4NMRA

Cftr associated ligand (cal) pdz domain bound to peptide ical36(ac-k-5) (ansr[ac-k]ptsii)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
87
structure length
87
Chain Sequence
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Chemically Modified Peptide Scaffolds Target the CFTR-Associated Ligand PDZ Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 22
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4nmrA00
2D8IA 4JOJA 4Q6SA 4R2ZA 2R4HA 1UJVA 3OTPA 1VCWA 3PV5A 1R6JA 3SOEA 5E22A 1Y7NA 2EDZA 3DJAA 1WG6A 1X8SA 1WI2A 2JILA 4FGMA 2MX6A 2H2CA 4GHNA 4H11A 1N6DA 2KJDA 3GCOA 3HVQC 3K50A 3L4FD 2IWQA 1QLCA 2VZ5A 1M5ZA 2JIKA 2PKUA 3DIWA 4K78A 3GJ9A 1G9OA 2EJYA 2KV8A 5HFDA 3SHUA 1V1TA 4GVCA 3CH8A 1UM1A 1I16A 1ZUBA 4UU6A 2QT5A 1WJLA 2LOBA 5HFCA 3K1RA 1UEPA 3CBYA 4K75A 1TE0A 5G1DA 5D13A 1P1EA 5H3JA 5F67A 3TSZA 5A2PA 1N99A 2M0ZA 5HETA 5I7ZA 1MC7A 3QE1A 4N6XA 2F0AA 5JXBA 4NNMA 1MFLA 5EYZA 2RCZA 1IHJA 1N6EA 2HE4A 4NMQA 3EGGC 1WI4A 5E21A 2EHRA 1PDRA 1KEFA 1N7TA 2LA8A 5HDYA 1I92A 1VB7A 2KPKA 2X7ZA 1W9OA 2EGNA 5G1EA 2PNTA 2QG1A 2QKUA 1MFGA 4AMHA 2I0IA 2OZFA 3PDZA 3QJNA 1FC7A 3ID1A 5GLJA 2D92A 3VQGA 2EDVA 2Q9VA 2W4FA 2KOMA 2JWEA 2ZPMA 4E3BA 4P0CA 1X45A 3BPUA 2Z17A 1Z87A 2FNEA 3O5NA 1SOTA 2KL1A 2EGOA 5HF1A 2VWRA 4NMTA 1VAEA 4KFWA 3RLEA 1GM1A 3DJ1A 2Z9IA 2EDPA 3SUZA 1GQ4A 3NFKA 4WYTA 3VQFA 1N6FA 3R68A 1X5RA 2O2TA 2IWOA 5E1YA 2I04A 2GZVA 1SOZA 1U37A 4YYXA 1WFGA 4JORA 2YTWA 1FC6A 3KZDA 3GGEA 1RY4A 2EGKA 4O06A 1V5LA 2PA1A 3ZRTA 3E17A 1U3BA 5E6PB 1OBZA 2ZPLA 3CBZA 4JOPA 1N7EA 3PS4A 3QO6A 3STJA 1WFVA 4Q6HA 2EEIA 2K20A 3CS0A 3NGHA 1KY9A 2KA9A 5HJ1A 4E35A 3KHFA 5E11A 2V1WA 2L97A 4NXRA 3PV2A 4JL7A 4XHVA 2LC7A 2OQSA 2DKRA 3CBXA 1WF8A 3DJ3A 2VPHA 3I4WA 3JXTA 2D90A 2OGPA 1IU2A 2KQFA 2KYLA 1RGRA 1L6OA 2W7RA 5DTHA 3QIKA 3CYYA 4Q2NA 4G69A 2JXOA 3QDOA 1VA8A 4JOFA 4JOEA 4F8KA 3NFLA 4YDPA 1UM7A 4NXQA 5F3XA 1V6BA 1UJDA 2CSSA 2I0LA 4OEOA 4NMSA 3I18A 2KJKA 2V90A 2DJTA 4Q2OA 2M10A 2HE2A 2QKTA 5HFFA 3GSLA 1TQ3A 1IU0A 1UITA 2H3LA 4JOGA 3SHWA 1QAVA 2KOHA 1Q3OA 3LNXA 2Q3GA 2KOJA 2VSVA 3RL7A 2AINA 1W9EA 2G2LA 1OBXA 1UEQA 4Q2QA 1OBYA 2LC6A 2EEGA 1X6DA 4REYA 3GDSA 5HF4A 4Z33A 3WKLA 2L4TA 3MH4A 2F5YA 4JOHA 4LMMA 3QJMA 4OAJA 3ID3A 1W9QA 4P2AB 1WIFA 4NNLA 2FCFA 2KAWA 5HEBA 5HEYA 3QGLA 4NMPA 2H2BA 3R0HA 2DLUA 3RL8A 2PZDA 1KWAA 1BE9A 1U39A 2L4SA 3KZEA 1X5NA 2YT8A 3R69A 5HEDA 1T2MA 2UZCA 2DB5A 2ENOA 4WYUA 1UF1A 4NXPA 3FY5A 2DLSA 3WKMA 2EEJA 1OZIA 1UHPA 1N7FA 2RRMA 1RGWA 5FHTA 1QAVB 2CSJA 1FCFA 3TSWA 2H3MA 3CC0A 5B6LA 2E7KA 2JOAA 1UEZA 1Q3PA 1YBOA 5HFBA 4NMOA 2AWUA 1NTEA 3AXAA 2OPGA 1UFXA 4K76A 4Z8JA 2IWPA 2M0UA 1FC9A 2PKTA 3TMHA 3PV4A 2KJPA 1U38A 1P1DA 1Y8TA 1ZOKA 4L8NA 3TSVA 4MPAA 2P3WA 1B8QA 2M0TA 4OEPA 1Q7XA 1BFEA 2MHOA 1UJUA 4NMRA 1NF3C 2I1NA 1XZ9A 2KBSA 4KFVA 3DORA 2YUBA 2G5MB 2FE5A 2OS6A 2OMJA 1Z86A 2VRFA 2YUYA 5FB8C 1D5GA 3HPKA 3I1EA 4Q3HA 2EV8A 2M3MA 4HOPA 2LUIA 3K82A 2K1ZA 2QBWA 1LCYA 2I6VA 1V62A 2EEHA 4E34A 2EAQA 2DMZA 3MH6A 2R3YA 4K72A 4RI0A 3EGHC 2KG2A 4K6YA 3HPMA 1UEWA 1X5QA 3OU0A 2CS5A 2JINA 2PDZA 2FN5A 4UU5A 2DM8A 3O46A 5GNDA 2IWNA 2KPLA 2I4SA 1QAUA 1V5QA 4EDJA 3MH7A 4IC6A 1K32A 2VSPA 2DC2A 3GDUA 3ID4A 4HOPB 2WL7A 5EZ0A 2HGAA 2KRGA 2REYA 2QKVA 4PQWA 5HFEA 1WHDA 2DAZA 1RZXA 1WHAA 2AWXA 1TP3A 2BYGA 2OCSA 2AWWA 4JOKA 3PDVA 1WH1A 4NMVA 2EXGA 1WF7A 4GVDA 2JREA 1TP5A 1GQ5A 2OSGA 3ID2A 3B76A 3LNYA 2M0VA 2YT7A 3GDVA 3SFJA 1VJ6A 3GCNA 4Q2PA
chains in the Genus database with same CATH superfamily
2D8IA 4JOJA 4Q6SA 4R2ZA 2R4HA 1UJVA 3OTPA 1VCWA 3PV5A 1R6JA 3SOEA 5E22A 1Y7NA 2EDZA 3DJAA 1WG6A 1X8SA 1WI2A 2JILA 4FGMA 4JJ0A 2MX6A 2H2CA 4GHNA 4H11A 1N6DA 2KJDA 3GCOA 3HVQC 3K50A 3L4FD 2IWQA 1QLCA 2VZ5A 1M5ZA 2JIKA 2PKUA 3DIWA 4K78A 3GJ9A 1G9OA 2EJYA 2KV8A 2GEFA 5HFDA 3SHUA 1V1TA 4GVCA 3CH8A 1UM1A 1I16A 1ZUBA 4UU6A 2QT5A 1WJLA 2LOBA 5HFCA 3K1RA 1UEPA 3CBYA 4K75A 1TE0A 5G1DA 5D13A 1P1EA 5H3JA 5F67A 3TSZA 5A2PA 1N99A 2M0ZA 5HETA 5I7ZA 1MC7A 3QE1A 4N6XA 2F0AA 5JXBA 4NNMA 1MFLA 5EYZA 2RCZA 1IHJA 1N6EA 2HE4A 4NMQA 3EGGC 1WI4A 5E21A 2EHRA 1PDRA 1KEFA 1N7TA 2LA8A 5HDYA 1I92A 1VB7A 2KPKA 2X7ZA 1W9OA 2EGNA 5G1EA 2PNTA 4FLNA 2QG1A 2QKUA 1MFGA 4AMHA 2I0IA 2OZFA 3KDKA 3PDZA 3QJNA 1FC7A 3ID1A 5GLJA 2D92A 3VQGA 2EDVA 2Q9VA 2W4FA 2KOMA 2JWEA 2ZPMA 4E3BA 4P0CA 1X45A 3BPUA 2Z17A 1Z87A 2FNEA 3O5NA 1SOTA 2KL1A 2EGOA 5HF1A 2VWRA 4NMTA 1VAEA 4KFWA 3RLEA 1GM1A 3DJ1A 2Z9IA 2EDPA 3SUZA 1GQ4A 3NFKA 4WYTA 3VQFA 1N6FA 3R68A 1X5RA 2O2TA 2IWOA 5E1YA 2I04A 2GZVA 1SOZA 1U37A 4YYXA 1WFGA 4JORA 2YTWA 5B42A 1FC6A 3KZDA 3GGEA 1RY4A 2EGKA 4O06A 1V5LA 2PA1A 3ZRTA 3E17A 1U3BA 5E6PB 1OBZA 2ZPLA 3CBZA 5IL9A 4JOPA 1N7EA 3PS4A 3QO6A 3STJA 1WFVA 4Q6HA 2EEIA 2K20A 3CS0A 3NGHA 1KY9A 2KA9A 5HJ1A 4E35A 3KHFA 5E11A 2V1WA 2L97A 4NXRA 3PV2A 4JL7A 4XHVA 2LC7A 2OQSA 2DKRA 3CBXA 1WF8A 3DJ3A 2VPHA 3I4WA 3JXTA 2D90A 2OGPA 1IU2A 2KQFA 2KYLA 1RGRA 3GABA 1L6OA 2W7RA 5DTHA 3QIKA 3CYYA 4Q2NA 4G69A 2JXOA 3QDOA 1VA8A 4JOFA 4JOEA 4F8KA 3NFLA 4YDPA 1UM7A 4NXQA 5F3XA 1V6BA 1UJDA 2CSSA 2I0LA 4OEOA 4NMSA 3I18A 2KJKA 2V90A 2DJTA 4Q2OA 2M10A 2HE2A 2QKTA 5HFFA 3GSLA 1TQ3A 1IU0A 1UITA 2H3LA 4JOGA 3SHWA 1QAVA 1X9ZA 2KOHA 1Q3OA 3LNXA 2Q3GA 2KOJA 2VSVA 3RL7A 2AINA 1W9EA 2G2LA 1OBXA 1UEQA 4Q2QA 1OBYA 2LC6A 2EEGA 1X6DA 4REYA 3GDSA 5HF4A 4Z33A 3WKLA 2L4TA 3MH4A 2F5YA 4JOHA 4LMMA 2JSNA 3QJMA 4OAJA 3ID3A 1W9QA 4P2AB 1WIFA 4NNLA 2FCFA 2KAWA 5HEBA 5HEYA 3QGLA 4NMPA 2H2BA 3R0HA 2DLUA 3RL8A 2PZDA 1KWAA 1BE9A 1U39A 2L4SA 3KZEA 1X5NA 2YT8A 3R69A 5HEDA 1T2MA 2UZCA 2DB5A 2ENOA 4WYUA 1UF1A 4NXPA 3FY5A 2DLSA 3WKMA 2EEJA 1OZIA 1UHPA 1N7FA 2RRMA 1RGWA 5FHTA 1QAVB 2CSJA 1FCFA 3TSWA 2H3MA 3CC0A 5B6LA 2E7KA 2JOAA 1UEZA 1Q3PA 1YBOA 5HFBA 4NMOA 2AWUA 1NTEA 3AXAA 2OPGA 1UFXA 4K76A 4Z8JA 2IWPA 2M0UA 1FC9A 2PKTA 3TMHA 3PV4A 2KJPA 1U38A 1P1DA 5ILBA 1Y8TA 1ZOKA 3KDGA 4L8NA 3TSVA 4MPAA 2P3WA 1B8QA 2M0TA 4OEPA 1Q7XA 1BFEA 2MHOA 1UJUA 4NMRA 1NF3C 2I1NA 1XZ9A 2KBSA 4KFVA 3DORA 2YUBA 2G5MB 2FE5A 2OS6A 2OMJA 1Z86A 2VRFA 2YUYA 5FB8C 1D5GA 3HPKA 3I1EA 4Q3HA 2EV8A 2M3MA 4HOPA 2LUIA 3K82A 2K1ZA 2QBWA 1LCYA 2I6VA 1V62A 2EEHA 4E34A 2EAQA 2DMZA 3MH6A 2R3YA 4K72A 4RI0A 3EGHC 2KG2A 4K6YA 3HPMA 1UEWA 1X5QA 3OU0A 2CS5A 2JINA 2PDZA 2FN5A 4UU5A 2DM8A 3O46A 5GNDA 2IWNA 2KPLA 2I4SA 1QAUA 1V5QA 4EDJA 3MH7A 4IC6A 1K32A 2VSPA 2DC2A 3GDUA 3ID4A 4HOPB 2WL7A 5EZ0A 2HGAA 2KRGA 2REYA 2QKVA 4PQWA 5HFEA 1WHDA 3NCVA 2DAZA 1RZXA 1WHAA 2AWXA 1TP3A 2BYGA 2OCSA 2AWWA 4JJ3A 4JOKA 3PDVA 1WH1A 4NMVA 2EXGA 1WF7A 4GVDA 2JREA 1TP5A 1GQ5A 2OSGA 3ID2A 3B76A 3LNYA 2M0VA 2YT7A 3GDVA 3SFJA 1VJ6A 3GCNA 4Q2PA
chains in the Genus database with same CATH topology
2D8IA 4JOJA 4Q6SA 4R2ZA 2R4HA 1UJVA 3OTPA 1VCWA 3PV5A 1R6JA 3SOEA 5E22A 1Y7NA 2EDZA 3DJAA 1WG6A 1X8SA 1WI2A 2JILA 4FGMA 4JJ0A 2MX6A 2H2CA 4GHNA 4H11A 1N6DA 2KJDA 3GCOA 3HVQC 3K50A 3L4FD 2IWQA 1QLCA 2VZ5A 1M5ZA 2JIKA 2PKUA 3DIWA 4K78A 3GJ9A 1G9OA 2EJYA 2KV8A 2GEFA 5HFDA 3SHUA 1V1TA 4GVCA 3CH8A 1UM1A 1I16A 1ZUBA 4UU6A 2QT5A 1WJLA 2LOBA 5HFCA 3K1RA 1UEPA 3CBYA 4K75A 1TE0A 5G1DA 5D13A 1P1EA 5H3JA 5F67A 3TSZA 5A2PA 1N99A 2M0ZA 5HETA 5I7ZA 1MC7A 3QE1A 4N6XA 2F0AA 5JXBA 4NNMA 1MFLA 5EYZA 2RCZA 1IHJA 1N6EA 2HE4A 4NMQA 3EGGC 1WI4A 5E21A 2EHRA 1PDRA 1KEFA 1N7TA 2LA8A 5HDYA 1I92A 1VB7A 2KPKA 2X7ZA 1W9OA 2EGNA 5G1EA 2PNTA 4FLNA 2QG1A 2QKUA 1MFGA 4AMHA 2I0IA 2OZFA 3KDKA 3PDZA 3QJNA 1FC7A 3ID1A 5GLJA 2D92A 3VQGA 2EDVA 2Q9VA 2W4FA 2KOMA 2JWEA 2ZPMA 4E3BA 4P0CA 1X45A 3BPUA 2Z17A 1Z87A 2FNEA 3O5NA 1SOTA 2KL1A 2EGOA 5HF1A 2VWRA 4NMTA 1VAEA 4KFWA 3RLEA 1GM1A 3DJ1A 2Z9IA 2EDPA 3SUZA 1GQ4A 3NFKA 4WYTA 3VQFA 1N6FA 3R68A 1X5RA 2O2TA 2IWOA 5E1YA 2I04A 2GZVA 1SOZA 1U37A 4YYXA 1WFGA 4JORA 2YTWA 5B42A 1FC6A 3KZDA 3GGEA 1RY4A 2EGKA 4O06A 1V5LA 2PA1A 3ZRTA 3E17A 1U3BA 5E6PB 1OBZA 2ZPLA 3CBZA 5IL9A 4JOPA 1N7EA 3PS4A 3QO6A 3STJA 1WFVA 4Q6HA 2EEIA 2K20A 3CS0A 3NGHA 1KY9A 2KA9A 5HJ1A 4E35A 3KHFA 5E11A 2V1WA 2L97A 4NXRA 3PV2A 4JL7A 4XHVA 2LC7A 2OQSA 2DKRA 3CBXA 1WF8A 3DJ3A 2VPHA 3I4WA 3JXTA 2D90A 2OGPA 1IU2A 2KQFA 2KYLA 1RGRA 3GABA 1L6OA 2W7RA 5DTHA 3QIKA 3CYYA 4Q2NA 4G69A 2JXOA 3QDOA 1VA8A 4JOFA 4JOEA 4F8KA 3NFLA 4YDPA 1UM7A 4NXQA 5F3XA 1V6BA 1UJDA 2CSSA 2I0LA 4OEOA 4NMSA 3I18A 2KJKA 2V90A 2DJTA 4Q2OA 2M10A 2HE2A 2QKTA 5HFFA 3GSLA 1TQ3A 1IU0A 1UITA 2H3LA 4JOGA 3SHWA 1QAVA 1X9ZA 2KOHA 1Q3OA 3LNXA 2Q3GA 2KOJA 2VSVA 3RL7A 2AINA 1W9EA 2G2LA 1OBXA 1UEQA 4Q2QA 1OBYA 2LC6A 2EEGA 1X6DA 4REYA 3GDSA 5HF4A 4Z33A 3WKLA 2L4TA 3MH4A 2F5YA 4JOHA 4LMMA 2JSNA 3QJMA 4OAJA 3ID3A 1W9QA 4P2AB 1WIFA 4NNLA 2FCFA 2KAWA 5HEBA 5HEYA 3QGLA 4NMPA 2H2BA 3R0HA 2DLUA 3RL8A 2PZDA 1KWAA 1BE9A 1U39A 2L4SA 3KZEA 1X5NA 2YT8A 3R69A 5HEDA 1T2MA 2UZCA 2DB5A 2ENOA 4WYUA 1UF1A 4NXPA 3FY5A 2DLSA 3WKMA 2EEJA 1OZIA 1UHPA 1N7FA 2RRMA 1RGWA 5FHTA 1QAVB 2CSJA 1FCFA 3TSWA 2H3MA 3CC0A 5B6LA 2E7KA 2JOAA 1UEZA 1Q3PA 1YBOA 5HFBA 4NMOA 2AWUA 1NTEA 3AXAA 2OPGA 1UFXA 4K76A 4Z8JA 2IWPA 2M0UA 1FC9A 2PKTA 3TMHA 3PV4A 2KJPA 1U38A 1P1DA 5ILBA 1Y8TA 1ZOKA 3KDGA 4L8NA 3TSVA 4MPAA 2P3WA 1B8QA 2M0TA 4OEPA 1Q7XA 1BFEA 2MHOA 1UJUA 4NMRA 1NF3C 2I1NA 1XZ9A 2KBSA 4KFVA 3DORA 2YUBA 2G5MB 2FE5A 2OS6A 2OMJA 1Z86A 2VRFA 2YUYA 5FB8C 1D5GA 3HPKA 3I1EA 4Q3HA 2EV8A 2M3MA 4HOPA 2LUIA 3K82A 2K1ZA 2QBWA 1LCYA 2I6VA 1V62A 2EEHA 4E34A 2EAQA 2DMZA 3MH6A 2R3YA 4K72A 4RI0A 3EGHC 2KG2A 4K6YA 3HPMA 1UEWA 1X5QA 3OU0A 2CS5A 2JINA 2PDZA 2FN5A 4UU5A 2DM8A 3O46A 5GNDA 2IWNA 2KPLA 2I4SA 1QAUA 1V5QA 4EDJA 3MH7A 4IC6A 1K32A 2VSPA 2DC2A 3GDUA 3ID4A 4HOPB 2WL7A 5EZ0A 2HGAA 2KRGA 2REYA 2QKVA 4PQWA 5HFEA 1WHDA 3NCVA 2DAZA 1RZXA 1WHAA 2AWXA 1TP3A 2BYGA 2OCSA 2AWWA 4JJ3A 4JOKA 3PDVA 1WH1A 4NMVA 2EXGA 1WF7A 4GVDA 2JREA 1TP5A 1GQ5A 2OSGA 3ID2A 3B76A 3LNYA 2M0VA 2YT7A 3GDVA 3SFJA 1VJ6A 3GCNA 4Q2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8I A;  4JOJ A;  4Q6S A;  4R2Z A;  2R4H A;  1UJV A;  3OTP A;  1VCW A;  3PV5 A;  1R6J A;  3SOE A;  5E22 A;  1Y7N A;  2EDZ A;  3DJA A;  1WG6 A;  1X8S A;  1WI2 A;  2JIL A;  4FGM A;  2MX6 A;  2H2C A;  4GHN A;  4H11 A;  1N6D A;  2KJD A;  3GCO A;  3HVQ C;  3K50 A;  3L4F D;  2IWQ A;  1QLC A;  2VZ5 A;  1M5Z A;  2JIK A;  2PKU A;  3DIW A;  4K78 A;  3GJ9 A;  1G9O A;  2EJY A;  2KV8 A;  5HFD A;  3SHU A;  1V1T A;  4GVC A;  3CH8 A;  1UM1 A;  1I16 A;  1ZUB A;  4UU6 A;  2QT5 A;  1WJL A;  2LOB A;  5HFC A;  3K1R A;  1UEP A;  3CBY A;  4K75 A;  1TE0 A;  5G1D A;  5D13 A;  1P1E A;  5H3J A;  5F67 A;  3TSZ A;  5A2P A;  1N99 A;  2M0Z A;  5HET A;  5I7Z A;  1MC7 A;  3QE1 A;  4N6X A;  2F0A A;  5JXB A;  4NNM A;  1MFL A;  5EYZ A;  2RCZ A;  1IHJ A;  1N6E A;  2HE4 A;  4NMQ A;  3EGG C;  1WI4 A;  5E21 A;  2EHR A;  1PDR A;  1KEF A;  1N7T A;  2LA8 A;  5HDY A;  1I92 A;  1VB7 A;  2KPK A;  2X7Z A;  1W9O A;  2EGN A;  5G1E A;  2PNT A;  2QG1 A;  2QKU A;  1MFG A;  4AMH A;  2I0I A;  2OZF A;  3PDZ A;  3QJN A;  1FC7 A;  3ID1 A;  5GLJ A;  2D92 A;  3VQG A;  2EDV A;  2Q9V A;  2W4F A;  2KOM A;  2JWE A;  2ZPM A;  4E3B A;  4P0C A;  1X45 A;  3BPU A;  2Z17 A;  1Z87 A;  2FNE A;  3O5N A;  1SOT A;  2KL1 A;  2EGO A;  5HF1 A;  2VWR A;  4NMT A;  1VAE A;  4KFW A;  3RLE A;  1GM1 A;  3DJ1 A;  2Z9I A;  2EDP A;  3SUZ A;  1GQ4 A;  3NFK A;  4WYT A;  3VQF A;  1N6F A;  3R68 A;  1X5R A;  2O2T A;  2IWO A;  5E1Y A;  2I04 A;  2GZV A;  1SOZ A;  1U37 A;  4YYX A;  1WFG A;  4JOR A;  2YTW A;  1FC6 A;  3KZD A;  3GGE A;  1RY4 A;  2EGK A;  4O06 A;  1V5L A;  2PA1 A;  3ZRT A;  3E17 A;  1U3B A;  5E6P B;  1OBZ A;  2ZPL A;  3CBZ A;  4JOP A;  1N7E A;  3PS4 A;  3QO6 A;  3STJ A;  1WFV A;  4Q6H A;  2EEI A;  2K20 A;  3CS0 A;  3NGH A;  1KY9 A;  2KA9 A;  5HJ1 A;  4E35 A;  3KHF A;  5E11 A;  2V1W A;  2L97 A;  4NXR A;  3PV2 A;  4JL7 A;  4XHV A;  2LC7 A;  2OQS A;  2DKR A;  3CBX A;  1WF8 A;  3DJ3 A;  2VPH A;  3I4W A;  3JXT A;  2D90 A;  2OGP A;  1IU2 A;  2KQF A;  2KYL A;  1RGR A;  1L6O A;  2W7R A;  5DTH A;  3QIK A;  3CYY A;  4Q2N A;  4G69 A;  2JXO A;  3QDO A;  1VA8 A;  4JOF A;  4JOE A;  4F8K A;  3NFL A;  4YDP A;  1UM7 A;  4NXQ A;  5F3X A;  1V6B A;  1UJD A;  2CSS A;  2I0L A;  4OEO A;  4NMS A;  3I18 A;  2KJK A;  2V90 A;  2DJT A;  4Q2O A;  2M10 A;  2HE2 A;  2QKT A;  5HFF A;  3GSL A;  1TQ3 A;  1IU0 A;  1UIT A;  2H3L A;  4JOG A;  3SHW A;  1QAV A;  2KOH A;  1Q3O A;  3LNX A;  2Q3G A;  2KOJ A;  2VSV A;  3RL7 A;  2AIN A;  1W9E A;  2G2L A;  1OBX A;  1UEQ A;  4Q2Q A;  1OBY A;  2LC6 A;  2EEG A;  1X6D A;  4REY A;  3GDS A;  5HF4 A;  4Z33 A;  3WKL A;  2L4T A;  3MH4 A;  2F5Y A;  4JOH A;  4LMM A;  3QJM A;  4OAJ A;  3ID3 A;  1W9Q A;  4P2A B;  1WIF A;  4NNL A;  2FCF A;  2KAW A;  5HEB A;  5HEY A;  3QGL A;  4NMP A;  2H2B A;  3R0H A;  2DLU A;  3RL8 A;  2PZD A;  1KWA A;  1BE9 A;  1U39 A;  2L4S A;  3KZE A;  1X5N A;  2YT8 A;  3R69 A;  5HED A;  1T2M A;  2UZC A;  2DB5 A;  2ENO A;  4WYU A;  1UF1 A;  4NXP A;  3FY5 A;  2DLS A;  3WKM A;  2EEJ A;  1OZI A;  1UHP A;  1N7F A;  2RRM A;  1RGW A;  5FHT A;  1QAV B;  2CSJ A;  1FCF A;  3TSW A;  2H3M A;  3CC0 A;  5B6L A;  2E7K A;  2JOA A;  1UEZ A;  1Q3P A;  1YBO A;  5HFB A;  4NMO A;  2AWU A;  1NTE A;  3AXA A;  2OPG A;  1UFX A;  4K76 A;  4Z8J A;  2IWP A;  2M0U A;  1FC9 A;  2PKT A;  3TMH A;  3PV4 A;  2KJP A;  1U38 A;  1P1D A;  1Y8T A;  1ZOK A;  4L8N A;  3TSV A;  4MPA A;  2P3W A;  1B8Q A;  2M0T A;  4OEP A;  1Q7X A;  1BFE A;  2MHO A;  1UJU A;  4NMR A;  1NF3 C;  2I1N A;  1XZ9 A;  2KBS A;  4KFV A;  3DOR A;  2YUB A;  2G5M B;  2FE5 A;  2OS6 A;  2OMJ A;  1Z86 A;  2VRF A;  2YUY A;  5FB8 C;  1D5G A;  3HPK A;  3I1E A;  4Q3H A;  2EV8 A;  2M3M A;  4HOP A;  2LUI A;  3K82 A;  2K1Z A;  2QBW A;  1LCY A;  2I6V A;  1V62 A;  2EEH A;  4E34 A;  2EAQ A;  2DMZ A;  3MH6 A;  2R3Y A;  4K72 A;  4RI0 A;  3EGH C;  2KG2 A;  4K6Y A;  3HPM A;  1UEW A;  1X5Q A;  3OU0 A;  2CS5 A;  2JIN A;  2PDZ A;  2FN5 A;  4UU5 A;  2DM8 A;  3O46 A;  5GND A;  2IWN A;  2KPL A;  2I4S A;  1QAU A;  1V5Q A;  4EDJ A;  3MH7 A;  4IC6 A;  1K32 A;  2VSP A;  2DC2 A;  3GDU A;  3ID4 A;  4HOP B;  2WL7 A;  5EZ0 A;  2HGA A;  2KRG A;  2REY A;  2QKV A;  4PQW A;  5HFE A;  1WHD A;  2DAZ A;  1RZX A;  1WHA A;  2AWX A;  1TP3 A;  2BYG A;  2OCS A;  2AWW A;  4JOK A;  3PDV A;  1WH1 A;  4NMV A;  2EXG A;  1WF7 A;  4GVD A;  2JRE A;  1TP5 A;  1GQ5 A;  2OSG A;  3ID2 A;  3B76 A;  3LNY A;  2M0V A;  2YT7 A;  3GDV A;  3SFJ A;  1VJ6 A;  3GCN A;  4Q2P A; 
#chains in the Genus database with same CATH topology
 2D8I A;  4JOJ A;  4Q6S A;  4R2Z A;  2R4H A;  1UJV A;  3OTP A;  1VCW A;  3PV5 A;  1R6J A;  3SOE A;  5E22 A;  1Y7N A;  2EDZ A;  3DJA A;  1WG6 A;  1X8S A;  1WI2 A;  2JIL A;  4FGM A;  4JJ0 A;  2MX6 A;  2H2C A;  4GHN A;  4H11 A;  1N6D A;  2KJD A;  3GCO A;  3HVQ C;  3K50 A;  3L4F D;  2IWQ A;  1QLC A;  2VZ5 A;  1M5Z A;  2JIK A;  2PKU A;  3DIW A;  4K78 A;  3GJ9 A;  1G9O A;  2EJY A;  2KV8 A;  2GEF A;  5HFD A;  3SHU A;  1V1T A;  4GVC A;  3CH8 A;  1UM1 A;  1I16 A;  1ZUB A;  4UU6 A;  2QT5 A;  1WJL A;  2LOB A;  5HFC A;  3K1R A;  1UEP A;  3CBY A;  4K75 A;  1TE0 A;  5G1D A;  5D13 A;  1P1E A;  5H3J A;  5F67 A;  3TSZ A;  5A2P A;  1N99 A;  2M0Z A;  5HET A;  5I7Z A;  1MC7 A;  3QE1 A;  4N6X A;  2F0A A;  5JXB A;  4NNM A;  1MFL A;  5EYZ A;  2RCZ A;  1IHJ A;  1N6E A;  2HE4 A;  4NMQ A;  3EGG C;  1WI4 A;  5E21 A;  2EHR A;  1PDR A;  1KEF A;  1N7T A;  2LA8 A;  5HDY A;  1I92 A;  1VB7 A;  2KPK A;  2X7Z A;  1W9O A;  2EGN A;  5G1E A;  2PNT A;  4FLN A;  2QG1 A;  2QKU A;  1MFG A;  4AMH A;  2I0I A;  2OZF A;  3KDK A;  3PDZ A;  3QJN A;  1FC7 A;  3ID1 A;  5GLJ A;  2D92 A;  3VQG A;  2EDV A;  2Q9V A;  2W4F A;  2KOM A;  2JWE A;  2ZPM A;  4E3B A;  4P0C A;  1X45 A;  3BPU A;  2Z17 A;  1Z87 A;  2FNE A;  3O5N A;  1SOT A;  2KL1 A;  2EGO A;  5HF1 A;  2VWR A;  4NMT A;  1VAE A;  4KFW A;  3RLE A;  1GM1 A;  3DJ1 A;  2Z9I A;  2EDP A;  3SUZ A;  1GQ4 A;  3NFK A;  4WYT A;  3VQF A;  1N6F A;  3R68 A;  1X5R A;  2O2T A;  2IWO A;  5E1Y A;  2I04 A;  2GZV A;  1SOZ A;  1U37 A;  4YYX A;  1WFG A;  4JOR A;  2YTW A;  5B42 A;  1FC6 A;  3KZD A;  3GGE A;  1RY4 A;  2EGK A;  4O06 A;  1V5L A;  2PA1 A;  3ZRT A;  3E17 A;  1U3B A;  5E6P B;  1OBZ A;  2ZPL A;  3CBZ A;  5IL9 A;  4JOP A;  1N7E A;  3PS4 A;  3QO6 A;  3STJ A;  1WFV A;  4Q6H A;  2EEI A;  2K20 A;  3CS0 A;  3NGH A;  1KY9 A;  2KA9 A;  5HJ1 A;  4E35 A;  3KHF A;  5E11 A;  2V1W A;  2L97 A;  4NXR A;  3PV2 A;  4JL7 A;  4XHV A;  2LC7 A;  2OQS A;  2DKR A;  3CBX A;  1WF8 A;  3DJ3 A;  2VPH A;  3I4W A;  3JXT A;  2D90 A;  2OGP A;  1IU2 A;  2KQF A;  2KYL A;  1RGR A;  3GAB A;  1L6O A;  2W7R A;  5DTH A;  3QIK A;  3CYY A;  4Q2N A;  4G69 A;  2JXO A;  3QDO A;  1VA8 A;  4JOF A;  4JOE A;  4F8K A;  3NFL A;  4YDP A;  1UM7 A;  4NXQ A;  5F3X A;  1V6B A;  1UJD A;  2CSS A;  2I0L A;  4OEO A;  4NMS A;  3I18 A;  2KJK A;  2V90 A;  2DJT A;  4Q2O A;  2M10 A;  2HE2 A;  2QKT A;  5HFF A;  3GSL A;  1TQ3 A;  1IU0 A;  1UIT A;  2H3L A;  4JOG A;  3SHW A;  1QAV A;  1X9Z A;  2KOH A;  1Q3O A;  3LNX A;  2Q3G A;  2KOJ A;  2VSV A;  3RL7 A;  2AIN A;  1W9E A;  2G2L A;  1OBX A;  1UEQ A;  4Q2Q A;  1OBY A;  2LC6 A;  2EEG A;  1X6D A;  4REY A;  3GDS A;  5HF4 A;  4Z33 A;  3WKL A;  2L4T A;  3MH4 A;  2F5Y A;  4JOH A;  4LMM A;  2JSN A;  3QJM A;  4OAJ A;  3ID3 A;  1W9Q A;  4P2A B;  1WIF A;  4NNL A;  2FCF A;  2KAW A;  5HEB A;  5HEY A;  3QGL A;  4NMP A;  2H2B A;  3R0H A;  2DLU A;  3RL8 A;  2PZD A;  1KWA A;  1BE9 A;  1U39 A;  2L4S A;  3KZE A;  1X5N A;  2YT8 A;  3R69 A;  5HED A;  1T2M A;  2UZC A;  2DB5 A;  2ENO A;  4WYU A;  1UF1 A;  4NXP A;  3FY5 A;  2DLS A;  3WKM A;  2EEJ A;  1OZI A;  1UHP A;  1N7F A;  2RRM A;  1RGW A;  5FHT A;  1QAV B;  2CSJ A;  1FCF A;  3TSW A;  2H3M A;  3CC0 A;  5B6L A;  2E7K A;  2JOA A;  1UEZ A;  1Q3P A;  1YBO A;  5HFB A;  4NMO A;  2AWU A;  1NTE A;  3AXA A;  2OPG A;  1UFX A;  4K76 A;  4Z8J A;  2IWP A;  2M0U A;  1FC9 A;  2PKT A;  3TMH A;  3PV4 A;  2KJP A;  1U38 A;  1P1D A;  5ILB A;  1Y8T A;  1ZOK A;  3KDG A;  4L8N A;  3TSV A;  4MPA A;  2P3W A;  1B8Q A;  2M0T A;  4OEP A;  1Q7X A;  1BFE A;  2MHO A;  1UJU A;  4NMR A;  1NF3 C;  2I1N A;  1XZ9 A;  2KBS A;  4KFV A;  3DOR A;  2YUB A;  2G5M B;  2FE5 A;  2OS6 A;  2OMJ A;  1Z86 A;  2VRF A;  2YUY A;  5FB8 C;  1D5G A;  3HPK A;  3I1E A;  4Q3H A;  2EV8 A;  2M3M A;  4HOP A;  2LUI A;  3K82 A;  2K1Z A;  2QBW A;  1LCY A;  2I6V A;  1V62 A;  2EEH A;  4E34 A;  2EAQ A;  2DMZ A;  3MH6 A;  2R3Y A;  4K72 A;  4RI0 A;  3EGH C;  2KG2 A;  4K6Y A;  3HPM A;  1UEW A;  1X5Q A;  3OU0 A;  2CS5 A;  2JIN A;  2PDZ A;  2FN5 A;  4UU5 A;  2DM8 A;  3O46 A;  5GND A;  2IWN A;  2KPL A;  2I4S A;  1QAU A;  1V5Q A;  4EDJ A;  3MH7 A;  4IC6 A;  1K32 A;  2VSP A;  2DC2 A;  3GDU A;  3ID4 A;  4HOP B;  2WL7 A;  5EZ0 A;  2HGA A;  2KRG A;  2REY A;  2QKV A;  4PQW A;  5HFE A;  1WHD A;  3NCV A;  2DAZ A;  1RZX A;  1WHA A;  2AWX A;  1TP3 A;  2BYG A;  2OCS A;  2AWW A;  4JJ3 A;  4JOK A;  3PDV A;  1WH1 A;  4NMV A;  2EXG A;  1WF7 A;  4GVD A;  2JRE A;  1TP5 A;  1GQ5 A;  2OSG A;  3ID2 A;  3B76 A;  3LNY A;  2M0V A;  2YT7 A;  3GDV A;  3SFJ A;  1VJ6 A;  3GCN A;  4Q2P A; 
#chains in the Genus database with same CATH homology
 2D8I A;  4JOJ A;  4Q6S A;  4R2Z A;  2R4H A;  1UJV A;  3OTP A;  1VCW A;  3PV5 A;  1R6J A;  3SOE A;  5E22 A;  1Y7N A;  2EDZ A;  3DJA A;  1WG6 A;  1X8S A;  1WI2 A;  2JIL A;  4FGM A;  4JJ0 A;  2MX6 A;  2H2C A;  4GHN A;  4H11 A;  1N6D A;  2KJD A;  3GCO A;  3HVQ C;  3K50 A;  3L4F D;  2IWQ A;  1QLC A;  2VZ5 A;  1M5Z A;  2JIK A;  2PKU A;  3DIW A;  4K78 A;  3GJ9 A;  1G9O A;  2EJY A;  2KV8 A;  2GEF A;  5HFD A;  3SHU A;  1V1T A;  4GVC A;  3CH8 A;  1UM1 A;  1I16 A;  1ZUB A;  4UU6 A;  2QT5 A;  1WJL A;  2LOB A;  5HFC A;  3K1R A;  1UEP A;  3CBY A;  4K75 A;  1TE0 A;  5G1D A;  5D13 A;  1P1E A;  5H3J A;  5F67 A;  3TSZ A;  5A2P A;  1N99 A;  2M0Z A;  5HET A;  5I7Z A;  1MC7 A;  3QE1 A;  4N6X A;  2F0A A;  5JXB A;  4NNM A;  1MFL A;  5EYZ A;  2RCZ A;  1IHJ A;  1N6E A;  2HE4 A;  4NMQ A;  3EGG C;  1WI4 A;  5E21 A;  2EHR A;  1PDR A;  1KEF A;  1N7T A;  2LA8 A;  5HDY A;  1I92 A;  1VB7 A;  2KPK A;  2X7Z A;  1W9O A;  2EGN A;  5G1E A;  2PNT A;  4FLN A;  2QG1 A;  2QKU A;  1MFG A;  4AMH A;  2I0I A;  2OZF A;  3KDK A;  3PDZ A;  3QJN A;  1FC7 A;  3ID1 A;  5GLJ A;  2D92 A;  3VQG A;  2EDV A;  2Q9V A;  2W4F A;  2KOM A;  2JWE A;  2ZPM A;  4E3B A;  4P0C A;  1X45 A;  3BPU A;  2Z17 A;  1Z87 A;  2FNE A;  3O5N A;  1SOT A;  2KL1 A;  2EGO A;  5HF1 A;  2VWR A;  4NMT A;  1VAE A;  4KFW A;  3RLE A;  1GM1 A;  3DJ1 A;  2Z9I A;  2EDP A;  3SUZ A;  1GQ4 A;  3NFK A;  4WYT A;  3VQF A;  1N6F A;  3R68 A;  1X5R A;  2O2T A;  2IWO A;  5E1Y A;  2I04 A;  2GZV A;  1SOZ A;  1U37 A;  4YYX A;  1WFG A;  4JOR A;  2YTW A;  5B42 A;  1FC6 A;  3KZD A;  3GGE A;  1RY4 A;  2EGK A;  4O06 A;  1V5L A;  2PA1 A;  3ZRT A;  3E17 A;  1U3B A;  5E6P B;  1OBZ A;  2ZPL A;  3CBZ A;  5IL9 A;  4JOP A;  1N7E A;  3PS4 A;  3QO6 A;  3STJ A;  1WFV A;  4Q6H A;  2EEI A;  2K20 A;  3CS0 A;  3NGH A;  1KY9 A;  2KA9 A;  5HJ1 A;  4E35 A;  3KHF A;  5E11 A;  2V1W A;  2L97 A;  4NXR A;  3PV2 A;  4JL7 A;  4XHV A;  2LC7 A;  2OQS A;  2DKR A;  3CBX A;  1WF8 A;  3DJ3 A;  2VPH A;  3I4W A;  3JXT A;  2D90 A;  2OGP A;  1IU2 A;  2KQF A;  2KYL A;  1RGR A;  3GAB A;  1L6O A;  2W7R A;  5DTH A;  3QIK A;  3CYY A;  4Q2N A;  4G69 A;  2JXO A;  3QDO A;  1VA8 A;  4JOF A;  4JOE A;  4F8K A;  3NFL A;  4YDP A;  1UM7 A;  4NXQ A;  5F3X A;  1V6B A;  1UJD A;  2CSS A;  2I0L A;  4OEO A;  4NMS A;  3I18 A;  2KJK A;  2V90 A;  2DJT A;  4Q2O A;  2M10 A;  2HE2 A;  2QKT A;  5HFF A;  3GSL A;  1TQ3 A;  1IU0 A;  1UIT A;  2H3L A;  4JOG A;  3SHW A;  1QAV A;  1X9Z A;  2KOH A;  1Q3O A;  3LNX A;  2Q3G A;  2KOJ A;  2VSV A;  3RL7 A;  2AIN A;  1W9E A;  2G2L A;  1OBX A;  1UEQ A;  4Q2Q A;  1OBY A;  2LC6 A;  2EEG A;  1X6D A;  4REY A;  3GDS A;  5HF4 A;  4Z33 A;  3WKL A;  2L4T A;  3MH4 A;  2F5Y A;  4JOH A;  4LMM A;  2JSN A;  3QJM A;  4OAJ A;  3ID3 A;  1W9Q A;  4P2A B;  1WIF A;  4NNL A;  2FCF A;  2KAW A;  5HEB A;  5HEY A;  3QGL A;  4NMP A;  2H2B A;  3R0H A;  2DLU A;  3RL8 A;  2PZD A;  1KWA A;  1BE9 A;  1U39 A;  2L4S A;  3KZE A;  1X5N A;  2YT8 A;  3R69 A;  5HED A;  1T2M A;  2UZC A;  2DB5 A;  2ENO A;  4WYU A;  1UF1 A;  4NXP A;  3FY5 A;  2DLS A;  3WKM A;  2EEJ A;  1OZI A;  1UHP A;  1N7F A;  2RRM A;  1RGW A;  5FHT A;  1QAV B;  2CSJ A;  1FCF A;  3TSW A;  2H3M A;  3CC0 A;  5B6L A;  2E7K A;  2JOA A;  1UEZ A;  1Q3P A;  1YBO A;  5HFB A;  4NMO A;  2AWU A;  1NTE A;  3AXA A;  2OPG A;  1UFX A;  4K76 A;  4Z8J A;  2IWP A;  2M0U A;  1FC9 A;  2PKT A;  3TMH A;  3PV4 A;  2KJP A;  1U38 A;  1P1D A;  5ILB A;  1Y8T A;  1ZOK A;  3KDG A;  4L8N A;  3TSV A;  4MPA A;  2P3W A;  1B8Q A;  2M0T A;  4OEP A;  1Q7X A;  1BFE A;  2MHO A;  1UJU A;  4NMR A;  1NF3 C;  2I1N A;  1XZ9 A;  2KBS A;  4KFV A;  3DOR A;  2YUB A;  2G5M B;  2FE5 A;  2OS6 A;  2OMJ A;  1Z86 A;  2VRF A;  2YUY A;  5FB8 C;  1D5G A;  3HPK A;  3I1E A;  4Q3H A;  2EV8 A;  2M3M A;  4HOP A;  2LUI A;  3K82 A;  2K1Z A;  2QBW A;  1LCY A;  2I6V A;  1V62 A;  2EEH A;  4E34 A;  2EAQ A;  2DMZ A;  3MH6 A;  2R3Y A;  4K72 A;  4RI0 A;  3EGH C;  2KG2 A;  4K6Y A;  3HPM A;  1UEW A;  1X5Q A;  3OU0 A;  2CS5 A;  2JIN A;  2PDZ A;  2FN5 A;  4UU5 A;  2DM8 A;  3O46 A;  5GND A;  2IWN A;  2KPL A;  2I4S A;  1QAU A;  1V5Q A;  4EDJ A;  3MH7 A;  4IC6 A;  1K32 A;  2VSP A;  2DC2 A;  3GDU A;  3ID4 A;  4HOP B;  2WL7 A;  5EZ0 A;  2HGA A;  2KRG A;  2REY A;  2QKV A;  4PQW A;  5HFE A;  1WHD A;  3NCV A;  2DAZ A;  1RZX A;  1WHA A;  2AWX A;  1TP3 A;  2BYG A;  2OCS A;  2AWW A;  4JJ3 A;  4JOK A;  3PDV A;  1WH1 A;  4NMV A;  2EXG A;  1WF7 A;  4GVD A;  2JRE A;  1TP5 A;  1GQ5 A;  2OSG A;  3ID2 A;  3B76 A;  3LNY A;  2M0V A;  2YT7 A;  3GDV A;  3SFJ A;  1VJ6 A;  3GCN A;  4Q2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...