  1V5Q A;  1UEZ A;  3OTP A;  1TE0 A;  3MH7 A;  1WG6 A;  5A2P A;  4RI0 A;  1UM1 A;  5HFC A;  2DM8 A;  2JXO A;  4KFV A;  3ID1 A;  1L6O A;  2QBW A;  4L8N A;  3QGL A;  1IU0 A;  1K32 A;  1VB7 A;  2M0U A;  5FB8 C;  2AWU A;  4E3B A;  3SHU A;  2OQS A;  1Q3P A;  3RLE A;  2KJP A;  3GDV A;  2JIL A;  2D90 A;  1VCW A;  4AMH A;  1WI2 A;  2QKU A;  4NXR A;  3MH6 A;  1W9E A;  2W4F A;  2I0L A;  3SUZ A;  3NCV A;  4K78 A;  4UU6 A;  1X9Z A;  4Q6S A;  3EGH C;  1N6D A;  1T2M A;  1P1D A;  1UEQ A;  2PNT A;  2VWR A;  2L97 A;  3QO6 A; 
#chains in the Genus database with same CATH homology
 4NMP A;  3RL7 A;  1UHP A;  3GAB A;  4MPA A;  1X5R A;  2LOB A;  4OEP A;  3LNY A;  1Z87 A;  1N99 A;  5HJ1 A;  2GEF A;  4HOP B;  2VZ5 A;  3QJM A;  2RRM A;  1V1T A;  5HFB A;  4F8K A;  2D8I A;  1FC6 A;  1VJ6 A;  1N6F A;  1GQ4 A;  1TP5 A;  4JJ0 A;  3ID4 A;  5IL9 A;  3MH4 A;  1WHA A;  3CBY A;  4K76 A;  1Y7N A;  2O2T A;  1BFE A;  4KFW A;  4Q6H A;  2EGK A;  1VAE A;  3CS0 A;  2EAQ A;  4P2A B;  3ID2 A;  2IWP A;  2G5M B;  2WL7 A;  1WIF A;  1RY4 A;  1UFX A;  3LNX A;  3PDZ A;  2KPL A;  3QJN A;  1XZ9 A;  2YT7 A;  1U39 A;  2L4T A;  4JOF A;  4Q2Q A;  1IHJ A;  2ENO A;  2ZPL A;  3FY5 A;  5FHT A;  2QT5 A;  5HFD A;  3DJA A;  5HDY A;  2Z9I A;  3O5N A;  2DJT A;  2EXG A;  1OZI A;  1Q3O A;  3STJ A;  5ILB A;  1UJV A;  4OEO A;  4NMV A;  5D13 A;  3VQF A;  4JOP A;  3NFK A;  1WH1 A;  1BE9 A;  3QIK A;  5DTH A;  3CBX A;  3KZE A;  2VSV A;  5G1E A;  2HE4 A;  2H2C A;  2M0Z A;  1UM7 A;  4R2Z A;  1FCF A;  2EGO A;  1V6B A;  2OSG A;  5HFF A;  2KL1 A;  1N7T A;  2DKR A;  2AWW A;  3DJ1 A;  1N7E A;  5I7Z A;  3WKL A;  1QAU A;  3SOE A;  2YUB A;  2BYG A;  2ZPM A;  2DB5 A;  4Z8J A;  1GM1 A;  2MX6 A;  2KA9 A;  5JXB A;  3WKM A;  1KEF A;  2W7R A;  1V5L A;  2PZD A;  4NNM A;  2EEG A;  2LUI A;  1OBY A;  4NMR A;  4N6X A;  2IWN A;  1IU2 A;  2P3W A;  3R69 A;  2R3Y A;  3CH8 A;  1UEP A;  2K20 A;  5HET A;  2CSJ A;  3R0H A;  5E22 A;  1GQ5 A;  2IWO A;  2JRE A;  2Z17 A;  4FLN A;  2KOM A;  2REY A;  3K82 A;  2JIK A;  2KV8 A;  4JOE A;  2EDZ A;  3HVQ C;  4PQW A;  4YDP A;  1FC7 A;  1W9O A;  5EYZ A;  3GJ9 A;  5H3J A;  1UEW A;  1U3B A;  1RGW A;  1WJL A;  1WHD A;  3SFJ A;  3SHW A;  2Q3G A;  2JOA A;  1FC9 A;  2KPK A;  3KDG A;  2DC2 A;  4NMQ A;  2L4S A;  2KJD A;  3AXA A;  3I1E A;  1SOT A;  2AIN A;  1Y8T A;  1WF8 A;  1RGR A;  2E7K A;  3HPM A;  1LCY A;  2KQF A;  2EDV A;  2UZC A;  2CSS A;  3PV2 A;  3R68 A;  3CYY A;  2PKU A;  1QLC A;  1QAV A;  2M0T A;  2G2L A;  2PKT A;  2OMJ A;  1ZOK A;  4Q2O A;  2OS6 A;  2FCF A;  1Q7X A;  4P0C A;  1OBX A;  3DIW A;  2VSP A;  4IC6 A;  2EDP A;  1PDR A;  4WYU A;  2AWX A;  1WI4 A;  1UIT A;  1I16 A;  3I4W A;  2YTW A;  1M5Z A;  4FGM A;  4G69 A;  4NMO A;  2KAW A;  1KWA A;  4JOR A;  1U37 A;  3TSZ A;  2V1W A;  2FN5 A;  4O06 A;  3JXT A;  3TSV A;  3TMH A;  3PDV A;  1WFG A;  4GHN A;  2H2B A;  2OGP A;  2HE2 A;  4E35 A;  2KYL A;  5B42 A;  4UU5 A;  3DOR A;  3L4F D;  3TSW A;  2YT8 A;  5HED A;  1I92 A;  2JWE A;  1OBZ A;  3I18 A;  2VPH A;  4EDJ A;  3O46 A;  4K6Y A;  2KOH A;  3PV4 A;  5HEY A;  4Q2P A;  4LMM A;  4JOK A;  2EV8 A;  2X7Z A;  2EGN A;  1WFV A;  2M10 A;  4YYX A;  2QKV A;  2LA8 A;  1X5N A;  4NXQ A;  3BPU A;  3QDO A;  4JL7 A;  2DMZ A;  2GZV A;  1UJD A;  2F0A A;  2PA1 A;  2KRG A;  1MFL A;  4K75 A;  3PS4 A;  4K72 A;  2KOJ A;  2H3M A;  3ID3 A;  2M0V A;  2OPG A;  2EEH A;  3NFL A;  5E6P B;  2DLS A;  1D5G A;  1MFG A;  1UF1 A;  3GGE A;  1TQ3 A;  2FNE A;  4E34 A;  4GVC A;  2K1Z A;  1YBO A;  4REY A;  4JOH A;  2I6V A;  1X6D A;  4HOP A;  2H3L A;  4NMT A;  4JJ3 A;  2VRF A;  2JSN A;  3NGH A;  5G1D A;  5GND A;  3HPK A;  5E11 A;  2R4H A;  2I1N A;  1VA8 A;  2V90 A;  3CBZ A;  2EJY A;  3OU0 A;  1SOZ A;  2CS5 A;  5GLJ A;  1NF3 C;  5E21 A;  2F5Y A;  5EZ0 A;  2KJK A;  4Q2N A;  1X8S A;  3GCO A;  3VQG A;  2LC6 A;  1X5Q A;  2RCZ A;  3E17 A;  2I0I A;  4GVD A;  4H11 A;  2MHO A;  5F3X A;  2YUY A;  2DLU A;  3ZRT A;  3KHF A;  2EHR A;  2Q9V A;  3K50 A;  2KG2 A;  4JOG A;  5E1Y A;  3GDS A;  1W9Q A;  2FE5 A;  2M3M A;  2OZF A;  1N6E A;  1UJU A;  3KDK A;  4NMS A;  1WF7 A;  2IWQ A;  2I04 A;  2KBS A;  3DJ3 A;  3PV5 A;  3GSL A;  2LC7 A;  1NTE A;  1B8Q A;  4JOJ A;  2JIN A;  1P1E A;  3GCN A;  1TP3 A;  3EGG C;  3K1R A;  1KY9 A;  1Z86 A;  5B6L A;  3B76 A;  4OAJ A;  1QAV B;  2EEJ A;  5F67 A;  1ZUB A;  2EEI A;  2QG1 A;  1MC7 A;  2DAZ A;  4XHV A;  1N7F A;  4NXP A;  3CC0 A;  4Z33 A;  1RZX A;  2QKT A;  5HF1 A;  1U38 A;  4Q3H A;  2OCS A;  2I4S A;  3RL8 A;  1G9O A;  3GDU A;  4WYT A;  2D92 A;  1X45 A;  1V62 A;  5HF4 A;  5HFE A;  3QE1 A;  4NNL A;  3KZD A;  2HGA A;  5HEB A;  2PDZ A;  1R6J A;  1V5Q A;  1UEZ A;  3OTP A;  1TE0 A;  3MH7 A;  1WG6 A;  5A2P A;  4RI0 A;  1UM1 A;  5HFC A;  2DM8 A;  2JXO A;  4KFV A;  3ID1 A;  1L6O A;  2QBW A;  4L8N A;  3QGL A;  1IU0 A;  1K32 A;  1VB7 A;  2M0U A;  5FB8 C;  2AWU A;  4E3B A;  3SHU A;  2OQS A;  1Q3P A;  3RLE A;  2KJP A;  3GDV A;  2JIL A;  2D90 A;  1VCW A;  4AMH A;  1WI2 A;  2QKU A;  4NXR A;  3MH6 A;  1W9E A;  2W4F A;  2I0L A;  3SUZ A;  3NCV A;  4K78 A;  4UU6 A;  1X9Z A;  4Q6S A;  3EGH C;  1N6D A;  1T2M A;  1P1D A;  1UEQ A;  2PNT A;  2VWR A;  2L97 A;  3QO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...