1KEFA

Pdz1 of sap90
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
93
structure length
93
Chain Sequence
EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords synapse associated protein-90
publication title The PDZ1 domain of SAP90. Characterization of structure and binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1kefA00
2DKRA 3GSLA 1WI2A 2KOMA 2DJTA 1I92A 3RLEA 4Z33A 1UHPA 1T2MA 2M0UA 1UFXA 1YBOA 5E1YA 5FB8C 1OBYA 2M0ZA 1WHAA 2QG1A 5E22A 3QO6A 3EGHC 2LA8A 1OBZA 1N6FA 2R4HA 1SOTA 2KG2A 4K78A 3LNXA 1N7EA 4REYA 4EDJA 3O46A 1WG6A 1U37A 3VQGA 2FNEA 3I4WA 2DAZA 3K50A 1RY4A 2IWPA 2EGOA 1QAUA 5GLJA 3R68A 3FY5A 2D90A 1LCYA 4N6XA 2EGKA 3L4FD 2EEHA 2KL1A 1UM1A 4K6YA 4KFVA 3QDOA 3CS0A 2DLSA 2AWUA 2M10A 2PKTA 3OTPA 4JOGA 2OSGA 2EAQA 1IU0A 2LOBA 5EZ0A 3SOEA 2I6VA 3KZEA 4JOHA 4KFWA 4YYXA 1FCFA 5F67A 1Y8TA 3E17A 2KYLA 5HDYA 2WL7A 4NMRA 2E7KA 3ID4A 1XZ9A 4G69A 1UEWA 2Q9VA 2JREA 1FC6A 3KHFA 2EHRA 4AMHA 2F0AA 2KJDA 3SUZA 2PA1A 1X5QA 4RI0A 2KOHA 2W7RA 3CH8A 5HFDA 4JOEA 1FC7A 1X6DA 3ID1A 1Q7XA 1TP3A 2KQFA 5HFBA 5G1EA 1W9QA 2M0VA 4Q6HA 1WFVA 2I1NA 1BFEA 2I0LA 3STJA 1WJLA 3GJ9A 2PZDA 1WF7A 2EDZA 1ZOKA 4HOPA 2UZCA 1I16A 2EEGA 4E35A 2JWEA 4UU5A 2G2LA 2X7ZA 2KV8A 4OEOA 4K76A 1P1DA 2BYGA 3EGGC 1UJUA 2Z9IA 5HFEA 1RGRA 1TP5A 3DIWA 3GDSA 4K72A 5HEDA 3RL8A 4Q2OA 2KJKA 1WI4A 3OU0A 4Q2PA 3R0HA 3GDVA 2EEJA 4Q6SA 2VSVA 4NMOA 4GHNA 5HFFA 5EYZA 1V5QA 3K1RA 4Q2NA 1N6EA 2R3YA 2DB5A 4GVDA 4NMQA 5JXBA 2I0IA 2QKUA 2O2TA 3BPUA 4WYUA 3QIKA 5H3JA 4L8NA 1UITA 2PDZA 3RL7A 5B6LA 1QAVB 3SFJA 1N99A 4JOPA 2YT8A 1UEQA 3VQFA 1WH1A 4K75A 3CC0A 2QBWA 3R69A 5HF1A 5I7ZA 2YUBA 1X8SA 3HPKA 2L97A 3PV4A 2AINA 1GQ5A 2VWRA 2JIKA 5HF4A 1X5NA 1X5RA 2K20A 4LMMA 2P3WA 4NMVA 1WF8A 4H11A 1WFGA 4GVCA 2LUIA 2ZPMA 3HVQC 1FC9A 4O06A 1IHJA 2Q3GA 2H3MA 2EXGA 2RCZA 2VZ5A 3GCNA 3QJNA 1TQ3A 1VA8A 2FN5A 3NGHA 2H2CA 1ZUBA 1NF3C 4E34A 3TMHA 2JINA 3QGLA 3WKLA 3TSVA 1QLCA 2W4FA 1U3BA 4PQWA 5D13A 4F8KA 5FHTA 2LC6A 1SOZA 3ID3A 2H2BA 3AXAA 3PDVA 1M5ZA 3CBXA 2CS5A 2DLUA 1VAEA 2EJYA 4XHVA 1Z86A 3DJAA 2YTWA 2CSJA 2I04A 2OQSA 2JILA 4Z8JA 5E11A 3QE1A 2QT5A 3NFKA 3O5NA 2IWQA 1V1TA 5E6PB 1D5GA 1TE0A 3CBYA 3PDZA 3GCOA 4NNMA 1KY9A 4YDPA 2V1WA 2YUYA 2KOJA 2QKTA 2KPLA 4JOKA 3PS4A 4NMSA 3GGEA 2EDPA 4NMPA 4OAJA 2OZFA 1MC7A 2JOAA 3B76A 4P2AB 1OZIA 3DJ1A 2IWNA 1GM1A 2G5MB 2HGAA 2QKVA 2FCFA 3HPMA 4HOPB 2KPKA 2CSSA 4WYTA 1GQ4A 3JXTA 2PKUA 1WHDA 1P1EA 1G9OA 2I4SA 2EV8A 2YT7A 1Q3PA 2M3MA 2V90A 2REYA 1IU2A 2D92A 1VCWA 2KAWA 1OBXA 2RRMA 2M0TA 1UEZA 2D8IA 1L6OA 3MH4A 2VPHA 4MPAA 2OCSA 1Y7NA 2HE4A 1N7FA 1UEPA 3SHWA 3TSZA 1R6JA 3ID2A 2L4TA 3NFLA 2H3LA 2IWOA 1MFLA 1UF1A 4JOFA 2OS6A 3DORA 5HEBA 2KA9A 4UU6A 4R2ZA 1B8QA 5A2PA 2F5YA 3I1EA 2VSPA 4NXQA 4NNLA 5HJ1A 1U38A 1UJVA 2ZPLA 3DJ3A 1MFGA 3KZDA 3QJMA 5DTHA 3TSWA 3PV5A 3K82A 3LNYA 4NMTA 3MH6A 1X45A 1W9EA 4JOJA 4E3BA 2OPGA 3SHUA 2VRFA 5E21A 2EEIA 2JXOA 1UM7A 2KJPA 3PV2A 1U39A 2GZVA 3ZRTA 2L4SA 3CBZA 4Q3HA 1VB7A 1N6DA 1RZXA 5HETA 2FE5A 2PNTA 1N7TA 2Z17A 4JORA 1KWAA 1BE9A 1V62A 4JL7A 5HEYA 3WKMA 1Z87A 5G1DA 4FGMA 2AWXA 5GNDA 3CYYA 1KEFA 1VJ6A 2DM8A 2DMZA 1WIFA 2LC7A 2MHOA 3I18A 2ENOA 4P0CA 3GDUA 4NXRA 2KRGA 1UJDA 5F3XA 4Q2QA 1Q3OA 3MH7A 2MX6A 1W9OA 2KBSA 1QAVA 2OMJA 4IC6A 2AWWA 1V6BA 1NTEA 1V5LA 2OGPA 5HFCA 1K32A 4NXPA 2EDVA 2HE2A 4OEPA 2EGNA 2K1ZA 1RGWA 1PDRA 2DC2A
chains in the Genus database with same CATH superfamily
2DKRA 3GSLA 1WI2A 2KOMA 2DJTA 1I92A 3RLEA 4Z33A 1UHPA 4JJ0A 1T2MA 2M0UA 1UFXA 1YBOA 5E1YA 5FB8C 1OBYA 2M0ZA 1WHAA 2QG1A 5E22A 3QO6A 3EGHC 2LA8A 1OBZA 1N6FA 2R4HA 1SOTA 2KG2A 4K78A 4JJ3A 3LNXA 1N7EA 4REYA 4EDJA 3O46A 1WG6A 1U37A 3VQGA 2FNEA 3I4WA 2DAZA 3K50A 1RY4A 2IWPA 2EGOA 1QAUA 5GLJA 3R68A 3FY5A 2D90A 1LCYA 4N6XA 2EGKA 3L4FD 2EEHA 2KL1A 1UM1A 4K6YA 4KFVA 3QDOA 3CS0A 2DLSA 2AWUA 2M10A 2PKTA 3OTPA 4JOGA 2OSGA 2EAQA 1IU0A 2LOBA 5EZ0A 2JSNA 3SOEA 2I6VA 3KZEA 4JOHA 4KFWA 4YYXA 1FCFA 5F67A 1Y8TA 3E17A 2KYLA 5HDYA 2WL7A 4NMRA 2E7KA 3ID4A 1XZ9A 4G69A 1UEWA 2Q9VA 2JREA 1FC6A 3KHFA 2EHRA 4AMHA 2F0AA 2KJDA 3SUZA 2PA1A 1X5QA 4RI0A 2KOHA 2W7RA 3CH8A 5HFDA 4JOEA 1FC7A 1X6DA 3ID1A 1Q7XA 1TP3A 2KQFA 5HFBA 5G1EA 1W9QA 2M0VA 4Q6HA 1WFVA 2I1NA 1BFEA 1X9ZA 2I0LA 3STJA 1WJLA 3GJ9A 2PZDA 1WF7A 2EDZA 1ZOKA 4HOPA 2UZCA 1I16A 2EEGA 4E35A 2JWEA 4UU5A 2G2LA 2X7ZA 2KV8A 4OEOA 4K76A 1P1DA 2BYGA 3EGGC 1UJUA 2Z9IA 5HFEA 1RGRA 1TP5A 3DIWA 3GDSA 4K72A 5HEDA 3RL8A 4Q2OA 2KJKA 1WI4A 3OU0A 4Q2PA 3R0HA 3GDVA 2EEJA 4Q6SA 2VSVA 4NMOA 4GHNA 5HFFA 3NCVA 5EYZA 1V5QA 3K1RA 4Q2NA 1N6EA 2R3YA 2DB5A 4GVDA 4NMQA 5JXBA 2I0IA 2QKUA 5B42A 2O2TA 3BPUA 4WYUA 3QIKA 5H3JA 4L8NA 1UITA 2PDZA 3RL7A 5B6LA 1QAVB 3SFJA 1N99A 4JOPA 2YT8A 1UEQA 3VQFA 1WH1A 4K75A 3CC0A 2QBWA 3R69A 5HF1A 5I7ZA 2YUBA 1X8SA 3HPKA 2L97A 3PV4A 2AINA 1GQ5A 2VWRA 2JIKA 5HF4A 1X5NA 1X5RA 2K20A 4LMMA 2P3WA 4NMVA 1WF8A 4H11A 5ILBA 1WFGA 4GVCA 2LUIA 2ZPMA 3HVQC 1FC9A 4O06A 1IHJA 2Q3GA 4FLNA 2H3MA 2EXGA 2RCZA 2VZ5A 3GCNA 3QJNA 1TQ3A 1VA8A 2FN5A 3NGHA 2H2CA 1ZUBA 1NF3C 4E34A 3TMHA 2JINA 3QGLA 3WKLA 3TSVA 1QLCA 2W4FA 1U3BA 4PQWA 5D13A 4F8KA 5FHTA 2LC6A 1SOZA 3ID3A 2H2BA 3AXAA 3PDVA 1M5ZA 3CBXA 2CS5A 2DLUA 1VAEA 2EJYA 4XHVA 1Z86A 3DJAA 2YTWA 2CSJA 2I04A 2OQSA 2JILA 4Z8JA 5E11A 3QE1A 2QT5A 3NFKA 3O5NA 2IWQA 1V1TA 5E6PB 1D5GA 1TE0A 3CBYA 3PDZA 3GCOA 4NNMA 1KY9A 4YDPA 2V1WA 2YUYA 2KOJA 2QKTA 2KPLA 4JOKA 3PS4A 4NMSA 3GGEA 2EDPA 4NMPA 4OAJA 2OZFA 1MC7A 2JOAA 3B76A 4P2AB 1OZIA 3DJ1A 2IWNA 1GM1A 2G5MB 2HGAA 2QKVA 2FCFA 3HPMA 4HOPB 2KPKA 2CSSA 4WYTA 1GQ4A 3JXTA 2PKUA 1WHDA 1P1EA 1G9OA 2I4SA 2EV8A 2YT7A 1Q3PA 2M3MA 2V90A 2REYA 1IU2A 3KDKA 2D92A 1VCWA 2KAWA 1OBXA 2RRMA 2M0TA 1UEZA 2D8IA 1L6OA 3MH4A 2VPHA 4MPAA 2OCSA 1Y7NA 2HE4A 1N7FA 1UEPA 3SHWA 3TSZA 1R6JA 3ID2A 2L4TA 3NFLA 2H3LA 2IWOA 1MFLA 1UF1A 4JOFA 2OS6A 3DORA 5HEBA 2KA9A 4UU6A 4R2ZA 1B8QA 5A2PA 2F5YA 3I1EA 2VSPA 4NXQA 4NNLA 5HJ1A 1U38A 1UJVA 2ZPLA 3DJ3A 1MFGA 3KZDA 3QJMA 5DTHA 3TSWA 3PV5A 3K82A 3LNYA 4NMTA 3MH6A 1X45A 1W9EA 4JOJA 4E3BA 2OPGA 3SHUA 2VRFA 5E21A 2EEIA 2JXOA 1UM7A 2KJPA 3PV2A 1U39A 2GZVA 3ZRTA 2L4SA 3CBZA 4Q3HA 1VB7A 1N6DA 1RZXA 5HETA 2FE5A 2PNTA 1N7TA 2Z17A 4JORA 1KWAA 1BE9A 1V62A 4JL7A 3GABA 5HEYA 3WKMA 1Z87A 5G1DA 4FGMA 2AWXA 5GNDA 3CYYA 1KEFA 3KDGA 1VJ6A 2DM8A 2DMZA 1WIFA 2LC7A 2MHOA 3I18A 2ENOA 4P0CA 3GDUA 4NXRA 2KRGA 1UJDA 5F3XA 4Q2QA 1Q3OA 3MH7A 2MX6A 1W9OA 2KBSA 1QAVA 2OMJA 4IC6A 5IL9A 2AWWA 1V6BA 1NTEA 1V5LA 2OGPA 5HFCA 1K32A 4NXPA 2GEFA 2EDVA 2HE2A 4OEPA 2EGNA 2K1ZA 1RGWA 1PDRA 2DC2A
chains in the Genus database with same CATH topology
2DKRA 3GSLA 1WI2A 2KOMA 2DJTA 1I92A 3RLEA 4Z33A 1UHPA 4JJ0A 1T2MA 2M0UA 1UFXA 1YBOA 5E1YA 5FB8C 1OBYA 2M0ZA 1WHAA 2QG1A 5E22A 3QO6A 3EGHC 2LA8A 1OBZA 1N6FA 2R4HA 1SOTA 2KG2A 4K78A 4JJ3A 3LNXA 1N7EA 4REYA 4EDJA 3O46A 1WG6A 1U37A 3VQGA 2FNEA 3I4WA 2DAZA 3K50A 1RY4A 2IWPA 2EGOA 1QAUA 5GLJA 3R68A 3FY5A 2D90A 1LCYA 4N6XA 2EGKA 3L4FD 2EEHA 2KL1A 1UM1A 4K6YA 4KFVA 3QDOA 3CS0A 2DLSA 2AWUA 2M10A 2PKTA 3OTPA 4JOGA 2OSGA 2EAQA 1IU0A 2LOBA 5EZ0A 2JSNA 3SOEA 2I6VA 3KZEA 4JOHA 4KFWA 4YYXA 1FCFA 5F67A 1Y8TA 3E17A 2KYLA 5HDYA 2WL7A 4NMRA 2E7KA 3ID4A 1XZ9A 4G69A 1UEWA 2Q9VA 2JREA 1FC6A 3KHFA 2EHRA 4AMHA 2F0AA 2KJDA 3SUZA 2PA1A 1X5QA 4RI0A 2KOHA 2W7RA 3CH8A 5HFDA 4JOEA 1FC7A 1X6DA 3ID1A 1Q7XA 1TP3A 2KQFA 5HFBA 5G1EA 1W9QA 2M0VA 4Q6HA 1WFVA 2I1NA 1BFEA 1X9ZA 2I0LA 3STJA 1WJLA 3GJ9A 2PZDA 1WF7A 2EDZA 1ZOKA 4HOPA 2UZCA 1I16A 2EEGA 4E35A 2JWEA 4UU5A 2G2LA 2X7ZA 2KV8A 4OEOA 4K76A 1P1DA 2BYGA 3EGGC 1UJUA 2Z9IA 5HFEA 1RGRA 1TP5A 3DIWA 3GDSA 4K72A 5HEDA 3RL8A 4Q2OA 2KJKA 1WI4A 3OU0A 4Q2PA 3R0HA 3GDVA 2EEJA 4Q6SA 2VSVA 4NMOA 4GHNA 5HFFA 3NCVA 5EYZA 1V5QA 3K1RA 4Q2NA 1N6EA 2R3YA 2DB5A 4GVDA 4NMQA 5JXBA 2I0IA 2QKUA 5B42A 2O2TA 3BPUA 4WYUA 3QIKA 5H3JA 4L8NA 1UITA 2PDZA 3RL7A 5B6LA 1QAVB 3SFJA 1N99A 4JOPA 2YT8A 1UEQA 3VQFA 1WH1A 4K75A 3CC0A 2QBWA 3R69A 5HF1A 5I7ZA 2YUBA 1X8SA 3HPKA 2L97A 3PV4A 2AINA 1GQ5A 2VWRA 2JIKA 5HF4A 1X5NA 1X5RA 2K20A 4LMMA 2P3WA 4NMVA 1WF8A 4H11A 5ILBA 1WFGA 4GVCA 2LUIA 2ZPMA 3HVQC 1FC9A 4O06A 1IHJA 2Q3GA 4FLNA 2H3MA 2EXGA 2RCZA 2VZ5A 3GCNA 3QJNA 1TQ3A 1VA8A 2FN5A 3NGHA 2H2CA 1ZUBA 1NF3C 4E34A 3TMHA 2JINA 3QGLA 3WKLA 3TSVA 1QLCA 2W4FA 1U3BA 4PQWA 5D13A 4F8KA 5FHTA 2LC6A 1SOZA 3ID3A 2H2BA 3AXAA 3PDVA 1M5ZA 3CBXA 2CS5A 2DLUA 1VAEA 2EJYA 4XHVA 1Z86A 3DJAA 2YTWA 2CSJA 2I04A 2OQSA 2JILA 4Z8JA 5E11A 3QE1A 2QT5A 3NFKA 3O5NA 2IWQA 1V1TA 5E6PB 1D5GA 1TE0A 3CBYA 3PDZA 3GCOA 4NNMA 1KY9A 4YDPA 2V1WA 2YUYA 2KOJA 2QKTA 2KPLA 4JOKA 3PS4A 4NMSA 3GGEA 2EDPA 4NMPA 4OAJA 2OZFA 1MC7A 2JOAA 3B76A 4P2AB 1OZIA 3DJ1A 2IWNA 1GM1A 2G5MB 2HGAA 2QKVA 2FCFA 3HPMA 4HOPB 2KPKA 2CSSA 4WYTA 1GQ4A 3JXTA 2PKUA 1WHDA 1P1EA 1G9OA 2I4SA 2EV8A 2YT7A 1Q3PA 2M3MA 2V90A 2REYA 1IU2A 3KDKA 2D92A 1VCWA 2KAWA 1OBXA 2RRMA 2M0TA 1UEZA 2D8IA 1L6OA 3MH4A 2VPHA 4MPAA 2OCSA 1Y7NA 2HE4A 1N7FA 1UEPA 3SHWA 3TSZA 1R6JA 3ID2A 2L4TA 3NFLA 2H3LA 2IWOA 1MFLA 1UF1A 4JOFA 2OS6A 3DORA 5HEBA 2KA9A 4UU6A 4R2ZA 1B8QA 5A2PA 2F5YA 3I1EA 2VSPA 4NXQA 4NNLA 5HJ1A 1U38A 1UJVA 2ZPLA 3DJ3A 1MFGA 3KZDA 3QJMA 5DTHA 3TSWA 3PV5A 3K82A 3LNYA 4NMTA 3MH6A 1X45A 1W9EA 4JOJA 4E3BA 2OPGA 3SHUA 2VRFA 5E21A 2EEIA 2JXOA 1UM7A 2KJPA 3PV2A 1U39A 2GZVA 3ZRTA 2L4SA 3CBZA 4Q3HA 1VB7A 1N6DA 1RZXA 5HETA 2FE5A 2PNTA 1N7TA 2Z17A 4JORA 1KWAA 1BE9A 1V62A 4JL7A 3GABA 5HEYA 3WKMA 1Z87A 5G1DA 4FGMA 2AWXA 5GNDA 3CYYA 1KEFA 3KDGA 1VJ6A 2DM8A 2DMZA 1WIFA 2LC7A 2MHOA 3I18A 2ENOA 4P0CA 3GDUA 4NXRA 2KRGA 1UJDA 5F3XA 4Q2QA 1Q3OA 3MH7A 2MX6A 1W9OA 2KBSA 1QAVA 2OMJA 4IC6A 5IL9A 2AWWA 1V6BA 1NTEA 1V5LA 2OGPA 5HFCA 1K32A 4NXPA 2GEFA 2EDVA 2HE2A 4OEPA 2EGNA 2K1ZA 1RGWA 1PDRA 2DC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKR A;  3GSL A;  1WI2 A;  2KOM A;  2DJT A;  1I92 A;  3RLE A;  4Z33 A;  1UHP A;  1T2M A;  2M0U A;  1UFX A;  1YBO A;  5E1Y A;  5FB8 C;  1OBY A;  2M0Z A;  1WHA A;  2QG1 A;  5E22 A;  3QO6 A;  3EGH C;  2LA8 A;  1OBZ A;  1N6F A;  2R4H A;  1SOT A;  2KG2 A;  4K78 A;  3LNX A;  1N7E A;  4REY A;  4EDJ A;  3O46 A;  1WG6 A;  1U37 A;  3VQG A;  2FNE A;  3I4W A;  2DAZ A;  3K50 A;  1RY4 A;  2IWP A;  2EGO A;  1QAU A;  5GLJ A;  3R68 A;  3FY5 A;  2D90 A;  1LCY A;  4N6X A;  2EGK A;  3L4F D;  2EEH A;  2KL1 A;  1UM1 A;  4K6Y A;  4KFV A;  3QDO A;  3CS0 A;  2DLS A;  2AWU A;  2M10 A;  2PKT A;  3OTP A;  4JOG A;  2OSG A;  2EAQ A;  1IU0 A;  2LOB A;  5EZ0 A;  3SOE A;  2I6V A;  3KZE A;  4JOH A;  4KFW A;  4YYX A;  1FCF A;  5F67 A;  1Y8T A;  3E17 A;  2KYL A;  5HDY A;  2WL7 A;  4NMR A;  2E7K A;  3ID4 A;  1XZ9 A;  4G69 A;  1UEW A;  2Q9V A;  2JRE A;  1FC6 A;  3KHF A;  2EHR A;  4AMH A;  2F0A A;  2KJD A;  3SUZ A;  2PA1 A;  1X5Q A;  4RI0 A;  2KOH A;  2W7R A;  3CH8 A;  5HFD A;  4JOE A;  1FC7 A;  1X6D A;  3ID1 A;  1Q7X A;  1TP3 A;  2KQF A;  5HFB A;  5G1E A;  1W9Q A;  2M0V A;  4Q6H A;  1WFV A;  2I1N A;  1BFE A;  2I0L A;  3STJ A;  1WJL A;  3GJ9 A;  2PZD A;  1WF7 A;  2EDZ A;  1ZOK A;  4HOP A;  2UZC A;  1I16 A;  2EEG A;  4E35 A;  2JWE A;  4UU5 A;  2G2L A;  2X7Z A;  2KV8 A;  4OEO A;  4K76 A;  1P1D A;  2BYG A;  3EGG C;  1UJU A;  2Z9I A;  5HFE A;  1RGR A;  1TP5 A;  3DIW A;  3GDS A;  4K72 A;  5HED A;  3RL8 A;  4Q2O A;  2KJK A;  1WI4 A;  3OU0 A;  4Q2P A;  3R0H A;  3GDV A;  2EEJ A;  4Q6S A;  2VSV A;  4NMO A;  4GHN A;  5HFF A;  5EYZ A;  1V5Q A;  3K1R A;  4Q2N A;  1N6E A;  2R3Y A;  2DB5 A;  4GVD A;  4NMQ A;  5JXB A;  2I0I A;  2QKU A;  2O2T A;  3BPU A;  4WYU A;  3QIK A;  5H3J A;  4L8N A;  1UIT A;  2PDZ A;  3RL7 A;  5B6L A;  1QAV B;  3SFJ A;  1N99 A;  4JOP A;  2YT8 A;  1UEQ A;  3VQF A;  1WH1 A;  4K75 A;  3CC0 A;  2QBW A;  3R69 A;  5HF1 A;  5I7Z A;  2YUB A;  1X8S A;  3HPK A;  2L97 A;  3PV4 A;  2AIN A;  1GQ5 A;  2VWR A;  2JIK A;  5HF4 A;  1X5N A;  1X5R A;  2K20 A;  4LMM A;  2P3W A;  4NMV A;  1WF8 A;  4H11 A;  1WFG A;  4GVC A;  2LUI A;  2ZPM A;  3HVQ C;  1FC9 A;  4O06 A;  1IHJ A;  2Q3G A;  2H3M A;  2EXG A;  2RCZ A;  2VZ5 A;  3GCN A;  3QJN A;  1TQ3 A;  1VA8 A;  2FN5 A;  3NGH A;  2H2C A;  1ZUB A;  1NF3 C;  4E34 A;  3TMH A;  2JIN A;  3QGL A;  3WKL A;  3TSV A;  1QLC A;  2W4F A;  1U3B A;  4PQW A;  5D13 A;  4F8K A;  5FHT A;  2LC6 A;  1SOZ A;  3ID3 A;  2H2B A;  3AXA A;  3PDV A;  1M5Z A;  3CBX A;  2CS5 A;  2DLU A;  1VAE A;  2EJY A;  4XHV A;  1Z86 A;  3DJA A;  2YTW A;  2CSJ A;  2I04 A;  2OQS A;  2JIL A;  4Z8J A;  5E11 A;  3QE1 A;  2QT5 A;  3NFK A;  3O5N A;  2IWQ A;  1V1T A;  5E6P B;  1D5G A;  1TE0 A;  3CBY A;  3PDZ A;  3GCO A;  4NNM A;  1KY9 A;  4YDP A;  2V1W A;  2YUY A;  2KOJ A;  2QKT A;  2KPL A;  4JOK A;  3PS4 A;  4NMS A;  3GGE A;  2EDP A;  4NMP A;  4OAJ A;  2OZF A;  1MC7 A;  2JOA A;  3B76 A;  4P2A B;  1OZI A;  3DJ1 A;  2IWN A;  1GM1 A;  2G5M B;  2HGA A;  2QKV A;  2FCF A;  3HPM A;  4HOP B;  2KPK A;  2CSS A;  4WYT A;  1GQ4 A;  3JXT A;  2PKU A;  1WHD A;  1P1E A;  1G9O A;  2I4S A;  2EV8 A;  2YT7 A;  1Q3P A;  2M3M A;  2V90 A;  2REY A;  1IU2 A;  2D92 A;  1VCW A;  2KAW A;  1OBX A;  2RRM A;  2M0T A;  1UEZ A;  2D8I A;  1L6O A;  3MH4 A;  2VPH A;  4MPA A;  2OCS A;  1Y7N A;  2HE4 A;  1N7F A;  1UEP A;  3SHW A;  3TSZ A;  1R6J A;  3ID2 A;  2L4T A;  3NFL A;  2H3L A;  2IWO A;  1MFL A;  1UF1 A;  4JOF A;  2OS6 A;  3DOR A;  5HEB A;  2KA9 A;  4UU6 A;  4R2Z A;  1B8Q A;  5A2P A;  2F5Y A;  3I1E A;  2VSP A;  4NXQ A;  4NNL A;  5HJ1 A;  1U38 A;  1UJV A;  2ZPL A;  3DJ3 A;  1MFG A;  3KZD A;  3QJM A;  5DTH A;  3TSW A;  3PV5 A;  3K82 A;  3LNY A;  4NMT A;  3MH6 A;  1X45 A;  1W9E A;  4JOJ A;  4E3B A;  2OPG A;  3SHU A;  2VRF A;  5E21 A;  2EEI A;  2JXO A;  1UM7 A;  2KJP A;  3PV2 A;  1U39 A;  2GZV A;  3ZRT A;  2L4S A;  3CBZ A;  4Q3H A;  1VB7 A;  1N6D A;  1RZX A;  5HET A;  2FE5 A;  2PNT A;  1N7T A;  2Z17 A;  4JOR A;  1KWA A;  1BE9 A;  1V62 A;  4JL7 A;  5HEY A;  3WKM A;  1Z87 A;  5G1D A;  4FGM A;  2AWX A;  5GND A;  3CYY A;  1KEF A;  1VJ6 A;  2DM8 A;  2DMZ A;  1WIF A;  2LC7 A;  2MHO A;  3I18 A;  2ENO A;  4P0C A;  3GDU A;  4NXR A;  2KRG A;  1UJD A;  5F3X A;  4Q2Q A;  1Q3O A;  3MH7 A;  2MX6 A;  1W9O A;  2KBS A;  1QAV A;  2OMJ A;  4IC6 A;  2AWW A;  1V6B A;  1NTE A;  1V5L A;  2OGP A;  5HFC A;  1K32 A;  4NXP A;  2EDV A;  2HE2 A;  4OEP A;  2EGN A;  2K1Z A;  1RGW A;  1PDR A;  2DC2 A; 
#chains in the Genus database with same CATH topology
 2DKR A;  3GSL A;  1WI2 A;  2KOM A;  2DJT A;  1I92 A;  3RLE A;  4Z33 A;  1UHP A;  4JJ0 A;  1T2M A;  2M0U A;  1UFX A;  1YBO A;  5E1Y A;  5FB8 C;  1OBY A;  2M0Z A;  1WHA A;  2QG1 A;  5E22 A;  3QO6 A;  3EGH C;  2LA8 A;  1OBZ A;  1N6F A;  2R4H A;  1SOT A;  2KG2 A;  4K78 A;  4JJ3 A;  3LNX A;  1N7E A;  4REY A;  4EDJ A;  3O46 A;  1WG6 A;  1U37 A;  3VQG A;  2FNE A;  3I4W A;  2DAZ A;  3K50 A;  1RY4 A;  2IWP A;  2EGO A;  1QAU A;  5GLJ A;  3R68 A;  3FY5 A;  2D90 A;  1LCY A;  4N6X A;  2EGK A;  3L4F D;  2EEH A;  2KL1 A;  1UM1 A;  4K6Y A;  4KFV A;  3QDO A;  3CS0 A;  2DLS A;  2AWU A;  2M10 A;  2PKT A;  3OTP A;  4JOG A;  2OSG A;  2EAQ A;  1IU0 A;  2LOB A;  5EZ0 A;  2JSN A;  3SOE A;  2I6V A;  3KZE A;  4JOH A;  4KFW A;  4YYX A;  1FCF A;  5F67 A;  1Y8T A;  3E17 A;  2KYL A;  5HDY A;  2WL7 A;  4NMR A;  2E7K A;  3ID4 A;  1XZ9 A;  4G69 A;  1UEW A;  2Q9V A;  2JRE A;  1FC6 A;  3KHF A;  2EHR A;  4AMH A;  2F0A A;  2KJD A;  3SUZ A;  2PA1 A;  1X5Q A;  4RI0 A;  2KOH A;  2W7R A;  3CH8 A;  5HFD A;  4JOE A;  1FC7 A;  1X6D A;  3ID1 A;  1Q7X A;  1TP3 A;  2KQF A;  5HFB A;  5G1E A;  1W9Q A;  2M0V A;  4Q6H A;  1WFV A;  2I1N A;  1BFE A;  1X9Z A;  2I0L A;  3STJ A;  1WJL A;  3GJ9 A;  2PZD A;  1WF7 A;  2EDZ A;  1ZOK A;  4HOP A;  2UZC A;  1I16 A;  2EEG A;  4E35 A;  2JWE A;  4UU5 A;  2G2L A;  2X7Z A;  2KV8 A;  4OEO A;  4K76 A;  1P1D A;  2BYG A;  3EGG C;  1UJU A;  2Z9I A;  5HFE A;  1RGR A;  1TP5 A;  3DIW A;  3GDS A;  4K72 A;  5HED A;  3RL8 A;  4Q2O A;  2KJK A;  1WI4 A;  3OU0 A;  4Q2P A;  3R0H A;  3GDV A;  2EEJ A;  4Q6S A;  2VSV A;  4NMO A;  4GHN A;  5HFF A;  3NCV A;  5EYZ A;  1V5Q A;  3K1R A;  4Q2N A;  1N6E A;  2R3Y A;  2DB5 A;  4GVD A;  4NMQ A;  5JXB A;  2I0I A;  2QKU A;  5B42 A;  2O2T A;  3BPU A;  4WYU A;  3QIK A;  5H3J A;  4L8N A;  1UIT A;  2PDZ A;  3RL7 A;  5B6L A;  1QAV B;  3SFJ A;  1N99 A;  4JOP A;  2YT8 A;  1UEQ A;  3VQF A;  1WH1 A;  4K75 A;  3CC0 A;  2QBW A;  3R69 A;  5HF1 A;  5I7Z A;  2YUB A;  1X8S A;  3HPK A;  2L97 A;  3PV4 A;  2AIN A;  1GQ5 A;  2VWR A;  2JIK A;  5HF4 A;  1X5N A;  1X5R A;  2K20 A;  4LMM A;  2P3W A;  4NMV A;  1WF8 A;  4H11 A;  5ILB A;  1WFG A;  4GVC A;  2LUI A;  2ZPM A;  3HVQ C;  1FC9 A;  4O06 A;  1IHJ A;  2Q3G A;  4FLN A;  2H3M A;  2EXG A;  2RCZ A;  2VZ5 A;  3GCN A;  3QJN A;  1TQ3 A;  1VA8 A;  2FN5 A;  3NGH A;  2H2C A;  1ZUB A;  1NF3 C;  4E34 A;  3TMH A;  2JIN A;  3QGL A;  3WKL A;  3TSV A;  1QLC A;  2W4F A;  1U3B A;  4PQW A;  5D13 A;  4F8K A;  5FHT A;  2LC6 A;  1SOZ A;  3ID3 A;  2H2B A;  3AXA A;  3PDV A;  1M5Z A;  3CBX A;  2CS5 A;  2DLU A;  1VAE A;  2EJY A;  4XHV A;  1Z86 A;  3DJA A;  2YTW A;  2CSJ A;  2I04 A;  2OQS A;  2JIL A;  4Z8J A;  5E11 A;  3QE1 A;  2QT5 A;  3NFK A;  3O5N A;  2IWQ A;  1V1T A;  5E6P B;  1D5G A;  1TE0 A;  3CBY A;  3PDZ A;  3GCO A;  4NNM A;  1KY9 A;  4YDP A;  2V1W A;  2YUY A;  2KOJ A;  2QKT A;  2KPL A;  4JOK A;  3PS4 A;  4NMS A;  3GGE A;  2EDP A;  4NMP A;  4OAJ A;  2OZF A;  1MC7 A;  2JOA A;  3B76 A;  4P2A B;  1OZI A;  3DJ1 A;  2IWN A;  1GM1 A;  2G5M B;  2HGA A;  2QKV A;  2FCF A;  3HPM A;  4HOP B;  2KPK A;  2CSS A;  4WYT A;  1GQ4 A;  3JXT A;  2PKU A;  1WHD A;  1P1E A;  1G9O A;  2I4S A;  2EV8 A;  2YT7 A;  1Q3P A;  2M3M A;  2V90 A;  2REY A;  1IU2 A;  3KDK A;  2D92 A;  1VCW A;  2KAW A;  1OBX A;  2RRM A;  2M0T A;  1UEZ A;  2D8I A;  1L6O A;  3MH4 A;  2VPH A;  4MPA A;  2OCS A;  1Y7N A;  2HE4 A;  1N7F A;  1UEP A;  3SHW A;  3TSZ A;  1R6J A;  3ID2 A;  2L4T A;  3NFL A;  2H3L A;  2IWO A;  1MFL A;  1UF1 A;  4JOF A;  2OS6 A;  3DOR A;  5HEB A;  2KA9 A;  4UU6 A;  4R2Z A;  1B8Q A;  5A2P A;  2F5Y A;  3I1E A;  2VSP A;  4NXQ A;  4NNL A;  5HJ1 A;  1U38 A;  1UJV A;  2ZPL A;  3DJ3 A;  1MFG A;  3KZD A;  3QJM A;  5DTH A;  3TSW A;  3PV5 A;  3K82 A;  3LNY A;  4NMT A;  3MH6 A;  1X45 A;  1W9E A;  4JOJ A;  4E3B A;  2OPG A;  3SHU A;  2VRF A;  5E21 A;  2EEI A;  2JXO A;  1UM7 A;  2KJP A;  3PV2 A;  1U39 A;  2GZV A;  3ZRT A;  2L4S A;  3CBZ A;  4Q3H A;  1VB7 A;  1N6D A;  1RZX A;  5HET A;  2FE5 A;  2PNT A;  1N7T A;  2Z17 A;  4JOR A;  1KWA A;  1BE9 A;  1V62 A;  4JL7 A;  3GAB A;  5HEY A;  3WKM A;  1Z87 A;  5G1D A;  4FGM A;  2AWX A;  5GND A;  3CYY A;  1KEF A;  3KDG A;  1VJ6 A;  2DM8 A;  2DMZ A;  1WIF A;  2LC7 A;  2MHO A;  3I18 A;  2ENO A;  4P0C A;  3GDU A;  4NXR A;  2KRG A;  1UJD A;  5F3X A;  4Q2Q A;  1Q3O A;  3MH7 A;  2MX6 A;  1W9O A;  2KBS A;  1QAV A;  2OMJ A;  4IC6 A;  5IL9 A;  2AWW A;  1V6B A;  1NTE A;  1V5L A;  2OGP A;  5HFC A;  1K32 A;  4NXP A;  2GEF A;  2EDV A;  2HE2 A;  4OEP A;  2EGN A;  2K1Z A;  1RGW A;  1PDR A;  2DC2 A; 
#chains in the Genus database with same CATH homology
 2DKR A;  3GSL A;  1WI2 A;  2KOM A;  2DJT A;  1I92 A;  3RLE A;  4Z33 A;  1UHP A;  4JJ0 A;  1T2M A;  2M0U A;  1UFX A;  1YBO A;  5E1Y A;  5FB8 C;  1OBY A;  2M0Z A;  1WHA A;  2QG1 A;  5E22 A;  3QO6 A;  3EGH C;  2LA8 A;  1OBZ A;  1N6F A;  2R4H A;  1SOT A;  2KG2 A;  4K78 A;  4JJ3 A;  3LNX A;  1N7E A;  4REY A;  4EDJ A;  3O46 A;  1WG6 A;  1U37 A;  3VQG A;  2FNE A;  3I4W A;  2DAZ A;  3K50 A;  1RY4 A;  2IWP A;  2EGO A;  1QAU A;  5GLJ A;  3R68 A;  3FY5 A;  2D90 A;  1LCY A;  4N6X A;  2EGK A;  3L4F D;  2EEH A;  2KL1 A;  1UM1 A;  4K6Y A;  4KFV A;  3QDO A;  3CS0 A;  2DLS A;  2AWU A;  2M10 A;  2PKT A;  3OTP A;  4JOG A;  2OSG A;  2EAQ A;  1IU0 A;  2LOB A;  5EZ0 A;  2JSN A;  3SOE A;  2I6V A;  3KZE A;  4JOH A;  4KFW A;  4YYX A;  1FCF A;  5F67 A;  1Y8T A;  3E17 A;  2KYL A;  5HDY A;  2WL7 A;  4NMR A;  2E7K A;  3ID4 A;  1XZ9 A;  4G69 A;  1UEW A;  2Q9V A;  2JRE A;  1FC6 A;  3KHF A;  2EHR A;  4AMH A;  2F0A A;  2KJD A;  3SUZ A;  2PA1 A;  1X5Q A;  4RI0 A;  2KOH A;  2W7R A;  3CH8 A;  5HFD A;  4JOE A;  1FC7 A;  1X6D A;  3ID1 A;  1Q7X A;  1TP3 A;  2KQF A;  5HFB A;  5G1E A;  1W9Q A;  2M0V A;  4Q6H A;  1WFV A;  2I1N A;  1BFE A;  1X9Z A;  2I0L A;  3STJ A;  1WJL A;  3GJ9 A;  2PZD A;  1WF7 A;  2EDZ A;  1ZOK A;  4HOP A;  2UZC A;  1I16 A;  2EEG A;  4E35 A;  2JWE A;  4UU5 A;  2G2L A;  2X7Z A;  2KV8 A;  4OEO A;  4K76 A;  1P1D A;  2BYG A;  3EGG C;  1UJU A;  2Z9I A;  5HFE A;  1RGR A;  1TP5 A;  3DIW A;  3GDS A;  4K72 A;  5HED A;  3RL8 A;  4Q2O A;  2KJK A;  1WI4 A;  3OU0 A;  4Q2P A;  3R0H A;  3GDV A;  2EEJ A;  4Q6S A;  2VSV A;  4NMO A;  4GHN A;  5HFF A;  3NCV A;  5EYZ A;  1V5Q A;  3K1R A;  4Q2N A;  1N6E A;  2R3Y A;  2DB5 A;  4GVD A;  4NMQ A;  5JXB A;  2I0I A;  2QKU A;  5B42 A;  2O2T A;  3BPU A;  4WYU A;  3QIK A;  5H3J A;  4L8N A;  1UIT A;  2PDZ A;  3RL7 A;  5B6L A;  1QAV B;  3SFJ A;  1N99 A;  4JOP A;  2YT8 A;  1UEQ A;  3VQF A;  1WH1 A;  4K75 A;  3CC0 A;  2QBW A;  3R69 A;  5HF1 A;  5I7Z A;  2YUB A;  1X8S A;  3HPK A;  2L97 A;  3PV4 A;  2AIN A;  1GQ5 A;  2VWR A;  2JIK A;  5HF4 A;  1X5N A;  1X5R A;  2K20 A;  4LMM A;  2P3W A;  4NMV A;  1WF8 A;  4H11 A;  5ILB A;  1WFG A;  4GVC A;  2LUI A;  2ZPM A;  3HVQ C;  1FC9 A;  4O06 A;  1IHJ A;  2Q3G A;  4FLN A;  2H3M A;  2EXG A;  2RCZ A;  2VZ5 A;  3GCN A;  3QJN A;  1TQ3 A;  1VA8 A;  2FN5 A;  3NGH A;  2H2C A;  1ZUB A;  1NF3 C;  4E34 A;  3TMH A;  2JIN A;  3QGL A;  3WKL A;  3TSV A;  1QLC A;  2W4F A;  1U3B A;  4PQW A;  5D13 A;  4F8K A;  5FHT A;  2LC6 A;  1SOZ A;  3ID3 A;  2H2B A;  3AXA A;  3PDV A;  1M5Z A;  3CBX A;  2CS5 A;  2DLU A;  1VAE A;  2EJY A;  4XHV A;  1Z86 A;  3DJA A;  2YTW A;  2CSJ A;  2I04 A;  2OQS A;  2JIL A;  4Z8J A;  5E11 A;  3QE1 A;  2QT5 A;  3NFK A;  3O5N A;  2IWQ A;  1V1T A;  5E6P B;  1D5G A;  1TE0 A;  3CBY A;  3PDZ A;  3GCO A;  4NNM A;  1KY9 A;  4YDP A;  2V1W A;  2YUY A;  2KOJ A;  2QKT A;  2KPL A;  4JOK A;  3PS4 A;  4NMS A;  3GGE A;  2EDP A;  4NMP A;  4OAJ A;  2OZF A;  1MC7 A;  2JOA A;  3B76 A;  4P2A B;  1OZI A;  3DJ1 A;  2IWN A;  1GM1 A;  2G5M B;  2HGA A;  2QKV A;  2FCF A;  3HPM A;  4HOP B;  2KPK A;  2CSS A;  4WYT A;  1GQ4 A;  3JXT A;  2PKU A;  1WHD A;  1P1E A;  1G9O A;  2I4S A;  2EV8 A;  2YT7 A;  1Q3P A;  2M3M A;  2V90 A;  2REY A;  1IU2 A;  3KDK A;  2D92 A;  1VCW A;  2KAW A;  1OBX A;  2RRM A;  2M0T A;  1UEZ A;  2D8I A;  1L6O A;  3MH4 A;  2VPH A;  4MPA A;  2OCS A;  1Y7N A;  2HE4 A;  1N7F A;  1UEP A;  3SHW A;  3TSZ A;  1R6J A;  3ID2 A;  2L4T A;  3NFL A;  2H3L A;  2IWO A;  1MFL A;  1UF1 A;  4JOF A;  2OS6 A;  3DOR A;  5HEB A;  2KA9 A;  4UU6 A;  4R2Z A;  1B8Q A;  5A2P A;  2F5Y A;  3I1E A;  2VSP A;  4NXQ A;  4NNL A;  5HJ1 A;  1U38 A;  1UJV A;  2ZPL A;  3DJ3 A;  1MFG A;  3KZD A;  3QJM A;  5DTH A;  3TSW A;  3PV5 A;  3K82 A;  3LNY A;  4NMT A;  3MH6 A;  1X45 A;  1W9E A;  4JOJ A;  4E3B A;  2OPG A;  3SHU A;  2VRF A;  5E21 A;  2EEI A;  2JXO A;  1UM7 A;  2KJP A;  3PV2 A;  1U39 A;  2GZV A;  3ZRT A;  2L4S A;  3CBZ A;  4Q3H A;  1VB7 A;  1N6D A;  1RZX A;  5HET A;  2FE5 A;  2PNT A;  1N7T A;  2Z17 A;  4JOR A;  1KWA A;  1BE9 A;  1V62 A;  4JL7 A;  3GAB A;  5HEY A;  3WKM A;  1Z87 A;  5G1D A;  4FGM A;  2AWX A;  5GND A;  3CYY A;  1KEF A;  3KDG A;  1VJ6 A;  2DM8 A;  2DMZ A;  1WIF A;  2LC7 A;  2MHO A;  3I18 A;  2ENO A;  4P0C A;  3GDU A;  4NXR A;  2KRG A;  1UJD A;  5F3X A;  4Q2Q A;  1Q3O A;  3MH7 A;  2MX6 A;  1W9O A;  2KBS A;  1QAV A;  2OMJ A;  4IC6 A;  5IL9 A;  2AWW A;  1V6B A;  1NTE A;  1V5L A;  2OGP A;  5HFC A;  1K32 A;  4NXP A;  2GEF A;  2EDV A;  2HE2 A;  4OEP A;  2EGN A;  2K1Z A;  1RGW A;  1PDR A;  2DC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...