1X5QA

Solution structure of the first pdz domain of scribble homolog protein (hscrib)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
110
Chain Sequence
b'GSSGSSGEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LAP4 protein
publication title Solution structure of the first PDZ domain of scribble homolog protein (hScrib)
rcsb
source organism Homo sapiens
molecule tags Cell adhesion, cell cycle
total genus 11
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1x5qA01
1WH1A 2PNTA 1UJVA 2H2BA 2JILA 3RLEA 4OEPA 3I18A 4HOPB 3DJ3A 2I6VA 1Z86A 2LA8A 4H11A 3TSVA 4L8NA 2EGOA 3ZRTA 2LC7A 5D13A 3HPMA 4FGMA 2D90A 2IWQA 4O06A 2QT5A 3VQFA 4F8KA 3CBXA 1X8SA 3SFJA 1WFGA 1RZXA 2RCZA 2JOAA 4WYTA 3QDOA 1X45A 4KFVA 1P1EA 4JOHA 3TSWA 3CBYA 1UEQA 2D92A 3TMHA 2FCFA 1T2MA 3WKLA 3DORA 2F0AA 2HE4A 2KYLA 2M0TA 2O2TA 3NFKA 5HFDA 2IWNA 2OS6A 3QGLA 1WJLA 5F3XA 4NMPA 4NXQA 1R6JA 1NTEA 3ID3A 2I0IA 5HJ1A 2M0UA 5F67A 1U38A 1ZOKA 1N6EA 1SOTA 1I16A 1W9EA 1WFVA 4JOEA 5B6LA 5HFEA 2M0VA 4Q2QA 4JL7A 2DJTA 5HF4A 3SHUA 1N99A 3CYYA 1U3BA 2KOMA 2PDZA 3MH6A 4GHNA 1QAVA 1V5LA 2DLSA 5E1YA 4NMRA 2OMJA 4G69A 1FC6A 2JREA 2YT7A 2DAZA 4Z33A 2ZPMA 2H3LA 4OAJA 4Q2OA 2FE5A 3HVQC 1L6OA 1UM1A 1UM7A 4K76A 1WI2A 4YYXA 2M10A 4GVCA 2EXGA 4E35A 2EV8A 3BPUA 1RGRA 1M5ZA 2HGAA 3OTPA 2G5MB 2Z9IA 4K72A 1Q7XA 2UZCA 2P3WA 1B8QA 4JOGA 4PQWA 4RI0A 3WKMA 1UJDA 2V1WA 5G1DA 3HPKA 3R69A 1X6DA 1WG6A 2AWXA 2EJYA 2F5YA 1IHJA 1MC7A 3MH7A 3E17A 1KWAA 1N6DA 1X5RA 1Y8TA 1Y7NA 3DJAA 1W9QA 3RL7A 2QKUA 3SHWA 2DC2A 2I1NA 1TP3A 1UHPA 3CBZA 2OGPA 2VRFA 2VZ5A 2KBSA 1QAUA 2PKTA 1PDRA 2EEGA 2KOHA 1GQ5A 1X5QA 4GVDA 4NXRA 4P2AB 2PKUA 2CSJA 2OZFA 3GDSA 1UEWA 3ID2A 4JOJA 2I4SA 2Q9VA 3LNXA 5A2PA 2QKTA 3OU0A 2FNEA 5E11A 1TQ3A 2LUIA 3I1EA 3SOEA 5GLJA 2K1ZA 3EGGC 4NMSA 1BFEA 2KPKA 1N7EA 1WHDA 1ZUBA 3I4WA 4NXPA 3DJ1A 1P1DA 2EDVA 3PS4A 4JOKA 2Z17A 3GJ9A 3O5NA 4OEOA 4Q3HA 5E21A 2D8IA 4NMQA 2OPGA 3CS0A 3L4FD 3QO6A 2KRGA 1UEZA 4NMTA 1RGWA 2EHRA 3JXTA 5GNDA 1D5GA 3B76A 1UJUA 2QBWA 4EDJA 3PDZA 4Q6SA 1BE9A 2AWUA 3NFLA 4NMVA 1FCFA 2EEHA 4UU5A 3NGHA 2DMZA 1G9OA 5DTHA 1WI4A 2I04A 1X5NA 5HDYA 5FHTA 2WL7A 2YUBA 5HEDA 4Z8JA 1UFXA 2PA1A 4MPAA 1V6BA 1V62A 1TE0A 4UU6A 3K1RA 1WF7A 1XZ9A 5HEBA 2Q3GA 3SUZA 4AMHA 2VPHA 4R2ZA 2REYA 1VCWA 1WIFA 2QKVA 2X7ZA 3GDUA 2EGKA 3R0HA 4LMMA 1Q3OA 1K32A 3MH4A 4P0CA 3ID4A 3GSLA 2DB5A 3K50A 1W9OA 2VSPA 3AXAA 2LC6A 2M3MA 3GDVA 1Q3PA 1UITA 5I7ZA 2EEJA 2JIKA 1IU0A 1KY9A 2R4HA 3KZEA 2OCSA 3QE1A 3STJA 2ENOA 4HOPA 2H3MA 2VSVA 4K75A 2W4FA 1UF1A 1OBZA 2QG1A 2KV8A 2CS5A 2JWEA 5E22A 2KL1A 3GCOA 2PZDA 2KJPA 1Z87A 5HEYA 3CC0A 1LCYA 2EGNA 1WF8A 3CH8A 1N7FA 2YT8A 2KG2A 2OQSA 1U39A 1TP5A 1U37A 2E7KA 1N7TA 2DKRA 1V5QA 1FC9A 2KAWA 5HF1A 2FN5A 3TSZA 2EEIA 1GQ4A 4REYA 4E34A 2L97A 4NMOA 3GGEA 4Q2NA 1I92A 4XHVA 2EDZA 1YBOA 1RY4A 4WYUA 1UEPA 3LNYA 2L4SA 1IU2A 2LOBA 2V90A 3VQGA 3O46A 3PV2A 2OSGA 2L4TA 2JXOA 2I0LA 3PV5A 1QLCA 4NNMA 3QJMA 4N6XA 1VAEA 3DIWA 1VJ6A 3QIKA 3K82A 2EAQA 1KEFA 2BYGA 3RL8A 3PDVA 2DM8A 5EZ0A 4Q6HA 2YUYA 4IC6A 4KFWA 3R68A 4E3BA 1GM1A 2AINA 1VA8A 1QAVB 4K78A 1VB7A 2KJDA 1OBXA 2IWOA 1MFGA 2JINA 5JXBA 2YTWA 2K20A 4JOFA 3QJNA 2AWWA 5HFBA 3FY5A 2MX6A 2RRMA 3PV4A 4Q2PA 5E6PB 5HFCA 2MHOA 5FB8C 1WHAA 2EDPA 2W7RA 2DLUA 2ZPLA 2R3YA 3KZDA 1NF3C 4NNLA 1V1TA 2GZVA 5G1EA 2G2LA 2KJKA 4K6YA 2IWPA 4JOPA 5HETA 5HFFA 3GCNA 1OZIA 1SOZA 3ID1A 2KA9A 2M0ZA 2H2CA 2VWRA 2KOJA 2KPLA 1OBYA 4JORA 1MFLA 2CSSA 3KHFA 2KQFA 4YDPA 2HE2A 5H3JA 3EGHC 5EYZA 1FC7A 1N6FA
chains in the Genus database with same CATH superfamily
1WH1A 2PNTA 1UJVA 2H2BA 2JILA 3RLEA 4OEPA 3I18A 4HOPB 3DJ3A 2I6VA 1Z86A 2LA8A 4H11A 3TSVA 4L8NA 2EGOA 3ZRTA 2LC7A 5D13A 3HPMA 4FGMA 2D90A 2IWQA 4O06A 2QT5A 3VQFA 4F8KA 3CBXA 1X8SA 3SFJA 1WFGA 1RZXA 2RCZA 2JOAA 4WYTA 3QDOA 1X45A 4KFVA 1P1EA 4JOHA 3TSWA 3CBYA 3KDGA 1UEQA 2D92A 3TMHA 2FCFA 1T2MA 3WKLA 3DORA 2F0AA 2HE4A 2KYLA 2M0TA 2O2TA 3NFKA 5HFDA 2IWNA 2OS6A 3QGLA 4JJ3A 1WJLA 5F3XA 4NMPA 4NXQA 1R6JA 1NTEA 3KDKA 3ID3A 2I0IA 5HJ1A 2M0UA 5F67A 1U38A 1ZOKA 1N6EA 1SOTA 1I16A 1W9EA 1WFVA 4JOEA 5B6LA 5HFEA 2M0VA 4Q2QA 4JL7A 2DJTA 5HF4A 3SHUA 1N99A 3CYYA 1U3BA 2PDZA 2KOMA 3MH6A 4GHNA 1QAVA 1V5LA 2DLSA 5E1YA 4NMRA 2OMJA 4FLNA 4G69A 1FC6A 2JREA 2YT7A 2DAZA 4Z33A 2ZPMA 2H3LA 4OAJA 4Q2OA 2FE5A 3HVQC 1L6OA 1UM1A 1UM7A 4K76A 1WI2A 4YYXA 2M10A 4GVCA 2EXGA 4E35A 2EV8A 3BPUA 1RGRA 1M5ZA 2HGAA 3OTPA 2G5MB 2Z9IA 4K72A 1Q7XA 2UZCA 2P3WA 1B8QA 4JOGA 4PQWA 4RI0A 3WKMA 1UJDA 2V1WA 5G1DA 3GABA 3HPKA 3R69A 1X6DA 1WG6A 2AWXA 5B42A 2EJYA 2F5YA 1IHJA 1MC7A 3MH7A 3E17A 1KWAA 1N6DA 1X5RA 1Y8TA 1Y7NA 3DJAA 1W9QA 3RL7A 2QKUA 3SHWA 2DC2A 2I1NA 1TP3A 1UHPA 3CBZA 2OGPA 2VRFA 2VZ5A 2KBSA 1QAUA 2PKTA 1PDRA 2EEGA 2KOHA 1GQ5A 1X5QA 4GVDA 4NXRA 4P2AB 2PKUA 2CSJA 5ILBA 2OZFA 3GDSA 1UEWA 3ID2A 4JOJA 2I4SA 2Q9VA 3LNXA 5A2PA 2QKTA 3OU0A 2FNEA 5E11A 1TQ3A 2LUIA 3I1EA 3SOEA 5GLJA 2K1ZA 3EGGC 4NMSA 1BFEA 2KPKA 1N7EA 1WHDA 1ZUBA 3I4WA 4NXPA 3DJ1A 1P1DA 2EDVA 3PS4A 4JOKA 2Z17A 3GJ9A 3O5NA 4OEOA 4Q3HA 5E21A 2D8IA 4NMQA 2OPGA 3CS0A 3L4FD 3QO6A 2KRGA 1UEZA 4NMTA 1RGWA 2EHRA 3JXTA 5GNDA 1D5GA 3B76A 1UJUA 2QBWA 4EDJA 3PDZA 4Q6SA 1BE9A 2AWUA 3NFLA 4NMVA 1FCFA 2EEHA 4UU5A 3NGHA 2DMZA 1G9OA 5DTHA 1WI4A 2I04A 1X5NA 5HDYA 5FHTA 2WL7A 2YUBA 5HEDA 4Z8JA 1UFXA 2PA1A 4MPAA 1V6BA 1V62A 1TE0A 4UU6A 1WF7A 1XZ9A 3K1RA 5HEBA 2Q3GA 3SUZA 4AMHA 2VPHA 4R2ZA 2REYA 1VCWA 1WIFA 2QKVA 2X7ZA 3GDUA 2EGKA 3R0HA 4LMMA 1Q3OA 1K32A 3MH4A 4P0CA 3ID4A 3GSLA 2DB5A 3K50A 1W9OA 2VSPA 3AXAA 2LC6A 2M3MA 3GDVA 1Q3PA 1UITA 5IL9A 5I7ZA 2EEJA 2JIKA 1IU0A 1KY9A 2R4HA 3KZEA 2OCSA 3QE1A 3STJA 2ENOA 4HOPA 2H3MA 2VSVA 4K75A 2W4FA 1UF1A 1OBZA 2QG1A 2KV8A 2CS5A 2JWEA 5E22A 2KL1A 3GCOA 2PZDA 2KJPA 1X9ZA 1Z87A 5HEYA 3CC0A 1LCYA 2EGNA 1WF8A 3CH8A 1N7FA 2YT8A 2KG2A 2OQSA 1U39A 1TP5A 1U37A 2E7KA 1N7TA 2DKRA 1V5QA 1FC9A 2KAWA 5HF1A 2FN5A 3TSZA 2EEIA 2JSNA 1GQ4A 4REYA 4E34A 2L97A 4NMOA 3GGEA 4Q2NA 1I92A 4XHVA 2EDZA 1YBOA 1RY4A 4WYUA 3NCVA 1UEPA 3LNYA 2L4SA 1IU2A 2LOBA 2V90A 3VQGA 3O46A 3PV2A 2OSGA 2L4TA 2JXOA 2I0LA 3PV5A 1QLCA 4NNMA 3QJMA 4N6XA 1VAEA 3DIWA 1VJ6A 3QIKA 3K82A 2EAQA 1KEFA 2BYGA 3RL8A 3PDVA 2DM8A 5EZ0A 4Q6HA 2YUYA 4IC6A 4KFWA 3R68A 4E3BA 1GM1A 2AINA 1VA8A 1QAVB 4K78A 1VB7A 2KJDA 1OBXA 2IWOA 1MFGA 2JINA 5JXBA 2YTWA 2K20A 4JOFA 3QJNA 2AWWA 5HFBA 3FY5A 2MX6A 2RRMA 3PV4A 4Q2PA 5E6PB 5HFCA 2MHOA 5FB8C 1WHAA 2EDPA 2W7RA 2DLUA 2ZPLA 2R3YA 3KZDA 1NF3C 4NNLA 1V1TA 2GZVA 5G1EA 2G2LA 2KJKA 4K6YA 2IWPA 4JOPA 5HETA 5HFFA 3GCNA 1OZIA 1SOZA 3ID1A 2KA9A 2M0ZA 2H2CA 2VWRA 2KOJA 2GEFA 2KPLA 1OBYA 4JORA 1MFLA 2CSSA 3KHFA 2KQFA 4YDPA 4JJ0A 2HE2A 5H3JA 3EGHC 5EYZA 1FC7A 1N6FA
chains in the Genus database with same CATH topology
1WH1A 2PNTA 1UJVA 2H2BA 2JILA 3RLEA 4OEPA 3I18A 4HOPB 3DJ3A 2I6VA 1Z86A 2LA8A 4H11A 3TSVA 4L8NA 2EGOA 3ZRTA 2LC7A 5D13A 3HPMA 4FGMA 2D90A 2IWQA 4O06A 2QT5A 3VQFA 4F8KA 3CBXA 1X8SA 3SFJA 1WFGA 1RZXA 2RCZA 2JOAA 4WYTA 3QDOA 1X45A 4KFVA 1P1EA 4JOHA 3TSWA 3CBYA 3KDGA 1UEQA 2D92A 3TMHA 2FCFA 1T2MA 3WKLA 3DORA 2F0AA 2HE4A 2KYLA 2M0TA 2O2TA 3NFKA 5HFDA 2IWNA 2OS6A 3QGLA 4JJ3A 1WJLA 5F3XA 4NMPA 4NXQA 1R6JA 1NTEA 3KDKA 3ID3A 2I0IA 5HJ1A 2M0UA 5F67A 1U38A 1ZOKA 1N6EA 1SOTA 1I16A 1W9EA 1WFVA 4JOEA 5B6LA 5HFEA 2M0VA 4Q2QA 4JL7A 2DJTA 5HF4A 3SHUA 1N99A 3CYYA 1U3BA 2PDZA 2KOMA 3MH6A 4GHNA 1QAVA 1V5LA 2DLSA 5E1YA 4NMRA 2OMJA 4FLNA 4G69A 1FC6A 2JREA 2YT7A 2DAZA 4Z33A 2ZPMA 2H3LA 4OAJA 4Q2OA 2FE5A 3HVQC 1L6OA 1UM1A 1UM7A 4K76A 1WI2A 4YYXA 2M10A 4GVCA 2EXGA 4E35A 2EV8A 3BPUA 1RGRA 1M5ZA 2HGAA 3OTPA 2G5MB 2Z9IA 4K72A 1Q7XA 2UZCA 2P3WA 1B8QA 4JOGA 4PQWA 4RI0A 3WKMA 1UJDA 2V1WA 5G1DA 3GABA 3HPKA 3R69A 1X6DA 1WG6A 2AWXA 5B42A 2EJYA 2F5YA 1IHJA 1MC7A 3MH7A 3E17A 1KWAA 1N6DA 1X5RA 1Y8TA 1Y7NA 3DJAA 1W9QA 3RL7A 2QKUA 3SHWA 2DC2A 2I1NA 1TP3A 1UHPA 3CBZA 2OGPA 2VRFA 2VZ5A 2KBSA 1QAUA 2PKTA 1PDRA 2EEGA 2KOHA 1GQ5A 1X5QA 4GVDA 4NXRA 4P2AB 2PKUA 2CSJA 5ILBA 2OZFA 3GDSA 1UEWA 3ID2A 4JOJA 2I4SA 2Q9VA 3LNXA 5A2PA 2QKTA 3OU0A 2FNEA 5E11A 1TQ3A 2LUIA 3I1EA 3SOEA 5GLJA 2K1ZA 3EGGC 4NMSA 1BFEA 2KPKA 1N7EA 1WHDA 1ZUBA 3I4WA 4NXPA 3DJ1A 1P1DA 2EDVA 3PS4A 4JOKA 2Z17A 3GJ9A 3O5NA 4OEOA 4Q3HA 5E21A 2D8IA 4NMQA 2OPGA 3CS0A 3L4FD 3QO6A 2KRGA 1UEZA 4NMTA 1RGWA 2EHRA 3JXTA 5GNDA 1D5GA 3B76A 1UJUA 2QBWA 4EDJA 3PDZA 4Q6SA 1BE9A 2AWUA 3NFLA 4NMVA 1FCFA 2EEHA 4UU5A 3NGHA 2DMZA 1G9OA 5DTHA 1WI4A 2I04A 1X5NA 5HDYA 5FHTA 2WL7A 2YUBA 5HEDA 4Z8JA 1UFXA 2PA1A 4MPAA 1V6BA 1V62A 1TE0A 4UU6A 1WF7A 1XZ9A 3K1RA 5HEBA 2Q3GA 3SUZA 4AMHA 2VPHA 4R2ZA 2REYA 1VCWA 1WIFA 2QKVA 2X7ZA 3GDUA 2EGKA 3R0HA 4LMMA 1Q3OA 1K32A 3MH4A 4P0CA 3ID4A 3GSLA 2DB5A 3K50A 1W9OA 2VSPA 3AXAA 2LC6A 2M3MA 3GDVA 1Q3PA 1UITA 5IL9A 5I7ZA 2EEJA 2JIKA 1IU0A 1KY9A 2R4HA 3KZEA 2OCSA 3QE1A 3STJA 2ENOA 4HOPA 2H3MA 2VSVA 4K75A 2W4FA 1UF1A 1OBZA 2QG1A 2KV8A 2CS5A 2JWEA 5E22A 2KL1A 3GCOA 2PZDA 2KJPA 1X9ZA 1Z87A 5HEYA 3CC0A 1LCYA 2EGNA 1WF8A 3CH8A 1N7FA 2YT8A 2KG2A 2OQSA 1U39A 1TP5A 1U37A 2E7KA 1N7TA 2DKRA 1V5QA 1FC9A 2KAWA 5HF1A 2FN5A 3TSZA 2EEIA 2JSNA 1GQ4A 4REYA 4E34A 2L97A 4NMOA 3GGEA 4Q2NA 1I92A 4XHVA 2EDZA 1YBOA 1RY4A 4WYUA 3NCVA 1UEPA 3LNYA 2L4SA 1IU2A 2LOBA 2V90A 3VQGA 3O46A 3PV2A 2OSGA 2L4TA 2JXOA 2I0LA 3PV5A 1QLCA 4NNMA 3QJMA 4N6XA 1VAEA 3DIWA 1VJ6A 3QIKA 3K82A 2EAQA 1KEFA 2BYGA 3RL8A 3PDVA 2DM8A 5EZ0A 4Q6HA 2YUYA 4IC6A 4KFWA 3R68A 4E3BA 1GM1A 2AINA 1VA8A 1QAVB 4K78A 1VB7A 2KJDA 1OBXA 2IWOA 1MFGA 2JINA 5JXBA 2YTWA 2K20A 4JOFA 3QJNA 2AWWA 5HFBA 3FY5A 2MX6A 2RRMA 3PV4A 4Q2PA 5E6PB 5HFCA 2MHOA 5FB8C 1WHAA 2EDPA 2W7RA 2DLUA 2ZPLA 2R3YA 3KZDA 1NF3C 4NNLA 1V1TA 2GZVA 5G1EA 2G2LA 2KJKA 4K6YA 2IWPA 4JOPA 5HETA 5HFFA 3GCNA 1OZIA 1SOZA 3ID1A 2KA9A 2M0ZA 2H2CA 2VWRA 2KOJA 2GEFA 2KPLA 1OBYA 4JORA 1MFLA 2CSSA 3KHFA 2KQFA 4YDPA 4JJ0A 2HE2A 5H3JA 3EGHC 5EYZA 1FC7A 1N6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH1 A;  2PNT A;  1UJV A;  2H2B A;  2JIL A;  3RLE A;  4OEP A;  3I18 A;  4HOP B;  3DJ3 A;  2I6V A;  1Z86 A;  2LA8 A;  4H11 A;  3TSV A;  4L8N A;  2EGO A;  3ZRT A;  2LC7 A;  5D13 A;  3HPM A;  4FGM A;  2D90 A;  2IWQ A;  4O06 A;  2QT5 A;  3VQF A;  4F8K A;  3CBX A;  1X8S A;  3SFJ A;  1WFG A;  1RZX A;  2RCZ A;  2JOA A;  4WYT A;  3QDO A;  1X45 A;  4KFV A;  1P1E A;  4JOH A;  3TSW A;  3CBY A;  1UEQ A;  2D92 A;  3TMH A;  2FCF A;  1T2M A;  3WKL A;  3DOR A;  2F0A A;  2HE4 A;  2KYL A;  2M0T A;  2O2T A;  3NFK A;  5HFD A;  2IWN A;  2OS6 A;  3QGL A;  1WJL A;  5F3X A;  4NMP A;  4NXQ A;  1R6J A;  1NTE A;  3ID3 A;  2I0I A;  5HJ1 A;  2M0U A;  5F67 A;  1U38 A;  1ZOK A;  1N6E A;  1SOT A;  1I16 A;  1W9E A;  1WFV A;  4JOE A;  5B6L A;  5HFE A;  2M0V A;  4Q2Q A;  4JL7 A;  2DJT A;  5HF4 A;  3SHU A;  1N99 A;  3CYY A;  1U3B A;  2KOM A;  2PDZ A;  3MH6 A;  4GHN A;  1QAV A;  1V5L A;  2DLS A;  5E1Y A;  4NMR A;  2OMJ A;  4G69 A;  1FC6 A;  2JRE A;  2YT7 A;  2DAZ A;  4Z33 A;  2ZPM A;  2H3L A;  4OAJ A;  4Q2O A;  2FE5 A;  3HVQ C;  1L6O A;  1UM1 A;  1UM7 A;  4K76 A;  1WI2 A;  4YYX A;  2M10 A;  4GVC A;  2EXG A;  4E35 A;  2EV8 A;  3BPU A;  1RGR A;  1M5Z A;  2HGA A;  3OTP A;  2G5M B;  2Z9I A;  4K72 A;  1Q7X A;  2UZC A;  2P3W A;  1B8Q A;  4JOG A;  4PQW A;  4RI0 A;  3WKM A;  1UJD A;  2V1W A;  5G1D A;  3HPK A;  3R69 A;  1X6D A;  1WG6 A;  2AWX A;  2EJY A;  2F5Y A;  1IHJ A;  1MC7 A;  3MH7 A;  3E17 A;  1KWA A;  1N6D A;  1X5R A;  1Y8T A;  1Y7N A;  3DJA A;  1W9Q A;  3RL7 A;  2QKU A;  3SHW A;  2DC2 A;  2I1N A;  1TP3 A;  1UHP A;  3CBZ A;  2OGP A;  2VRF A;  2VZ5 A;  2KBS A;  1QAU A;  2PKT A;  1PDR A;  2EEG A;  2KOH A;  1GQ5 A;  1X5Q A;  4GVD A;  4NXR A;  4P2A B;  2PKU A;  2CSJ A;  2OZF A;  3GDS A;  1UEW A;  3ID2 A;  4JOJ A;  2I4S A;  2Q9V A;  3LNX A;  5A2P A;  2QKT A;  3OU0 A;  2FNE A;  5E11 A;  1TQ3 A;  2LUI A;  3I1E A;  3SOE A;  5GLJ A;  2K1Z A;  3EGG C;  4NMS A;  1BFE A;  2KPK A;  1N7E A;  1WHD A;  1ZUB A;  3I4W A;  4NXP A;  3DJ1 A;  1P1D A;  2EDV A;  3PS4 A;  4JOK A;  2Z17 A;  3GJ9 A;  3O5N A;  4OEO A;  4Q3H A;  5E21 A;  2D8I A;  4NMQ A;  2OPG A;  3CS0 A;  3L4F D;  3QO6 A;  2KRG A;  1UEZ A;  4NMT A;  1RGW A;  2EHR A;  3JXT A;  5GND A;  1D5G A;  3B76 A;  1UJU A;  2QBW A;  4EDJ A;  3PDZ A;  4Q6S A;  1BE9 A;  2AWU A;  3NFL A;  4NMV A;  1FCF A;  2EEH A;  4UU5 A;  3NGH A;  2DMZ A;  1G9O A;  5DTH A;  1WI4 A;  2I04 A;  1X5N A;  5HDY A;  5FHT A;  2WL7 A;  2YUB A;  5HED A;  4Z8J A;  1UFX A;  2PA1 A;  4MPA A;  1V6B A;  1V62 A;  1TE0 A;  4UU6 A;  3K1R A;  1WF7 A;  1XZ9 A;  5HEB A;  2Q3G A;  3SUZ A;  4AMH A;  2VPH A;  4R2Z A;  2REY A;  1VCW A;  1WIF A;  2QKV A;  2X7Z A;  3GDU A;  2EGK A;  3R0H A;  4LMM A;  1Q3O A;  1K32 A;  3MH4 A;  4P0C A;  3ID4 A;  3GSL A;  2DB5 A;  3K50 A;  1W9O A;  2VSP A;  3AXA A;  2LC6 A;  2M3M A;  3GDV A;  1Q3P A;  1UIT A;  5I7Z A;  2EEJ A;  2JIK A;  1IU0 A;  1KY9 A;  2R4H A;  3KZE A;  2OCS A;  3QE1 A;  3STJ A;  2ENO A;  4HOP A;  2H3M A;  2VSV A;  4K75 A;  2W4F A;  1UF1 A;  1OBZ A;  2QG1 A;  2KV8 A;  2CS5 A;  2JWE A;  5E22 A;  2KL1 A;  3GCO A;  2PZD A;  2KJP A;  1Z87 A;  5HEY A;  3CC0 A;  1LCY A;  2EGN A;  1WF8 A;  3CH8 A;  1N7F A;  2YT8 A;  2KG2 A;  2OQS A;  1U39 A;  1TP5 A;  1U37 A;  2E7K A;  1N7T A;  2DKR A;  1V5Q A;  1FC9 A;  2KAW A;  5HF1 A;  2FN5 A;  3TSZ A;  2EEI A;  1GQ4 A;  4REY A;  4E34 A;  2L97 A;  4NMO A;  3GGE A;  4Q2N A;  1I92 A;  4XHV A;  2EDZ A;  1YBO A;  1RY4 A;  4WYU A;  1UEP A;  3LNY A;  2L4S A;  1IU2 A;  2LOB A;  2V90 A;  3VQG A;  3O46 A;  3PV2 A;  2OSG A;  2L4T A;  2JXO A;  2I0L A;  3PV5 A;  1QLC A;  4NNM A;  3QJM A;  4N6X A;  1VAE A;  3DIW A;  1VJ6 A;  3QIK A;  3K82 A;  2EAQ A;  1KEF A;  2BYG A;  3RL8 A;  3PDV A;  2DM8 A;  5EZ0 A;  4Q6H A;  2YUY A;  4IC6 A;  4KFW A;  3R68 A;  4E3B A;  1GM1 A;  2AIN A;  1VA8 A;  1QAV B;  4K78 A;  1VB7 A;  2KJD A;  1OBX A;  2IWO A;  1MFG A;  2JIN A;  5JXB A;  2YTW A;  2K20 A;  4JOF A;  3QJN A;  2AWW A;  5HFB A;  3FY5 A;  2MX6 A;  2RRM A;  3PV4 A;  4Q2P A;  5E6P B;  5HFC A;  2MHO A;  5FB8 C;  1WHA A;  2EDP A;  2W7R A;  2DLU A;  2ZPL A;  2R3Y A;  3KZD A;  1NF3 C;  4NNL A;  1V1T A;  2GZV A;  5G1E A;  2G2L A;  2KJK A;  4K6Y A;  2IWP A;  4JOP A;  5HET A;  5HFF A;  3GCN A;  1OZI A;  1SOZ A;  3ID1 A;  2KA9 A;  2M0Z A;  2H2C A;  2VWR A;  2KOJ A;  2KPL A;  1OBY A;  4JOR A;  1MFL A;  2CSS A;  3KHF A;  2KQF A;  4YDP A;  2HE2 A;  5H3J A;  3EGH C;  5EYZ A;  1FC7 A;  1N6F A; 
#chains in the Genus database with same CATH topology
 1WH1 A;  2PNT A;  1UJV A;  2H2B A;  2JIL A;  3RLE A;  4OEP A;  3I18 A;  4HOP B;  3DJ3 A;  2I6V A;  1Z86 A;  2LA8 A;  4H11 A;  3TSV A;  4L8N A;  2EGO A;  3ZRT A;  2LC7 A;  5D13 A;  3HPM A;  4FGM A;  2D90 A;  2IWQ A;  4O06 A;  2QT5 A;  3VQF A;  4F8K A;  3CBX A;  1X8S A;  3SFJ A;  1WFG A;  1RZX A;  2RCZ A;  2JOA A;  4WYT A;  3QDO A;  1X45 A;  4KFV A;  1P1E A;  4JOH A;  3TSW A;  3CBY A;  3KDG A;  1UEQ A;  2D92 A;  3TMH A;  2FCF A;  1T2M A;  3WKL A;  3DOR A;  2F0A A;  2HE4 A;  2KYL A;  2M0T A;  2O2T A;  3NFK A;  5HFD A;  2IWN A;  2OS6 A;  3QGL A;  4JJ3 A;  1WJL A;  5F3X A;  4NMP A;  4NXQ A;  1R6J A;  1NTE A;  3KDK A;  3ID3 A;  2I0I A;  5HJ1 A;  2M0U A;  5F67 A;  1U38 A;  1ZOK A;  1N6E A;  1SOT A;  1I16 A;  1W9E A;  1WFV A;  4JOE A;  5B6L A;  5HFE A;  2M0V A;  4Q2Q A;  4JL7 A;  2DJT A;  5HF4 A;  3SHU A;  1N99 A;  3CYY A;  1U3B A;  2PDZ A;  2KOM A;  3MH6 A;  4GHN A;  1QAV A;  1V5L A;  2DLS A;  5E1Y A;  4NMR A;  2OMJ A;  4FLN A;  4G69 A;  1FC6 A;  2JRE A;  2YT7 A;  2DAZ A;  4Z33 A;  2ZPM A;  2H3L A;  4OAJ A;  4Q2O A;  2FE5 A;  3HVQ C;  1L6O A;  1UM1 A;  1UM7 A;  4K76 A;  1WI2 A;  4YYX A;  2M10 A;  4GVC A;  2EXG A;  4E35 A;  2EV8 A;  3BPU A;  1RGR A;  1M5Z A;  2HGA A;  3OTP A;  2G5M B;  2Z9I A;  4K72 A;  1Q7X A;  2UZC A;  2P3W A;  1B8Q A;  4JOG A;  4PQW A;  4RI0 A;  3WKM A;  1UJD A;  2V1W A;  5G1D A;  3GAB A;  3HPK A;  3R69 A;  1X6D A;  1WG6 A;  2AWX A;  5B42 A;  2EJY A;  2F5Y A;  1IHJ A;  1MC7 A;  3MH7 A;  3E17 A;  1KWA A;  1N6D A;  1X5R A;  1Y8T A;  1Y7N A;  3DJA A;  1W9Q A;  3RL7 A;  2QKU A;  3SHW A;  2DC2 A;  2I1N A;  1TP3 A;  1UHP A;  3CBZ A;  2OGP A;  2VRF A;  2VZ5 A;  2KBS A;  1QAU A;  2PKT A;  1PDR A;  2EEG A;  2KOH A;  1GQ5 A;  1X5Q A;  4GVD A;  4NXR A;  4P2A B;  2PKU A;  2CSJ A;  5ILB A;  2OZF A;  3GDS A;  1UEW A;  3ID2 A;  4JOJ A;  2I4S A;  2Q9V A;  3LNX A;  5A2P A;  2QKT A;  3OU0 A;  2FNE A;  5E11 A;  1TQ3 A;  2LUI A;  3I1E A;  3SOE A;  5GLJ A;  2K1Z A;  3EGG C;  4NMS A;  1BFE A;  2KPK A;  1N7E A;  1WHD A;  1ZUB A;  3I4W A;  4NXP A;  3DJ1 A;  1P1D A;  2EDV A;  3PS4 A;  4JOK A;  2Z17 A;  3GJ9 A;  3O5N A;  4OEO A;  4Q3H A;  5E21 A;  2D8I A;  4NMQ A;  2OPG A;  3CS0 A;  3L4F D;  3QO6 A;  2KRG A;  1UEZ A;  4NMT A;  1RGW A;  2EHR A;  3JXT A;  5GND A;  1D5G A;  3B76 A;  1UJU A;  2QBW A;  4EDJ A;  3PDZ A;  4Q6S A;  1BE9 A;  2AWU A;  3NFL A;  4NMV A;  1FCF A;  2EEH A;  4UU5 A;  3NGH A;  2DMZ A;  1G9O A;  5DTH A;  1WI4 A;  2I04 A;  1X5N A;  5HDY A;  5FHT A;  2WL7 A;  2YUB A;  5HED A;  4Z8J A;  1UFX A;  2PA1 A;  4MPA A;  1V6B A;  1V62 A;  1TE0 A;  4UU6 A;  1WF7 A;  1XZ9 A;  3K1R A;  5HEB A;  2Q3G A;  3SUZ A;  4AMH A;  2VPH A;  4R2Z A;  2REY A;  1VCW A;  1WIF A;  2QKV A;  2X7Z A;  3GDU A;  2EGK A;  3R0H A;  4LMM A;  1Q3O A;  1K32 A;  3MH4 A;  4P0C A;  3ID4 A;  3GSL A;  2DB5 A;  3K50 A;  1W9O A;  2VSP A;  3AXA A;  2LC6 A;  2M3M A;  3GDV A;  1Q3P A;  1UIT A;  5IL9 A;  5I7Z A;  2EEJ A;  2JIK A;  1IU0 A;  1KY9 A;  2R4H A;  3KZE A;  2OCS A;  3QE1 A;  3STJ A;  2ENO A;  4HOP A;  2H3M A;  2VSV A;  4K75 A;  2W4F A;  1UF1 A;  1OBZ A;  2QG1 A;  2KV8 A;  2CS5 A;  2JWE A;  5E22 A;  2KL1 A;  3GCO A;  2PZD A;  2KJP A;  1X9Z A;  1Z87 A;  5HEY A;  3CC0 A;  1LCY A;  2EGN A;  1WF8 A;  3CH8 A;  1N7F A;  2YT8 A;  2KG2 A;  2OQS A;  1U39 A;  1TP5 A;  1U37 A;  2E7K A;  1N7T A;  2DKR A;  1V5Q A;  1FC9 A;  2KAW A;  5HF1 A;  2FN5 A;  3TSZ A;  2EEI A;  2JSN A;  1GQ4 A;  4REY A;  4E34 A;  2L97 A;  4NMO A;  3GGE A;  4Q2N A;  1I92 A;  4XHV A;  2EDZ A;  1YBO A;  1RY4 A;  4WYU A;  3NCV A;  1UEP A;  3LNY A;  2L4S A;  1IU2 A;  2LOB A;  2V90 A;  3VQG A;  3O46 A;  3PV2 A;  2OSG A;  2L4T A;  2JXO A;  2I0L A;  3PV5 A;  1QLC A;  4NNM A;  3QJM A;  4N6X A;  1VAE A;  3DIW A;  1VJ6 A;  3QIK A;  3K82 A;  2EAQ A;  1KEF A;  2BYG A;  3RL8 A;  3PDV A;  2DM8 A;  5EZ0 A;  4Q6H A;  2YUY A;  4IC6 A;  4KFW A;  3R68 A;  4E3B A;  1GM1 A;  2AIN A;  1VA8 A;  1QAV B;  4K78 A;  1VB7 A;  2KJD A;  1OBX A;  2IWO A;  1MFG A;  2JIN A;  5JXB A;  2YTW A;  2K20 A;  4JOF A;  3QJN A;  2AWW A;  5HFB A;  3FY5 A;  2MX6 A;  2RRM A;  3PV4 A;  4Q2P A;  5E6P B;  5HFC A;  2MHO A;  5FB8 C;  1WHA A;  2EDP A;  2W7R A;  2DLU A;  2ZPL A;  2R3Y A;  3KZD A;  1NF3 C;  4NNL A;  1V1T A;  2GZV A;  5G1E A;  2G2L A;  2KJK A;  4K6Y A;  2IWP A;  4JOP A;  5HET A;  5HFF A;  3GCN A;  1OZI A;  1SOZ A;  3ID1 A;  2KA9 A;  2M0Z A;  2H2C A;  2VWR A;  2KOJ A;  2GEF A;  2KPL A;  1OBY A;  4JOR A;  1MFL A;  2CSS A;  3KHF A;  2KQF A;  4YDP A;  4JJ0 A;  2HE2 A;  5H3J A;  3EGH C;  5EYZ A;  1FC7 A;  1N6F A; 
#chains in the Genus database with same CATH homology
 1WH1 A;  2PNT A;  1UJV A;  2H2B A;  2JIL A;  3RLE A;  4OEP A;  3I18 A;  4HOP B;  3DJ3 A;  2I6V A;  1Z86 A;  2LA8 A;  4H11 A;  3TSV A;  4L8N A;  2EGO A;  3ZRT A;  2LC7 A;  5D13 A;  3HPM A;  4FGM A;  2D90 A;  2IWQ A;  4O06 A;  2QT5 A;  3VQF A;  4F8K A;  3CBX A;  1X8S A;  3SFJ A;  1WFG A;  1RZX A;  2RCZ A;  2JOA A;  4WYT A;  3QDO A;  1X45 A;  4KFV A;  1P1E A;  4JOH A;  3TSW A;  3CBY A;  3KDG A;  1UEQ A;  2D92 A;  3TMH A;  2FCF A;  1T2M A;  3WKL A;  3DOR A;  2F0A A;  2HE4 A;  2KYL A;  2M0T A;  2O2T A;  3NFK A;  5HFD A;  2IWN A;  2OS6 A;  3QGL A;  4JJ3 A;  1WJL A;  5F3X A;  4NMP A;  4NXQ A;  1R6J A;  1NTE A;  3KDK A;  3ID3 A;  2I0I A;  5HJ1 A;  2M0U A;  5F67 A;  1U38 A;  1ZOK A;  1N6E A;  1SOT A;  1I16 A;  1W9E A;  1WFV A;  4JOE A;  5B6L A;  5HFE A;  2M0V A;  4Q2Q A;  4JL7 A;  2DJT A;  5HF4 A;  3SHU A;  1N99 A;  3CYY A;  1U3B A;  2PDZ A;  2KOM A;  3MH6 A;  4GHN A;  1QAV A;  1V5L A;  2DLS A;  5E1Y A;  4NMR A;  2OMJ A;  4FLN A;  4G69 A;  1FC6 A;  2JRE A;  2YT7 A;  2DAZ A;  4Z33 A;  2ZPM A;  2H3L A;  4OAJ A;  4Q2O A;  2FE5 A;  3HVQ C;  1L6O A;  1UM1 A;  1UM7 A;  4K76 A;  1WI2 A;  4YYX A;  2M10 A;  4GVC A;  2EXG A;  4E35 A;  2EV8 A;  3BPU A;  1RGR A;  1M5Z A;  2HGA A;  3OTP A;  2G5M B;  2Z9I A;  4K72 A;  1Q7X A;  2UZC A;  2P3W A;  1B8Q A;  4JOG A;  4PQW A;  4RI0 A;  3WKM A;  1UJD A;  2V1W A;  5G1D A;  3GAB A;  3HPK A;  3R69 A;  1X6D A;  1WG6 A;  2AWX A;  5B42 A;  2EJY A;  2F5Y A;  1IHJ A;  1MC7 A;  3MH7 A;  3E17 A;  1KWA A;  1N6D A;  1X5R A;  1Y8T A;  1Y7N A;  3DJA A;  1W9Q A;  3RL7 A;  2QKU A;  3SHW A;  2DC2 A;  2I1N A;  1TP3 A;  1UHP A;  3CBZ A;  2OGP A;  2VRF A;  2VZ5 A;  2KBS A;  1QAU A;  2PKT A;  1PDR A;  2EEG A;  2KOH A;  1GQ5 A;  1X5Q A;  4GVD A;  4NXR A;  4P2A B;  2PKU A;  2CSJ A;  5ILB A;  2OZF A;  3GDS A;  1UEW A;  3ID2 A;  4JOJ A;  2I4S A;  2Q9V A;  3LNX A;  5A2P A;  2QKT A;  3OU0 A;  2FNE A;  5E11 A;  1TQ3 A;  2LUI A;  3I1E A;  3SOE A;  5GLJ A;  2K1Z A;  3EGG C;  4NMS A;  1BFE A;  2KPK A;  1N7E A;  1WHD A;  1ZUB A;  3I4W A;  4NXP A;  3DJ1 A;  1P1D A;  2EDV A;  3PS4 A;  4JOK A;  2Z17 A;  3GJ9 A;  3O5N A;  4OEO A;  4Q3H A;  5E21 A;  2D8I A;  4NMQ A;  2OPG A;  3CS0 A;  3L4F D;  3QO6 A;  2KRG A;  1UEZ A;  4NMT A;  1RGW A;  2EHR A;  3JXT A;  5GND A;  1D5G A;  3B76 A;  1UJU A;  2QBW A;  4EDJ A;  3PDZ A;  4Q6S A;  1BE9 A;  2AWU A;  3NFL A;  4NMV A;  1FCF A;  2EEH A;  4UU5 A;  3NGH A;  2DMZ A;  1G9O A;  5DTH A;  1WI4 A;  2I04 A;  1X5N A;  5HDY A;  5FHT A;  2WL7 A;  2YUB A;  5HED A;  4Z8J A;  1UFX A;  2PA1 A;  4MPA A;  1V6B A;  1V62 A;  1TE0 A;  4UU6 A;  1WF7 A;  1XZ9 A;  3K1R A;  5HEB A;  2Q3G A;  3SUZ A;  4AMH A;  2VPH A;  4R2Z A;  2REY A;  1VCW A;  1WIF A;  2QKV A;  2X7Z A;  3GDU A;  2EGK A;  3R0H A;  4LMM A;  1Q3O A;  1K32 A;  3MH4 A;  4P0C A;  3ID4 A;  3GSL A;  2DB5 A;  3K50 A;  1W9O A;  2VSP A;  3AXA A;  2LC6 A;  2M3M A;  3GDV A;  1Q3P A;  1UIT A;  5IL9 A;  5I7Z A;  2EEJ A;  2JIK A;  1IU0 A;  1KY9 A;  2R4H A;  3KZE A;  2OCS A;  3QE1 A;  3STJ A;  2ENO A;  4HOP A;  2H3M A;  2VSV A;  4K75 A;  2W4F A;  1UF1 A;  1OBZ A;  2QG1 A;  2KV8 A;  2CS5 A;  2JWE A;  5E22 A;  2KL1 A;  3GCO A;  2PZD A;  2KJP A;  1X9Z A;  1Z87 A;  5HEY A;  3CC0 A;  1LCY A;  2EGN A;  1WF8 A;  3CH8 A;  1N7F A;  2YT8 A;  2KG2 A;  2OQS A;  1U39 A;  1TP5 A;  1U37 A;  2E7K A;  1N7T A;  2DKR A;  1V5Q A;  1FC9 A;  2KAW A;  5HF1 A;  2FN5 A;  3TSZ A;  2EEI A;  2JSN A;  1GQ4 A;  4REY A;  4E34 A;  2L97 A;  4NMO A;  3GGE A;  4Q2N A;  1I92 A;  4XHV A;  2EDZ A;  1YBO A;  1RY4 A;  4WYU A;  3NCV A;  1UEP A;  3LNY A;  2L4S A;  1IU2 A;  2LOB A;  2V90 A;  3VQG A;  3O46 A;  3PV2 A;  2OSG A;  2L4T A;  2JXO A;  2I0L A;  3PV5 A;  1QLC A;  4NNM A;  3QJM A;  4N6X A;  1VAE A;  3DIW A;  1VJ6 A;  3QIK A;  3K82 A;  2EAQ A;  1KEF A;  2BYG A;  3RL8 A;  3PDV A;  2DM8 A;  5EZ0 A;  4Q6H A;  2YUY A;  4IC6 A;  4KFW A;  3R68 A;  4E3B A;  1GM1 A;  2AIN A;  1VA8 A;  1QAV B;  4K78 A;  1VB7 A;  2KJD A;  1OBX A;  2IWO A;  1MFG A;  2JIN A;  5JXB A;  2YTW A;  2K20 A;  4JOF A;  3QJN A;  2AWW A;  5HFB A;  3FY5 A;  2MX6 A;  2RRM A;  3PV4 A;  4Q2P A;  5E6P B;  5HFC A;  2MHO A;  5FB8 C;  1WHA A;  2EDP A;  2W7R A;  2DLU A;  2ZPL A;  2R3Y A;  3KZD A;  1NF3 C;  4NNL A;  1V1T A;  2GZV A;  5G1E A;  2G2L A;  2KJK A;  4K6Y A;  2IWP A;  4JOP A;  5HET A;  5HFF A;  3GCN A;  1OZI A;  1SOZ A;  3ID1 A;  2KA9 A;  2M0Z A;  2H2C A;  2VWR A;  2KOJ A;  2GEF A;  2KPL A;  1OBY A;  4JOR A;  1MFL A;  2CSS A;  3KHF A;  2KQF A;  4YDP A;  4JJ0 A;  2HE2 A;  5H3J A;  3EGH C;  5EYZ A;  1FC7 A;  1N6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...