3OU0A

Re-refined 3cs0
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Periplasmic serine endoprotease DegP
publication title Covalent Linkage of Distinct Substrate Degrons Controls Assembly and Disassembly of DegP Proteolytic Cages.
pubmed doi rcsb
source organism Escherichia coli
total genus 82
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3ou0A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3ou0A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ou0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ou0A01
3SNDA 2KRGA 3BN9A 1AZ8A 4UFFH 1VAEA 3A7ZA 3V0XA 1E34B 3CS7A 1UCYH 1LPZB 4BAKB 3RXEA 1DSTA 2W7SA 3RXHA 3U8TH 2AH4X 1ELBA 2QA9E 2VVVA 3M5NA 1O5DH 3SU4A 3M7UA 5A8YA 3EA7A 4TYDA 2ZDNA 1V2KT 1MU8B 4Q2OA 1HGTH 2FX6A 2C8XB 2PTNA 1O2KA 5AF9H 2CV3A 2DLSA 2UWLA 1B0FA 2ZGXH 3MU0A 3RU4T 2VSPA 5EYZA 2ILNA 5JB8S 1U6QA 1ZMJA 3A80A 3SUEA 2W26A 3ODFA 1CA0C 1DANH 2ENOA 8ESTE 1UEPA 2R0LA 1RXPA 4E06H 1GMCF 4OEOA 3M37A 1PFXC 1RGRA 5BPEA 3NXPA 1VCQA 1CSOE 4K69A 1BIOA 1EB1H 2A2QH 1CGIE 2GZVA 1ZSLA 3GYMA 1RZXA 3T62A 3TNSA 3JXTA 5L30H 5E2OA 4Y79A 1L0ZA 3A82A 4DJZB 2FYQA 4LMMA 2W7UA 1EPTC 1SGCA 3ZRTA 5GNDA 2FE5A 1GMDG 3V3MA 3M5OA 4ABGA 5AVDA 1WBGB 3FZDA 2D8WA 3A7WA 4ZKRU 1NC6A 3E6PH 6GCHG 4ABHA 1GL1A 3ID4A 2JH5D 2G5NA 1OSSA 2UUKB 2PWXA 1THSH 1C2KA 3QK1A 1O3CA 1GI9B 3QE1A 4Y0YE 1MUEB 2VVCA 4WMEA 2ZHEH 5GWZA 4NIXA 4VGCC 2FYRA 1SGRE 3VB5A 4D7GA 1BBRK 4MVNA 4RI0A 3OY5U 2PGQB 2BY6X 3D49H 1O30A 1N8OB 3EDXB 3SU0A 2J34A 1PPGE 1SL3A 3O8DA 3RXFA 3ZZ7A 5C2ZA 1TOCB 3FY5A 2CF9H 5DP7A 5E0HA 2FI5E 2PLXA 2BOHB 1P2QA 4Y7BA 1TB6H 4JOEA 4NMTA 2IJOB 4U32A 1PPZA 2H2BA 1AGJA 2EI6A 1C1SA 5HFFA 1Y5AT 1IQLA 2FOFA 2IOTA 1OKXA 2BHGA 4JYUH 1HUTH 1HYLA 4JZ1A 2YT8A 3AASA 3HPTB 1QA7A 3ODDA 1EAIA 3MYWA 4UFDH 1QB9A 2F83A 3GSLA 2XC5A 1ARCA 3TH4H 1EX3A 1GBHA 2I04A 2EC9H 3NWUA 5DP8A 1F5RA 2KPLA 2F9VA 5F3XA 1WCZA 2QCYA 1SBWA 4BNRA 4BAMB 2Z7FE 3DA9B 3LGVA 1V6DA 3PMHB 2HE4A 2WINI 2Q1JA 1O2XA 1DE7H 1O2YA 2FESH 2ULLA 1IQEA 3VXFH 1ZSJA 3SQEE 5AFYH 1E38B 2BD4A 2EEKA 3BIUH 4JZDH 3A81A 3DFLA 1FQ3A 1DSUA 3M35A 1AUTC 2O8UA 2OP9A 3PMJA 4J2YB 2BB4A 4E7NA 2P3FH 4K2YA 4PROA 1TNGA 2ZCLP 2XC0A 1T8OA 2K1QA 4P2AB 1UFXA 2FWWA 4O06A 4REYA 2ZWLH 5HM2A 2KA9A 1GBMA 4GVUA 2PKSC 3SORA 2UZCA 3CP7A 2BVSH 3RXOA 4AGKA 1W0YH 1HV7A 5E1YA 3KIDU 2W3KA 2Z17A 8GCHG 2TBSA 4RSPA 2AMPA 1F0UA 1P8VC 4XFQA 1GJ7B 3SNCA 5JXBA 4YT7H 3NPSA 4Q7ZA 1QAVA 3SHUA 1AI8H 3MWIU 1GCTB 1KXDA 2PA1A 2IPHA 4O3TA 4OAJA 1DUEA 1WV7H 3ATMA 1M5ZA 4JOGA 1ELGA 1FMGA 3HK6B 3SU6A 1U39A 3L6PA 5TCAA 4F8KA 1J17T 3F68H 4K1TA 4MNYA 3BTFE 3T25A 3TH2H 2ZFTA 3QIKA 4KTSA 2RG3A 1JIRA 1S85A 1FLEE 1MAYA 1O5EH 1UK4A 3WY8A 1TRYA 1VGCC 5A0AE 1EPTA 1SGNE 2GTBA 4NA8A 1FDPA 1GBEA 1LO6A 1S6HA 3OX7U 1CBWC 1SQOA 4X6PA 3GY5A 4FU7A 2KJPA 1OOKB 1OP0A 2Z3DA 3P8FA 3Q3YA 1EJNA 4Y8XA 1ETTH 3MU5A 3MO6A 3SJ8A 2V1WA 3EGHC 3BTDE 5A8XA 1KXFA 1LHDH 1MU6B 1NFUA 1SOTA 3KGPA 2RA0A 2PUXB 5DP9A 3M3VA 2PZDA 2XTTB 3UPEA 4MNWA 4BXWA 5EXMA 4D9QA 3HKJB 4NMPA 5H3JA 1GDNA 4NFEA 3O8RA 1PQAA 2AEIH 5LPEA 1DWBH 2HALA 4AB8A 1C5XB 2FI3E 1NFWA 4NIWA 1TX8A 1SOZA 5FXLA 1BBRE 2FZZA 2BOKA 2OLGA 2QF0A 3C1KA 2UUFB 2HNTE 1AFQB 4F49A 2EDPA 3O5NA 5E0GA 1O0DH 1ZYOA 1B7XB 4E7RG 2B8OH 1YKTA 1ELCA 2XRCA 1QGFA 5HEDA 4Y71A 2EA3A 2KOHA 2ZPRA 1HFDA 1F0RA 1LVYA 1ANCA 1GBCA 2O9QA 1GJ8B 3M7QA 2OINA 1P9SA 2VWRA 1CU1A 3T2NA 2ZIQH 5T6GA 1QB6A 2ZFQH 1G30B 3P17H 1VITF 3E0NB 3PB1E 1W11U 4A92A 1H9HE 3B8JA 2L4SA 1SHHB 3S69A 3A7TA 4CRCA 6LPRA 1UO6A 4BTIB 4OS6A 1ABIH 1G9IE 4B2CA 4E35A 2GV7A 4WYTA 2B7DH 4O97A 2D92A 1MTNC 1H8IH 3VGCB 1KLTA 2BY9X 1OZIA 1WFVA 3LGYA 1XUKA 1DVAH 2GD4B 2FO9A 2P8OB 2MHOA 3SV6A 1IU2A 3LU9B 2ZFFH 9ESTA 3SHWA 1D3PB 1ANDA 3OSYA 4Z33A 2RDLA 2JILA 1FY3A 1O2OA 2ZPLA 2QYIA 3HGNA 2NU3E 1WOFA 1TGCA 2H2CA 3BG4C 4ZUHA 2L4TA 1HAVB 2Y5HA 3UR6A 3UTUH 1HAPH 2JINA 2ZECA 1FPHH 4WH6A 4A6LA 1QBVH 2TGAA 1ESAA 1TX6A 4HOPA 1GGDB 1QCPA 3ZZ6A 4VGCB 3K6YA 3A83A 2Z9JA 3UR9A 1FONA 2KOJA 1RRKA 1LQEA 1G2MA 1O31A 4ABFA 1NS3A 3R69A 1C2JA 4ISHH 1FIWA 1TE0A 1NFXA 3RXDA 1IQMA 1W9QA 3E1XB 2Z9KA 2CGAA 2ZHWH 1NTEA 1X6DA 3RXVA 3BTHE 1FN6A 2YT7A 1DICA 2O8MA 2E7KA 5C20A 3SUFA 1OX1A 2I0LA 1JOUB 1LVOA 2ANWA 2KYLA 2YNAA 1V2VT 3UOPA 4O03A 4H42U 2HLCA 2H9TH 4R2ZA 2FS8A 1PPBH 2HRVA 4U2WA 2H5DA 1SGIB 2M0TA 3RXUA 3PM3A 1HIAB 2FOBA 2BZAA 3SOEA 4OS7A 4IS5A 1KXCA 6CHAB 1P3EA 1Z86A 1BBRH 1DFPA 1V1TA 3VQGA 1O5BB 4FUHA 4NCYA 4MTBA 4ABJA 1ETSH 2Q3GA 1C5MD 2DM8A 3KQEA 1K32A 2ZTYA 5ESTE 3VB6A 2Q9VA 1H1BA 2R9PA 2BYGA 4CH8B 2PKTA 1ZPCA 2HVXA 4XBDA 1V2JT 1P10A 2WL7A 1PPEE 1ZGVA 3RXPA 4MNXA 3RXCA 3RDZA 1EAWA 4NNMA 2BLQA 3PLPA 2G4UA 1EUFA 1GHXH 5EQSA 4X8UH 3SJKA 1WIFA 2D2DA 2O8LA 3CC0A 4HOPB 3LIWA 5T6FA 2V3HH 1GJ4H 3TU7H 1Z71A 4K76A 4MDSA 4Q2QA 2IWQA 1K1MA 2KV8A 1UJUA 1N1LA 4JOKA 3PLKA 3SHAH 1BA8B 3U98H 2FTLE 4AGJA 1K2I1 4UONA 4AMHA 3S7KB 1MD7A 2DE8A 1QBOA 5JBBS 4ZHAA 4D76A 1IQKA 3VB7A 1AHTH 1HNEE 1J8AA 1GCDA 1O2UA 2GVFA 4OEPA 1A0JA 3PMBB 1B5GH 2KJDA 2AINA 1C1MA 1LTOA 3S0NA 1NT1A 4K60A 1P0SH 1C5WB 4WWYA 4M7GA 3B9FH 1OP8A 5JDUB 1O2NA 1C1VH 3M7TA 4IN2A 1V5QA 2PNTA 3SZNA 4ZAEA 2EDZA 2BXUH 4X8SH 3SO3A 1ZHPA 2FODA 1G3EA 4AG2A 3I18A 3MMGA 2R3UA 4DVAU 2KG2A 4YLQH 2F9PA 2XW9A 4AYVB 4Q2PA 3K65B 1P2OA 1FY8E 1BQYA 1TQ3A 1C2LA 4X1QU 3CBYA 1NROH 1XUFA 4B1TA 3W95A 1VGCB 2RCEA 2OUAA 3TSZA 2QKVA 2XXLA 1CBWB 2I0IA 2OC8A 1EASA 1PPFE 1UVTH 1AVGH 4JZFH 1AKSA 2FMJA 2JREA 2YNBA 4Q6SA 1P1DA 4I8KA 5F03A 3FANA 1BDAA 4DGJA 1ID5H 1UTQA 3RP2A 1RJXB 2HE2A 1TNJA 2SNWA 3TSWA 3T29A 3PYHA 5I25A 2A5IA 1FZZA 1GHAF 2Z9LA 4YO9A 4YTAA 2AS9A 1S83A 3MH5A 3QDOA 2OS6A 3BPUA 3RXRA 3QGLA 1GBLA 4D8NA 2VB0A 1VJ6A 4DOQA 1UTJA 3RXSA 5JYIA 2VNTA 2DJTA 1C2GA 7GCHF 2AGIX 4GCHF 5E11A 3BIVH 4X1RU 1OYQA 4Y0ZE 3RM2H 3RU4D 1TFXA 3AVZA 1BJVA 3ZZ3A 1V2MT 4KTUA 1OBZA 2F5YA 1PQ8A 1NY22 2PSYA 3PV5A 2BVRH 1WTGH 1UK2A 5C5OA 3ZVGA 4YOJA 4ABAA 2C3SA 3MU8A 3GCTF 3SGQE 1K1LA 2ZI2H 5HM9A 1TMUH 3FAOA 1YC0A 1K1OA 1L4DA 3EAJA 2WPIS 1C5YB 3F1SB 3RLEA 1DPOA 2QN5T 3VQFA 4A5TS 2H3MA 1NRQH 1YCPM 2QKTA 2BD3A 2ZDAH 1TBQH 1B0EA 1BTUA 1Y5BT 2ZHQH 4BTTB 5E8EH 3RC5A 1O32A 1AKSB 1IOEA 2CXVA 4ISIH 2EGOA 1A2CH 2OC0A 2J38A 3MI4A 1N6XA 2GDDA 1O38A 1VJAU 3ZYEA 1J14A 2ZDKA 2ZQ1A 1UHPA 2CS5A 1NM6A 1O2ZA 2XBYA 1FIZA 5F67A 1VITG 1C5QA 3F6UH 2GP9B 1GJ5H 2BDAA 1C9TA 2J94A 4WJG2 2OQSA 1G3BA 1O3AA 3RXMA 3RU4E 1TONA 1AE5A 2OMJA 1DY9A 2RRMA 1WTHD 1P1EA 2STAE 3PLBA 1O2RA 4WF8A 4HGCA 2AGEX 2G00A 1O33A 3DHKH 2NU0E 1NRSH 2GGVB 3HVQC 4L8NA 3TGKE 1GDUA 5EZ0A 4I8JA 2F9OA 3RMMH 1TNHA 1X5RA 5T3HA 1QQ4A 5CE1A 5FBIA 3O46A 4A1TA 1ZPBA 2EI7A 2HNTC 1GJ9B 1SHYA 3E17A 1OWKA 1NFYA 5HEYA 4INLA 1D6WA 4AG1A 3LGUA 5T6DA 1YBWA 1GBAA 3K2UA 4NSYA 1C1WH 3RL7A 1H4WA 1BMLA 4SGBE 2XNIA 5TJXA 1TA6A 2QXIA 2C8ZB 1QRZA 1TOMH 1FPCH 4CR9A 3S9BA 4X1NU 1ELAA 1S82A 2XWAA 2LA8A 1ANBA 1PDRA 4ASHA 1TGBA 5L2ZH 4DURA 3K50A 3RXJA 4FUEA 1AFQC 1OWEA 1IQGA 1TGSZ 2A5AA 2H5CA 1H9LB 2UWOA 1UM7A 5FB8C 3K9XB 3UREA 2OCSA 4XDEA 2I1NA 5DGJA 4QT8C 4NMOA 1V2OT 1WU1A 1GDQA 3U9AH 2AYWA 2THFB 2JOAA 1Z8GA 2EEGA 1J9CH 4K3JA 4X8VH 1P3CA 2XWBI 3AAUA 1GHBF 3ZVAA 2JWEA 1P03A 4FUJA 4FXGH 1AWFH 5FBEA 1MTUA 5K0HA 1TPAE 2FNEA 3EA9A 4MPVA 4NG9H 3TK6A 3PS4A 3VGCC 2EGNA 4OS2A 3TGIE 1WH1A 2HPQH 1AY6H 1OS8A 2P8OC 3Q3KA 3RXKA 1O3IA 4LXBH 2GKVE 1DLKB 1GJAB 1ZTKA 3A8AA 3UNQA 2G52A 3H7OA 1FAXA 2BDIA 1PPHE 1EZSC 5DPAA 2PTCE 3A86A 1MCTA 2ANMH 4MPAA 2H1UA 1OXGA 1HDTH 2ZF0H 2ZU2A 1P06A 2OBOA 2PKAB 5EQRA 2Y81A 2PGBB 2Z6BD 1OPHB 1PYTC 1GGDC 4BAOB 2EEJA 4TPIZ 2DLUA 1SLVB 3KQCA 1BMAA 1O2WA 3GY8A 1FI8A 3P6ZB 3STIA 1ETRH 1FY4A 2W5EA 3UIRA 1C5TA 2ZPSA 1SQTA 2ZP0H 1R6JA 4BXSA 2FLBH 1WF7A 2GCTB 3ATKA 4Y8YA 5K7RA 2B5TB 1Q7XA 1FXYA 4UFGH 2GV6A 1UVUH 5J4SA 3PV4A 2RA3A 1SPJA 2WYGA 1LPKB 1GHZA 2FXRA 3KQBA 3AXAA 1BRUP 1AD8H 1S5SA 4FVDA 3CBZA 4CRBA 1UEQA 3G01A 1GJBB 1T7CA 4GVCA 3GDSA 1GI7B 6CHAC 4Q3HA 1D3TB 1FC6A 5EGMA 1O3DA 3LH1A 3U8RH 4XOJA 2R0KA 1PQ5A 5EPNA 1QBNA 2QXGA 3ENSB 1HXEH 3GJ9A 4KELA 3L4FD 1CT0E 2GT7A 1SMFE 1VJ9U 1GBKA 2REYA 2Q6DA 2M5TA 3SNAA 3RXBA 4YYXA 4I8HA 1D6RA 4E05H 3SV9A 1ZR0A 5G1DA 5JPMH 1N7EA 2LOBA 1GHAG 4KFWA 2EAQA 1F5KU 3RMOH 1V6BA 1E37B 5H4IB 1QFKH 2D8IA 1HJAC 2IWNA 1RIWB 5EOKA 1D5GA 2OC1A 1JMOH 3H5CB 5GDSH 4RKOB 2ANYA 1O2LA 2FS9A 3EGKH 1GBDA 4ZKOU 1GWAA 1XUGA 2NU4E 1K1JA 2OPGA 1VB7A 3CBXA 2BDGA 2ZC9H 7GCHG 2ZO3H 4GCHG 1Y3YA 4I31A 2QG1A 1SGFG 4K75A 1GJCB 1UTNA 4HTCH 5C1YA 4ZKSU 1JXPA 4CREA 4TY6A 3RXLA 3SU1A 1O2GH 1L1JA 1UJ1A 2OTVA 3QLPH 3ZZ4A 2M10A 1EJMA 3K1RA 2OQUA 1YF4A 3SJOA 4NMSA 1SVPA 1QRXA 3QZRA 4JOJA 1GVLA 3LGIA 5HF1A 4EDJA 1MBMA 1W12U 1GI4A 2OD3B 3LKWA 3GCTG 2HOBA 1KXEA 2JIKA 4MNVA 3MU1A 2D1JA 1S0RA 4I7YH 1DXPA 1O3BA 3JZ1B 1V2LT 2QV1A 4FU9A 4X8TH 1ZOMA 2G81E 1UTPA 3V13A 2P3WA 2Y82A 4X2WA 3AW1A 3LH3A 3UQOA 1TPOA 3EGGC 3ZVDA 2ZKSA 3PTBA 7LPRA 1OBYA 3PWCA 4JOPA 1Z7KA 1BITA 5A0BA 3SJIA 4OGYA 1Q2WA 4KTCA 1AZZA 3BTTE 2P3TB 2OBQA 4NWLA 1MBQA 5JBTA 1RTFB 3RC4A 4IC5A 1SGTA 1O34A 2Y6TA 5HFEA 4X1PU 2PV9B 5FX5A 4A7IB 1QA0A 1IQJA 1SI5H 2GT8A 3P8NA 1G37A 1HAVA 4Z0KA 3OTJE 4Q7YA 1P2IA 3GISB 5EW1H 1LHGH 1U37A 4ZROA 3M36A 2J2UA 4XE4A 5HMAA 3UY9A 1GI1A 1SLUB 1YPJH 1N6EA 3DORA 1GHVH 2OCVB 3E8LA 4FUCA 4OS4A 4D9RA 2CSJA 1AIXH 1O37A 3LOXA 4UD9H 5HFCA 5L2YH 1G3DA 3URDA 3MH4A 2FOEA 4WYUA 3DIWA 1TIOA 1N7TA 3QJNA 2YOLA 3TITA 1U3BA 1J16A 3MHWU 1BZXE 1MFGA 1HAOH 1RS0A 4ABDA 1FC7A 1O2QA 3A85A 1O2SA 1UVPA 4Y11E 2QXJA 2BZ6H 4YOIA 3ZZ8A 1C4U2 1FJSA 4YLUA 2CSSA 4AFQA 1O2MA 3TGJE 1Z8JB 1HAHH 1F92A 1GPZA 2G51A 3RMNH 1RGQA 3FP6E 1DWCH 4LK4A 1MTSA 4CRFA 2VIPA 1HIAA 4GSOA 4YT6H 1VR1H 1LVBA 2I4SA 3ATIA 3KHFA 3D23A 1O3PB 1DS2E 2V3OH 1M9UA 5AHGH 5CMXH 1Q3PA 1O3OA 3I29A 2SGAA 4NNLA 3LPRA 3Q3XA 1YPLH 1SGPE 4CRAA 3ITIA 3SQHE 1WAYB 2BY7X 4JK5A 1JBUH 4A1VA 1QIXB 3LGTA 1QL8A 2WUBA 3O8CA 5I7ZA 3O8BA 4H11A 3PROA 2ASUB 3RXQA 4ABIA 1UF1A 2SGFE 1G32B 1SGEE 1SGYE 5J4QA 1SQAA 1BTXA 1XVOA 2VGCC 4I8LA 3M3TA 1GHBG 1THPB 2OXSA 2AMDA 2SGDE 1NO9H 5F8XA 3TMHA 4JYVH 3RM0H 3VPKA 3R0FA 4Q6HA 4G69A 1VCWA 2QF3A 3GCOA 1P2NA 3ZVBA 5DKMA 2FOCA 1F7ZA 1TNIA 3MH7A 2JH6D 1RTKA 1BCUH 5GPIB 1JIMA 4A1XA 2EHRA 4IC6A 3NZIA 4IMZA 3QJMA 4FU8A 1K22H 2QC2A 4ISLA 1C2DA 1UTKA 1YCPK 3UWIA 4GAWA 4CHAB 1F0TA 1IHJA 3QZQA 3BV9B 2GZ9A 3AW0A 4PQWA 3A87A 2VH0A 1QNJA 2H6MA 1NPMA 2QKUA 1UTLM 3KHVA 2H2ZA 1MKWK 4BTUB 3K6ZA 4ZXYH 1X5QA 1MZDA 3DJ1A 3D62A 1Z87A 1O2IA 1A46H 4JCNA 1V2QT 1O3FA 3PTNA 2BVXH 4LZ1H 3LDXH 2QY0B 1L4ZA 4B2BA 1HAXB 3KQDA 1UTOA 5E22A 1WSSH 1ELVA 1DLEA 4GPGA 1EATA 1OWIA 5GCHG 2ZFPH 2XCNA 2OGPA 4K78A 1TYNA 1KEFA 1C5NH 3SBKA 1UTMA 3OY6U 3KF2A 3BTKE 1O5FH 1H8DH 3ZVFA 3F9HA 1NF3C 5E2PA 3KZDA 2B0FA 2FOHA 1WFGA 3EA8A 4TWWA 3QWCH 3SW2B 3SN8A 1HXFH 4GLYA 4X1SU 1AQ7A 5LH8A 2Y5GA 2H9HA 2QGRA 4FVBA 1P2MA 1EP5A 4Q80A 1HJAB 4ABBA 3A84A 5DP5A 2BMGB 4IGDA 2FPZA 4KP0A 3ELAH 4UEHH 4KKDA 3BEUA 3L33A 4H6TA 2KQFA 2W3IA 5EQQA 1Q31A 1QL7A 2QBWA 3ATWA 3TJNA 4B76A 1NESE 4JMYA 2KAWA 1CE5A 3GDUA 2XCFA 3CH8A 1TX7A 1EQ9A 1F0SA 2BQ6B 1ZGIA 1N6FA 2FI4E 3EYDA 3SV7A 2P95A 3I77A 3E90B 4GVDA 1QL9A 2ZEBA 3GY7A 2K20A 8LPRA 1C1UH 3BTWE 1MKXK 3KN2A 2A5KA 4P0CA 1TNKA 3KL6A 3QUMP 4NSVA 3FVFB 1AWHB 2F9BH 1C1QA 2KOMA 1BJUA 4ZHLU 4AB9A 1K28D 1TGNA 1BTHH 2G5VA 4NZLA 2G5MB 4ZMAH 2NU2E 1ZHMA 2Z9IA 3T28A 5D13A 2VZ5A 3RXAA 5F8ZA 2V0BA 4ESTE 2GCTC 3KEEA 3L3TA 3QGJA 5C5NA 2A7JA 2ZZUH 4ABEA 4RN6A 2EJYA 5FCKA 1HJ9A 2LC6A 1O2TA 1TPPA 4Z6AH 1AN1E 3TJOA 1DUAA 1ZHRA 3A7XA 2BLWA 2R4HA 2ZCHP 3MNSA 4NMVA 2BTCE 4NA7A 2ZPQA 4WH8A 2A2XH 2TRMA 1HCGA 5IYTA 5GXPA 1TABE 3SV8A 1DOJA 1QURH 1A3BH 3C27B 3TH3H 1JWTA 4FUFA 1RFNA 3M5LA 1Y3XA 4DT7B 1UK3A 1F5LA 1XKAC 4BAQB 4MPXA 1P02A 5E0JA 1BE9A 2BD8A 1A5HA 4B73A 1KSNA 2VIDA 1YM0A 2AGGX 2DUCA 1AFEH 2SGPE 2NU1E 3A88A 4KGAA 2YUBA 2JXOA 1IQFA 2V90A 4YM9A 5E6PB 2W7RA 1FUJA 1G9OA 1L1GA 4DIHH 3GY4A 3KZEA 1C5ZB 1KIGH 1IQIA 1HAZB 2AMQA 4NXRA 4B2AA 1EOJA 5GJ4B 1WHAA 1T4VH 4XBCA 1TRMA 1RIWC 2FOMB 2PR3A 3ESTA 4JZEH 3MFJA 1GM1A 3ZVEA 1TP5A 2VPHA 1C5LH 1IAUA 3DJ3A 1DITH 2FIRH 3FZZA 2BDYA 3NUMA 1G2LA 3R68A 4E3BA 1YPEH 1BFEA 1EB2A 2VSVA 1P2JA 4WXIA 5JBCS 3RMLH 1BMMH 1ACBE 2SGEE 1GMHF 2J92A 2Y7XA 4ISNA 1C2IA 2EXGA 3I4WA 3PDZA 1CHOG 1MTVA 3QTVH 2BY8X 4JOHA 2EDVA 1QAUA 3U1JB 1ZJKA 3A7VA 3BSQA 4WY3A 3URCA 2JETB 3BF6H 2PHBA 2VU8E 1V2TT 3ZYDA 3Q76A 4X6MA 2J4IA 1BB0B 1X5NA 2IN2A 3Q00A 1O5CB 2XBVA 1UVSH 1J15A 1P09A 4GHQA 2VIWA 1BTZA 2BQWB 2VGCB 1GHWH 3SUZA 4J1YA 3ZZ5A 1QR3E 4HFPB 1SGDE 2BQ7B 2P94A 1BHXF 1S6FA 3BEFB 5FAHA 1GBJA 1V2UT 1QJ6B 2OC7A 4NFFA 3LT3A 4B74A 1W9EA 3DUXH 3CYYA 1BUIA 1W7GH 2G2LA 1A61H 2C93B 3SU2A 5HFBA 1GJ6A 2A4OA 2OQ5A 3SGBE 1ZTJA 1HLTH 2DB5A 3NFKA 1D4PB 5DP3A 2GZ8A 4UU5A 1XKBC 2IWOA 1P2KA 4DY7B 2Y5FA 1SFQB 1T31A 1EKBB 1GQ4A 1DXWA 1YYY1 2O2TA 1O39A 1P01A 1XM1A 4LOYH 1I16A 3ZZBA 5FPTA 1SFIA 1D9IA 1TALA 4DG4A 2PKAA 3HPKA 1CHGA 2WV5A 3TK9A 4Y76A 1C4V2 1QJ7B 1CT4E 4H4FA 2KPKA 4H6SB 2ZFRH 4JL7A 3SFJA 4MLFB 2VWMA 3QDZB 1TNLA 3SU3A 3FFGA 2BD7A 1N7FA 5C67A 4TY7A 3AAVA 1TQ7B 2HWLB 4X6NA 2A32A 1K9OE 1DDJA 3DFJA 1O35A 3VXEH 1RGWA 1AUJA 1SLWB 2SGQE 4JOFA 1LDTT 1LVMA 1MCVA 3F9GA 1YCPH 2WPMS 2AFQB 2VRFA 2ZTZA 2YTWA 1EJAA 2PUQH 3RXGA 2ZU3A 1A7SA 2FN5A 2Q6FA 2SFAA 1P9UA 1B8QA 3TJUA 5JBAS 1C5SA 1QJ1B 1QHRB 3OYPA 2F9NA 3EQ0H 5F8TA 2BD5A 1MKWH 4MPWA 4THNH 1T8MA 3LJJA 2DE9A 1X8SA 3HGPA 2Z9GA 1W3CA 2M0UA 1ELTA 4FUIA 1KDQB 2Y7ZA 5DP4A 1OWHA 1C2EA 1AB9B 2KAIB 1WI2A 1GI3A 4AZ2B 1DM4B 2FEQH 2WV4A 3TSVA 1ZSKA 2D26C 5FCRA 3V7TA 1BOQA 2A7CA 4I33A 3E16B 3ID1A 1ZRBA 1NU9A 1V3XA 1ZMLA 4X2XA 3BTME 1O3MA 1FCFA 4AX9H 2A0QB 1Y5UT 2XBWA 2GX4A 2ZHDA 2RCZA 3MOCA 4CBNA 4Y10E 4UFEH 2FP7B 4ZHMU 1ZPZA 1SG8B 1RY4A 1TMBH 1EXFA 2LC7A 1QRWA 2ZDLA 4IBLH 1EAUA 1H9IE 1K21H 1A5GH 2LPRA 3LGWA 1YPGH 3Q77A 1ZJDA 4NWKA 3UNSA 3UNRA 1T2MA 4CHAC 5GCHF 2HGAA 2G8TA 4YZUA 1GG6B 2O8WA 2TGPZ 1K1PA 3VB4A 1OWDA 3SU5A 1S81A 1Y3WA 1YLDA 3FP7E 2VINA 3GY3A 3GCNA 1N6YA 1EZXC 1I92A 2ESTE 2AIPA 5C3NA 1MKXH 1ZTLA 1C5OH 1AMHA 1D3DB 3RUOA 1UM1A 1O3LA 1PJPA 2J95A 1ESBA 3B76A 2A4QA 5FX6A 2ZU1A 1AU8A 3PO1B 3ZV8A 5BRRE 2CHAB 2TGTA 3ATLA 1G3CA 1JRTA 1LKBA 1S84A 1IHSH 2VWNA 1UHBA 2BD2A 3ZZ9A 1MD8A 2BY5X 2ODYB 3A7YA 5I46H 3ZZCA 1KWAA 2CMYA 1C1RA 2BDHA 1P04A 2KJKA 2BDCA 2FX4A 5DG6A 4NMQA 2GCHF 2V6NA 3IITA 1KTTB 2GZ7A 2ZU4A 1TRNA 3HATH 1UJVA 4NGAH 5DP6A 1EP6A 2Z94A 4BAHB 2PW8H 3RLYH 4Y7AA 1HRTH 5GIBA 1Y3UA 2WYJA 1CO7E 3F9EA 4SGAE 4CR5A 1KTSB 2QT5A 3SUDA 1W13U 1HAYB 2CN0H 3I78A 2NWNA 3F9FA 1GHYH 2GMTB 3EE0B 2ODPA 3MNXA 2ZA5A 1SR5C 4OS1A 2ZGJA 5G1EA 2X7ZA 3W94A 1GI0A 4DIIH 4XBBA 1W9OA 1WF8A 1SC8U 2O8TA 4IW4E 3TPIZ 4F4OC 2AWXA 1RTLA 1BMNH 4X0WU 1FV9A 1Y8TA 1NRRH 2Z3EA 1YPHC 3SNBA 2ZDMA 1FNIA 2GDEH 5A2MH 3WKMA 1JRSA 3QTOH 5LGOA 1W0ZU 3P92A 5SGAE 1GMHG 1XVMA 2AERH 2BLVA 3A8CA 4B75A 4E34A 1NTPA 1UMAH 4K6YA 3SNEA 1FN8A 1UHBB 1KLIH 2C8YB 3ZV9A 5EW2H 3R0HA 5EXLA 1NRNH 1MC7A 1O3NA 1N99A 2XBXA 4FUDA 1MMJN 1GI6A 1Q3XA 4FGMA 1SB1H 2UUYA 3U8OH 3OU0A 2V35A 4NZQA 1IHTH 2D90A 1WUNH 4O3UA 1IQNA 1C5RA 4NMRA 1UEZA 3ID2A 3SV2H 1CGJE 5CHAB 3BTQE 1C2HA 2A4RA 1V2WT 2ZNKH 2I6QA 4NIYA 1ZZZA 1V5LA 2MX6A 5EPYA 3PV2A 4YDPA 1W7XH 1THRH 4NXPA 5DO4H 1HBTH 1GQ5A 1DX5M 3NGHA 2KL1A 5A2PA 2VWLA 4FUGA 3WKLA 4U30A 3GCHC 4R8TB 4INHA 4RKJB 3V12A 4OS5A 1QTFA 2LUIA 2Y80A 3P8OA 3TK5A 1CHOF 3UFAA 2A1DB 3NFLA 1T4UH 1C1TA 3GY6A 1W14U 3BTEE 3FP8E 1FC9A 1XZ9A 3PWBA 1EZQA 1KXAA 1C4Y2 1WYKA 4IMQA 4AFZA 3PDVA 1ZUBA 5L6NH 1TGTA 1FAKH 2M3MA 1E0FD 3QO6A 2PDZA 1EZUC 5EU8A 2P59A 5A09A 3TLOA 5HF4A 2F91A 2DMZA 1Z6JH 1Q3OA 2EI8A 5DK1A 3UUZA 4I32A 1QAVB 1LHCH 1OP2A 2H9EH 5A8ZA 3SI4H 3GDVA 1YPKH 1BRCE 1TMTH 5EG4A 4N6XA 1QB1A 8KME2 1CA0B 1PPCE 5HXFA 2QIQA 5ETXA 2HNTF 5C1XA 2G55A 2Q6GA 1LHEH 2ZU5A 2JETC 4HI3A 3HPMA 1KXBA 2A45B 5HDYA 3T27A 1MQ6A 2OSGA 1C5PA 3IWMA 4NA9H 2EEIA 1CT2E 2EGKA 2YUYA 1Y59T 1XXFA 2OZFA 2HPPH 3GY2A 1Y3VA 2Z3CA 2ZHFH 1Z8RA 1L6OA 5HGGA 5TCCA 2WPKS 1PYTD 1C2MA 2TGDA 1KYNA 1O3EA 3MO9A 3DJAA 1EPTB 3DT0H 2VJ1A 2K1ZA 5HETA 1SGQE 4UE7H 3UWJH 3JZ2B 1T8NA 7KMEH 1T8LA 4X6OA 1LPGB 1V2ST 1BRAA 3H7TA 3MNCA 1O3KA 1TLDA 1UCYK 3BTGE 1GMCG 5IDKA 1C1PA 1C1NA 4GHTA 5FHTA 4I8GA 1TAWA 4K8BA 5EXNA 4WXVA 1BRBE 1MH0A 3MH6A 2FLRH 3E0PB 4OGXA 4CH2B 1UJDA 2FM2A 5ABWA 3UQVA 1AVWA 1O3HA 1OBXA 2ZDVH 1FY1A 2WPHS 4XSKU 1P11E 4ZH8A 1A1RA 1HB0B 1X7AC 1P57B 1C9PA 5GLJA 3QX5H 4X2VA 1DT2A 4R0IA 4WMFA 2UWPA 1INCA 2L97A 2M0VA 5JB9S 1O2PA 4K5ZA 1K1IA 1GJDB 2BX3A 3KNXA 3MO3A 3GICB 4GHNA 1MFLA 2LNCA 5FPSA 5DTHA 1V2NT 1NU7B 2WPLS 1GI8B 1O2JA 1S0QA 3S9CA 1YPMH 1T32A 4AFUA 4CBOA 1GI2A 2AWUA 1W10U 5C1UA 2KBSA 3GGEA 3MTYA 1MZAA 4CRDA 1KLJH 1VITH 1SGFA 3TVJB 1A4WH 1LQDB 2J9NA 3M5MA 3A8DA 5DJ7A 2F0AA 4JZIA 1GL0E 1ABJH 1QQUA 3HK3B 3D65E 2I6SA 3ID3A 1O3GA 2A4GA 1O36A 2BXTH 3CS0A 5HFDA 1TBRH 1DWDH 2TIOA 1ORFA 4XHVA 1XUIA 4JORA 3UOUA 3BEIB 5PTPA 1MQ5A 3MNBA 4HZHA 1GMDF 1DY8A 1OYTH 1ZLRA 1O3JA 2XC4A 1AB9C 1WJLA 1ELDE 4MQAA 5B6OA 1O5GH 4GUXA 3CENA 1CGHA 5G4BA 6GCHF 2VIQA 2FTMA 1TPSA 3R3GB 1L1NA 1EOLA 2SNVA 4X2YA 3STJA 1ZMNA 3BG8A 3LC5A 1ANEA 1IU0A 2W4FA 1A0LA 1NN6A 1CA8B 1AE8H 1O5AB 1SSXA 1GVZA 2XYAA 2JH0D 4IN1A 2BM2A 1L2EA 3HKIB 4B71A 4DW2U 2ZTXA 2ZGHA 4DCDA 1P05A 2GCHG 1X45A 1Z1IA 2ZFSA 2PKUA 2ODQA 1W8BH 7ESTE 2PKSB 3RC6A 1NRPH 2BD9A 3NCLA 4INKA 1QY6A 2ZCKP 1V62A 4BOHA 4K8YA 3SHCH 1FY5A 3S7HB 4NXQA 4Y8ZA 2F3CE 2IWPA 2BX4A 1BTWA 2BYAX 2C4FH 1WQVH 2BLOA 3I1EA 2ANKH 2PSXA 2DC2A 1W2KH 2EV8A 3RL8A 5HEBA 1TBZH 1GG6C 1GVKB 2FDAA 4ISOA 2TPIZ 5EODA 3PMAB 1XXDA 3P95A 3SJ9A 5AFZH 3T5FH 1GBTA 3IG6B 3VFEA 1UITA 1O2HA 1VCPA 1Z6EA 1EAXA 1N8OC 1YLCA 3B23B 3GOVB 4TWYA 1YPHE 5HJ1A 1BT7A 1LHFH 3P70B 1F2SE 3A8BA 4Q2NA 1AO5A 1ARBA 1SLXB 1WQSA 2VIOA 3T26A 4LZ4B 1A0HB 2F9UA 3PO1C 3RLWH 3SGAE 1GBIA 2AIQA 1V2PT 2CHAC 3VEQB 2FCFA 5HYOA 1Z1JA 2CJIA 1O2VA 3RXIA 2VWOA 4K72A 5ESBA 4FUBA 1AVXA 2WUCA 1KY9A 1OWJA 4Z8JA 1UCYE 3GCHB 4MG3A 1HAIH 4JYTA 4JK6A 3LJOA 1XUJA 4AN7A 4UDWH 3MU4A 3QGNB 1A3EH 1NZQH 1ZOKA 2WPJS 2DKRA 1HPGA 1ELFA 1BHXB 1GBFA 1RD3B 2P93A 1TWXB 4UU6A 3TNTA 3SOSA 2ALPA 3DD2H 3NKKA 4AFSA 1XX9A 4WVPE 1UVOA 2ZGCA 2DAZA 8GCHF 5B6LA 2EEHA 2A7HA 2PFEA 1D3QB 2VVUA 3LNXA 2VH6A 3RXTA 3LC3A 1YBOA 3E3TA 3LONA 1VA8A 1C2FA 1XUHA 2ZQ2A 4O9VA 2BDBA 2QAAA 4ZXXH 2ALVA 4AOQA 3M3SA 2GMTC 2ZG0H 4D7FA 1ELEE 4NIVA 1MTWA 1E36B 4K1SA 2I6VA 3TJVA 2STBE 1V2RT 3GYLB 5A0CA 2HGTH 1Z8IB 4CRGA 3E91A 3SUGA 3KCGH 1P12E 1GBBA 3S9AA 1LCYA 5FPYA 3VB3A 2G4TA 1QLCA 1MTNB 1ZRKA 1E35B 3ZVCA 3ZZAA 4YOGA 9LPRA 1TP3A 2M0ZA 4ZKNU 2R2WU 3OTPA 2R3YA 1A5IA 1GCTC 3QN7A 1KDQA 2C8WB 2B9LA 2VIVA 3U69H 1C1OA 5LPFA 1Y7NA 4YESB 1WG6A 1CVWH 2UUJB 2KAIA 2FOGA 4K1EA 4AORA 3LNYA 1UEWA 1TQ0B 1IQHA 1K1NA 4KFVA 1WHDA 4Q2KA 5LPRA 2P3UB 1XMNB 2FOAA 2ZGBH 3BG4B 3NK8A 1C5VA 1ESTA 2A31A 2CF8H 1CQQA 2AWWA 2H3LA 2ZPMA 1MAXA 3K82A 1G36A 2R2MB 4TPYA 1TA2A 3P8GA 3SI3H 4BANB 5F6MA 4AYYB 1GI5A 1LMWB 1YGCH 4WMDA 1YP9A 1C5UA 2C90B 1WI4A 1VZQH 2JKHA 4U01A 1LKAA 3TIUA 4Y6DA 5CHAC 1HAGE 2P16A 4MPUA 1HJ8A 1N6DA 2QXHA 1BTPA 1BTYA 1U38A 1PQ7A 6ESTA 1DWEH 3M61U 3N7OA 3U1IB 5E21A 4Q7XA 3ZZDA 3A89A
chains in the Genus database with same CATH superfamily
3SNDA 2KRGA 3BN9A 1AZ8A 4UFFH 1VAEA 3A7ZA 3V0XA 1E34B 3CS7A 1UCYH 1LPZB 4BAKB 3RXEA 1DSTA 2W7SA 3RXHA 3U8TH 2AH4X 1ELBA 2QA9E 2VVVA 3M5NA 1O5DH 3SU4A 3M7UA 5A8YA 3EA7A 4TYDA 1QZ8A 2ZDNA 1V2KT 1MU8B 4Q2OA 1HGTH 2FX6A 2C8XB 2PTNA 1O2KA 5AF9H 2CV3A 2DLSA 2UWLA 1B0FA 2ZGXH 3SZEA 3MU0A 3RU4T 2VSPA 5EYZA 2ILNA 5JB8S 1U6QA 1ZMJA 3A80A 2WV9A 3SUEA 2W26A 3ODFA 1CA0C 1DANH 2ENOA 8ESTE 1UEPA 2R0LA 1RXPA 4E06H 1GMCF 4OEOA 3M37A 1PFXC 1RGRA 5BPEA 3NXPA 1VCQA 1CSOE 4K69A 1BIOA 1EB1H 2A2QH 1CGIE 2GZVA 1ZSLA 3MQKC 2JJ2D 1RZXA 3GYMA 3T62A 3JXTA 3TNSA 5L30H 5E2OA 4Y79A 1L0ZA 3A82A 4DJZB 2FYQA 4LMMA 2W7UA 1EPTC 1SGCA 3ZRTA 5GNDA 2FE5A 1GMDG 3V3MA 3M5OA 4ABGA 5AVDA 1WBGB 3FZDA 2D8WA 3A7WA 4ZKRU 1NC6A 3E6PH 6GCHG 4ABHA 1GL1A 3ID4A 2JH5D 2G5NA 1OSSA 2UUKB 2PWXA 1THSH 1C2KA 3QK1A 1O3CA 1GI9B 3QE1A 4Y0YE 5CHBA 1MUEB 2VVCA 4WMEA 2ZHEH 5GWZA 4NIXA 4VGCC 2FYRA 1SGRE 2K0QA 3VB5A 4D7GA 1BBRK 4MVNA 4RI0A 3OY5U 2PGQB 2BY6X 3D49H 1O30A 1N8OB 3EDXB 3SU0A 2J34A 1PPGE 1SL3A 3O8DA 3RXFA 3ZZ7A 5C2ZA 1TOCB 3FY5A 2CF9H 5DP7A 5E0HA 2FI5E 2PLXA 2BOHB 4FETA 1P2QA 4Y7BA 1TB6H 4JOEA 4NMTA 2IJOB 4U32A 1PPZA 2H2BA 1AGJA 2EI6A 1C1SA 5HFFA 5IK2D 1Y5AT 1IQLA 2FOFA 2IOTA 1OKXA 2BHGA 4JYUH 1HUTH 1HYLA 4JZ1A 2YT8A 3AASA 3HPTB 1QA7A 3ODDA 4F48B 1EAIA 3MYWA 4UFDH 1QB9A 2F83A 3GSLA 2XC5A 1ARCA 3TH4H 1EX3A 1GBHA 2I04A 2EC9H 3NWUA 5DP8A 1F5RA 2KPLA 2EQNA 2F9VA 5F3XA 1WCZA 2QCYA 1SBWA 4BNRA 4BAMB 2Z7FE 3DA9B 3LGVA 1V6DA 3PMHB 2HE4A 2WINI 4TSFD 2WPDD 2Q1JA 1O2XA 1DE7H 3DSPA 1O2YA 2FESH 2ULLA 1IQEA 2KM0A 3VXFH 1ZSJA 3SQEE 3GABA 5AFYH 1E38B 2BD4A 2EEKA 3BIUH 4JZDH 3A81A 3DFLA 1FQ3A 1DSUA 3M35A 1AUTC 2O8UA 2OP9A 3KYFA 3PMJA 4J2YB 2BB4A 4E7NA 2P3FH 4K2YA 4PROA 1TNGA 2ZCLP 2XC0A 1T8OA 2K1QA 4P2AB 1UFXA 2FWWA 4O06A 4REYA 2ZWLH 5HM2A 2KA9A 1GBMA 4GVUA 2PKSC 3SORA 2UZCA 3CP7A 2BVSH 3RXOA 4AGKA 1FX0B 1W0YH 1HV7A 5E1YA 3KIDU 2W3KA 2Z17A 8GCHG 2TBSA 4RSPA 2AMPA 1F0UA 1P8VC 4XFQA 1GJ7B 3SNCA 3F0OA 5JXBA 4YT7H 3NPSA 2W6JD 4Q7ZA 1QAVA 3SHUA 1AI8H 3MWIU 1GCTB 1KXDA 2PA1A 2IPHA 4O3TA 4OAJA 3KQ5A 1DUEA 1WV7H 3ATMA 1M5ZA 4JOGA 1ELGA 1FMGA 3HK6B 3SU6A 1U39A 3L6PA 5TCAA 4F8KA 1J17T 3F68H 3AK5A 4K1TA 4MNYA 3BTFE 3T25A 3TH2H 5F53A 2ZFTA 3QIKA 4KTSA 2RG3A 1SQRA 1JIRA 1S85A 1FLEE 1MAYA 1O5EH 1UK4A 3WY8A 1TRYA 1VGCC 5A0AE 1EPTA 1SGNE 2GTBA 4NA8A 1FDPA 1GBEA 1YWUA 1LO6A 1S6HA 3OX7U 1CBWC 1SQOA 4X6PA 3GY5A 4FU7A 2KJPA 1OOKB 1OP0A 2Z3DA 3P8FA 3Q3YA 1EJNA 4Y8XA 1ETTH 3MU5A 5HKKD 3MO6A 3SJ8A 2V1WA 3EGHC 3BTDE 5A8XA 1KXFA 1LHDH 1MU6B 1NFUA 1SOTA 3KGPA 2RA0A 2PUXB 5DP9A 1E79D 3M3VA 2PZDA 2XTTB 3UPEA 4MNWA 4BXWA 5EXMA 4D9QA 3HKJB 4NMPA 5H3JA 1GDNA 4NFEA 3O8RA 1PQAA 2AEIH 5LPEA 1DWBH 2HALA 4AB8A 1C5XB 2FI3E 1NFWA 4NIWA 1TX8A 1SOZA 5FXLA 1BBRE 2FZZA 2BOKA 2OLGA 2QF0A 3C1KA 2UUFB 2HNTE 1AFQB 4F49A 2EDPA 3O5NA 5E0GA 1O0DH 4RT1A 1ZYOA 1B7XB 4E7RG 2B8OH 1YKTA 1ELCA 2XRCA 1QGFA 5HEDA 4Y71A 2EA3A 2KOHA 2ZPRA 1HFDA 1F0RA 4FLNA 1LVYA 1ANCA 1GBCA 2O9QA 1GJ8B 3M7QA 2OINA 1P9SA 2VWRA 1CU1A 3T2NA 2ZIQH 5T6GA 1QB6A 2ZFQH 1G30B 3P17H 1VITF 3E0NB 3PB1E 1W11U 4A92A 1H9HE 3B8JA 2L4SA 1SHHB 3S69A 3A7TA 4CRCA 6LPRA 1UO6A 4BTIB 4OS6A 1ABIH 1G9IE 4B2CA 4E35A 2GV7A 4WYTA 2B7DH 4O97A 2D92A 1MTNC 1H8IH 3VGCB 1KLTA 2BY9X 1OZIA 1WFVA 3LGYA 2WHXA 1XUKA 1DVAH 2GD4B 2FO9A 2F43B 2P8OB 2MHOA 3SV6A 1IU2A 3LU9B 2ZFFH 9ESTA 3SHWA 1D3PB 1ANDA 3OSYA 4Z33A 2RDLA 2JILA 1KMHB 1FY3A 1O2OA 2ZPLA 2QYIA 3HGNA 2NU3E 1WOFA 1TGCA 2H2CA 3BG4C 4ZUHA 2L4TA 1HAVB 2Y5HA 3UR6A 3UTUH 1HAPH 2JINA 2ZECA 1FPHH 2KCAA 2K8IA 4WH6A 4A6LA 1QBVH 2TGAA 1ESAA 1TX6A 3EE7A 4HOPA 1GGDB 1QCPA 3ZZ6A 4VGCB 3K6YA 3A83A 2Z9JA 3UR9A 1FONA 3OFND 2KOJA 1RRKA 1LQEA 4XD7D 1G2MA 1O31A 4ABFA 1NS3A 3R69A 1C2JA 4ISHH 1FIWA 1TE0A 1NFXA 3RXDA 1IQMA 1W9QA 3E1XB 2Z9KA 2CGAA 1EFRD 2ZHWH 1NTEA 1X6DA 3RXVA 3BTHE 1FN6A 2YT7A 1DICA 2O8MA 2E7KA 5C20A 3SUFA 1OX1A 2I0LA 1JOUB 1LVOA 2ANWA 2KYLA 2YNAA 1V2VT 3UOPA 4O03A 4H42U 2HLCA 2H9TH 4R2ZA 2FS8A 1PPBH 2HRVA 4U2WA 2H5DA 1SGIB 2M0TA 3RXUA 3PM3A 1HIAB 2FOBA 2BZAA 3SOEA 4OS7A 4IS5A 1KXCA 6CHAB 1P3EA 1Z86A 1BBRH 5DN6D 1DFPA 1V1TA 3VQGA 1O5BB 4FUHA 4NCYA 4MTBA 4ABJA 1ETSH 2Q3GA 1C5MD 2DM8A 3KQEA 1K32A 2ZTYA 5ESTE 3VB6A 2Q9VA 1H1BA 2R9PA 2BYGA 4CH8B 2PKTA 1ZPCA 2HVXA 4XBDA 1V2JT 1P10A 2WL7A 1PPEE 1ZGVA 3RXPA 4MNXA 3RXCA 3RDZA 1EAWA 4NNMA 2BLQA 3PLPA 2G4UA 1EUFA 1GHXH 5EQSA 4X8UH 3SJKA 1WIFA 2D2DA 2O8LA 3CC0A 4HOPB 3LIWA 5T6FA 2V3HH 1GJ4H 3TU7H 1Z71A 4K76A 4MDSA 4Q2QA 4F55A 2IWQA 1K1MA 2KV8A 1UJUA 1MABB 4JOKA 1N1LA 3PLKA 3SHAH 1BA8B 3U98H 2FTLE 4AGJA 1K2I1 4UONA 4AMHA 3S7KB 1MD7A 2DE8A 1QBOA 5JBBS 4ZHAA 4D76A 1IQKA 3VB7A 1AHTH 3FN8A 1HNEE 1J8AA 1GCDA 1O2UA 2GVFA 4OEPA 1A0JA 3PMBB 1B5GH 2KJDA 2AINA 1C1MA 1LTOA 3S0NA 1NT1A 4K60A 1P0SH 1C5WB 4WWYA 4M7GA 3B9FH 1OP8A 5JDUB 1O2NA 1C1VH 3M7TA 4IN2A 1V5QA 2PNTA 3SZNA 4ZAEA 2EDZA 2BXUH 4X8SH 3SO3A 1ZHPA 2FODA 1G3EA 4Q4LA 4AG2A 3I18A 3MMGA 2R3UA 4DVAU 2KG2A 4YLQH 2F9PA 2XW9A 4AYVB 4Q2PA 3K65B 1P2OA 1FY8E 1BQYA 1TQ3A 1C2LA 4X1QU 3CBYA 1NROH 1XUFA 4B1TA 3W95A 1VGCB 2RCEA 2OUAA 3TSZA 2QKVA 2XXLA 3VG8A 4YXWD 1CBWB 2I0IA 2OC8A 1EASA 1PPFE 1UVTH 1AVGH 4JZFH 1AKSA 2FMJA 2JREA 2YNBA 4Q6SA 1P1DA 4I8KA 5F03A 3FANA 1BDAA 4DGJA 1ID5H 1UTQA 3RP2A 1RJXB 2HE2A 1TNJA 2SNWA 3TSWA 3T29A 3PYHA 5I25A 5KEDA 2A5IA 1FZZA 1GHAF 2Z9LA 4YO9A 4YTAA 2AS9A 1S83A 3MH5A 3QDOA 2OS6A 3BPUA 3RXRA 3QGLA 1GBLA 4D8NA 2VB0A 1VJ6A 4DOQA 1UTJA 3RXSA 5JYIA 2VNTA 3UB0A 2DJTA 1C2GA 1E1QD 7GCHF 2AGIX 4GCHF 5E11A 3BIVH 4X1RU 1OYQA 4Y0ZE 3RM2H 3RU4D 1TFXA 3AVZA 1BJVA 3ZZ3A 3N99A 1V2MT 3OE7D 4KTUA 2GJGA 1OBZA 2F5YA 1PQ8A 1NY22 2PSYA 3PV5A 2BVRH 1WTGH 1UK2A 5C5OA 3ZVGA 4YOJA 4ABAA 2C3SA 3MU8A 3GCTF 2LELA 3SGQE 1K1LA 2ZI2H 5HM9A 1TMUH 3FAOA 1YC0A 1K1OA 1L4DA 3EAJA 2WPIS 1C5YB 3F1SB 3RLEA 1DPOA 2QN5T 5EJ1A 3VQFA 4A5TS 2KX4A 2H3MA 1NRQH 1YCPM 2QKTA 2BD3A 2ZDAH 1TBQH 1B0EA 1BTUA 1Y5BT 2ZHQH 4BTTB 5E8EH 3RC5A 1O32A 1AKSB 1IOEA 2CXVA 4ISIH 2EGOA 1A2CH 2OC0A 2J38A 3MI4A 1N6XA 2GDDA 1O38A 1VJAU 3ZYEA 1J14A 2ZDKA 2ZQ1A 1UHPA 2CS5A 1NM6A 1O2ZA 2XBYA 1FIZA 5F67A 1VITG 1C5QA 3F6UH 2GP9B 1OHHD 1GJ5H 2BDAA 1C9TA 2J94A 4WJG2 2OQSA 1G3BA 1O3AA 3RXMA 3RU4E 1TONA 1AE5A 2OMJA 1DY9A 2RRMA 1WTHD 1P1EA 2STAE 3PLBA 1O2RA 4WF8A 3GS9A 4HGCA 2AGEX 2G00A 1O33A 3DHKH 2NU0E 1NRSH 2GGVB 3HVQC 4L8NA 3W1EA 4Q63A 3TGKE 1GDUA 5EZ0A 4I8JA 2F9OA 3RMMH 1TNHA 1X5RA 5T3HA 1QQ4A 5CE1A 5FBIA 3O46A 4A1TA 4DT4A 1ZPBA 2EI7A 2HNTC 1GJ9B 1SHYA 3E17A 1OWKA 2QE7D 2GEFA 5HEYA 1NFYA 4INLA 1D6WA 4AG1A 3LGUA 5T6DA 1YBWA 1GBAA 3K2UA 4NSYA 1C1WH 3RL7A 1H4WA 1BMLA 4SGBE 2XNIA 5TJXA 1TA6A 2QXIA 2C8ZB 1QRZA 1TOMH 1FPCH 4CR9A 3F2HA 3S9BA 4X1NU 1ELAA 1S82A 2XWAA 2LA8A 1ANBA 1PDRA 4ASHA 1TGBA 5L2ZH 4DURA 3K50A 3RXJA 4FUEA 1AFQC 1OWEA 1IQGA 1TGSZ 2A5AA 2H5CA 1H9LB 2UWOA 1UM7A 5FB8C 3K9XB 3UREA 2OCSA 4XDEA 2I1NA 5DGJA 4QT8C 4NMOA 1V2OT 1WU1A 1GDQA 2J5UA 3U9AH 2AYWA 2THFB 2JOAA 1Z8GA 2EEGA 1J9CH 4K3JA 4X8VH 1P3CA 2XWBI 3AAUA 1GHBF 3ZVAA 2JWEA 1P03A 4FUJA 4FXGH 1AWFH 5FBEA 1MTUA 5K0HA 1TPAE 2FNEA 3EA9A 4MPVA 4NG9H 3TK6A 3PS4A 3VGCC 2EGNA 4OS2A 3TGIE 1WXRA 1WH1A 2HPQH 1AY6H 1OS8A 3PRBA 2P8OC 3Q3KA 3RXKA 1O3IA 4LXBH 2GKVE 1DLKB 1GJAB 1ZTKA 3A8AA 3UNQA 2G52A 3H7OA 1FAXA 2BDIA 1PPHE 1EZSC 5DPAA 2PTCE 3A86A 1MCTA 2ANMH 4MPAA 2H1UA 1OXGA 1HDTH 2ZF0H 2ZU2A 1P06A 2OBOA 2PKAB 5EQRA 2Y81A 2PGBB 2Z6BD 1OPHB 1PYTC 1GGDC 4BAOB 2EEJA 4TPIZ 2DLUA 1SLVB 3KQCA 1BMAA 3SYJA 1O2WA 3GY8A 1FI8A 3P6ZB 3STIA 1ETRH 1FY4A 2W5EA 3UIRA 1C5TA 2QF5A 2ZPSA 1SQTA 2ZP0H 1R6JA 4BXSA 2FLBH 1WF7A 2GCTB 3ATKA 4Y8YA 5K7RA 2B5TB 1Q7XA 1FXYA 4UFGH 2GV6A 2V3MA 1UVUH 5J4SA 2V7QD 3PV4A 2RA3A 1SPJA 2WYGA 3NCVA 1S6LA 1LPKB 1GHZA 2FXRA 3KQBA 3AXAA 1BRUP 1AD8H 1S5SA 4FVDA 3CBZA 4CRBA 1UEQA 3G01A 1GJBB 1T7CA 4M9FA 4GVCA 2RFKC 3GDSA 1GI7B 6CHAC 4Q3HA 1D3TB 2LP6A 1FC6A 5EGMA 1O3DA 3LH1A 3U8RH 4XOJA 2R0KA 1PQ5A 5EPNA 1H8HD 1QBNA 2QXGA 4XRNA 3ENSB 1HXEH 3GJ9A 4KELA 3L4FD 1CT0E 2GT7A 1SMFE 1VJ9U 1GBKA 2REYA 2Q6DA 2M5TA 3SNAA 3RXBA 4YYXA 4I8HA 1D6RA 4E05H 3SV9A 1ZR0A 5G1DA 5JPMH 1N7EA 2LOBA 1GHAG 4KFWA 2EAQA 1F5KU 3RMOH 1V6BA 3F2GA 1E37B 5H4IB 1QFKH 2D8IA 1HJAC 2IWNA 1RIWB 5EOKA 1D5GA 2OC1A 1JMOH 3H5CB 5GDSH 4RKOB 2ANYA 1O2LA 2FS9A 3EGKH 1GBDA 4ZKOU 1BMFD 1GWAA 1XUGA 2NU4E 3NRLA 1K1JA 2OPGA 1VB7A 3CBXA 2BDGA 2ZC9H 7GCHG 2ZO3H 4GCHG 1Y3YA 4I31A 2QG1A 1SGFG 4K75A 1GJCB 1UTNA 4HTCH 5C1YA 4ZKSU 2OK5A 1JXPA 4CREA 4TY6A 3RXLA 3SU1A 1O2GH 1L1JA 1UJ1A 2OTVA 3QLPH 3ZZ4A 2M10A 1EJMA 3K1RA 2OQUA 1YF4A 3SJOA 4NMSA 5C0UA 1SVPA 1QRXA 3QZRA 4JOJA 1GVLA 5KGOA 3LGIA 5HF1A 4EDJA 1MBMA 1W12U 1GI4A 2OD3B 3LKWA 3GCTG 2HOBA 1KXEA 2JIKA 4MNVA 3MU1A 2D1JA 1S0RA 4I7YH 1DXPA 1O3BA 2KFWA 2EY4C 3JZ1B 1V2LT 2QV1A 4FU9A 4X8TH 1YLNA 1ZOMA 2G81E 1UTPA 3V13A 2P3WA 1E1RD 2Y82A 4X2WA 3AW1A 3LH3A 3UQOA 1TPOA 3EGGC 3ZVDA 2ZKSA 3PTBA 7LPRA 1OBYA 3PWCA 4JOPA 1Z7KA 1BITA 5A0BA 3SJIA 4OGYA 1Q2WA 4KTCA 1AZZA 3BTTE 2P3TB 2OBQA 3N7DA 4NWLA 1MBQA 5JBTA 1RTFB 3RC4A 4IC5A 1SGTA 1O34A 2Y6TA 5HFEA 4X1PU 2CK3D 2PV9B 5FX5A 4A7IB 1QA0A 1IQJA 1SI5H 2GT8A 1COWD 3P8NA 1G37A 1HAVA 4Z0KA 3OTJE 4Q7YA 1P2IA 3GISB 5EW1H 1LHGH 1U37A 3CNRA 4ZROA 3M36A 2J2UA 4XE4A 5HMAA 3UY9A 1GI1A 1SLUB 1YPJH 1N6EA 3DORA 1GHVH 2OCVB 3E8LA 4FUCA 4OS4A 4D9RA 2CSJA 1AIXH 1O37A 3LOXA 4UD9H 5HFCA 5L2YH 1G3DA 3URDA 3MH4A 2FOEA 4WYUA 3DIWA 1TIOA 2PP6A 1N7TA 3QJNA 2YOLA 3TITA 4TT3D 1U3BA 1J16A 3MHWU 1BZXE 1MFGA 1HAOH 1RS0A 4ABDA 1FC7A 1O2QA 3A85A 1O2SA 1UVPA 4Y11E 2QXJA 2BZ6H 4YOIA 3ZZ8A 1C4U2 1FJSA 4YLUA 2CSSA 4AFQA 1O2MA 3TGJE 1Z8JB 1HAHH 1F92A 1GPZA 2G51A 3RMNH 1RGQA 3FP6E 1DWCH 4LK4A 1MTSA 4CRFA 2VIPA 1HIAA 4GSOA 4YT6H 1VR1H 1LVBA 2I4SA 3ATIA 3KHFA 3D23A 1YY3A 1O3PB 1DS2E 2V3OH 1M9UA 5AHGH 5CMXH 1Q3PA 1O3OA 3I29A 2SGAA 4NNLA 3LPRA 3Q3XA 1YPLH 1SGPE 4CRAA 3ITIA 3SQHE 1WAYB 2BY7X 4JK5A 1JBUH 4A1VA 1QIXB 3LGTA 2HVYB 1QL8A 2WUBA 3O8CA 5I7ZA 3O8BA 4H11A 3PROA 2ASUB 3RXQA 4ABIA 1UF1A 2SGFE 1G32B 1SGEE 1SGYE 5J4QA 1SQAA 1BTXA 1XVOA 2VGCC 4I8LA 3M3TA 1GHBG 1THPB 2OXSA 2AMDA 2SGDE 1NO9H 5F8XA 3TMHA 3F3BA 4JYVH 3RM0H 3VPKA 3R0FA 4Q6HA 4G69A 1VCWA 2QF3A 3GCOA 1P2NA 3ZVBA 5DKMA 2FOCA 3U28C 1F7ZA 1TNIA 3MH7A 2JH6D 1RTKA 1BCUH 5GPIB 3WWFA 1JIMA 4A1XA 2EHRA 4IC6A 3NZIA 4IMZA 3QJMA 4FU8A 1K22H 2QC2A 4ISLA 1C2DA 1UTKA 1YCPK 3UWIA 4GAWA 4CHAB 1F0TA 1IHJA 2KCYA 3QZQA 3BV9B 2GZ9A 3AW0A 4PQWA 3A87A 2VH0A 5FL7D 1QNJA 2H6MA 1NPMA 2QKUA 1UTLM 3KHVA 2H2ZA 1MKWK 4BTUB 3K6ZA 4AC9A 4ZXYH 1X5QA 1MZDA 3DJ1A 3D62A 1Z87A 1O2IA 1A46H 4JCNA 1V2QT 1O3FA 3PTNA 2BVXH 4LZ1H 3LDXH 2QY0B 1L4ZA 3WW7A 4B2BA 1HAXB 3KQDA 1UTOA 5E22A 1WSSH 3WWBA 1ELVA 1DLEA 4GPGA 1EATA 1OWIA 2JIZD 2XNDD 5GCHG 2ZFPH 2XCNA 2OGPA 4K78A 1TYNA 1KEFA 1C5NH 3SBKA 1UTMA 3OY6U 3KF2A 3BTKE 1O5FH 1H8DH 3ZVFA 3F9HA 1NF3C 5E2PA 3KZDA 2B0FA 2FOHA 1WFGA 3EA8A 4TWWA 3QWCH 3SW2B 3SN8A 1HXFH 4GLYA 4X1SU 1AQ7A 5LH8A 2Y5GA 2H9HA 2QGRA 4FVBA 1P2MA 1EP5A 4Q80A 1HJAB 4ABBA 3A84A 5DP5A 2BMGB 4IGDA 2FPZA 1UW7A 3ELAH 4KP0A 4KKDA 4UEHH 3BEUA 3L33A 4H6TA 2KQFA 2W3IA 5EQQA 1Q31A 1QL7A 2QBWA 3ATWA 3TJNA 4B76A 1NESE 4JMYA 2KAWA 1CE5A 3GDUA 2XCFA 3CH8A 1TX7A 1EQ9A 1F0SA 2BQ6B 1ZGIA 1N6FA 2FI4E 3EYDA 3SV7A 2P95A 3I77A 3E90B 4GVDA 1QL9A 2ZEBA 3GY7A 2K20A 8LPRA 1C1UH 3BTWE 1MKXK 3KN2A 2A5KA 5ILBA 4P0CA 1TNKA 3KL6A 3QUMP 4NSVA 4Z1MD 3FVFB 1AWHB 2F9BH 1C1QA 2KOMA 1BJUA 4ZHLU 4AB9A 1K28D 1TGNA 1BTHH 2G5VA 4NZLA 2G5MB 4ZMAH 2NU2E 1ZHMA 2Z9IA 3T28A 5D13A 2VZ5A 3RXAA 5F8ZA 2V0BA 4ESTE 2GCTC 3KEEA 2IJD1 3L3TA 3QGJA 5C5NA 2A7JA 2ZZUH 4ABEA 4RN6A 2EJYA 5FCKA 1HJ9A 2LC6A 1O2TA 5IL9A 1TPPA 4Z6AH 1AN1E 3TJOA 1DUAA 1ZHRA 3A7XA 4ASUD 2BLWA 2R4HA 2ZCHP 4HG6A 3MNSA 4NMVA 2BTCE 4NA7A 2ZPQA 4WH8A 2A2XH 2TRMA 1HCGA 5IYTA 5GXPA 1TABE 3SV8A 1DOJA 1QURH 1A3BH 3C27B 3TH3H 1JWTA 4FUFA 1RFNA 3M5LA 1Y3XA 4DT7B 1UK3A 1F5LA 1XKAC 4BAQB 4MPXA 1P02A 5E0JA 1BE9A 2BD8A 1A5HA 4B73A 2JDID 1KSNA 2VIDA 1YM0A 2AGGX 2DUCA 1AFEH 2SGPE 2NU1E 3A88A 4KGAA 4B6FA 2YUBA 2JXOA 1IQFA 2V90A 4YM9A 5E6PB 2W7RA 1FUJA 1G9OA 1L1GA 4DIHH 3GY4A 3KZEA 1C5ZB 1KIGH 1IQIA 1HAZB 2AMQA 4NXRA 4B2AA 1EOJA 5GJ4B 1WHAA 1T4VH 4XBCA 1TRMA 1RIWC 3UAIC 3H09A 2FOMB 2PR3A 3ESTA 4JZEH 3MFJA 1GM1A 3ZVEA 1TP5A 2VPHA 1C5LH 1IAUA 3DJ3A 1DITH 2FIRH 3FZZA 2BDYA 3NUMA 1G2LA 3R68A 3KDGA 4E3BA 1YPEH 1BFEA 1EB2A 2VSVA 1P2JA 1VKYA 4WXIA 5JBCS 3RMLH 1BMMH 1ACBE 2SGEE 1GMHF 2J92A 2Y7XA 4ISNA 1C2IA 2EXGA 3I4WA 3PDZA 1CHOG 1MTVA 3QTVH 2BY8X 4ACBA 4JOHA 2EDVA 1QAUA 3U1JB 1ZJKA 3A7VA 3BSQA 4WY3A 3URCA 2JETB 3BF6H 2PHBA 2VU8E 1V2TT 3ZYDA 3Q76A 4X6MA 2J4IA 1BB0B 1X5NA 2IN2A 3Q00A 1O5CB 2XBVA 1UVSH 1J15A 1P09A 4GHQA 2VIWA 1BTZA 2BQWB 2VGCB 1GHWH 3SUZA 4J1YA 3ZZ5A 3FOAA 1QR3E 4HFPB 1SGDE 2BQ7B 2P94A 1BHXF 1S6FA 3BEFB 5FAHA 4B6EA 1GBJA 1V2UT 1QJ6B 2OC7A 4NFFA 3PRDA 3LT3A 4B74A 1W9EA 3DUXH 3CYYA 1BUIA 1W7GH 2G2LA 1A61H 2C93B 3SU2A 5HFBA 1GJ6A 2A4OA 2OQ5A 3SGBE 1ZTJA 1HLTH 2DB5A 3NFKA 1D4PB 5DP3A 2GZ8A 5HIZA 4UU5A 1XKBC 2IPQX 2IWOA 1P2KA 4DY7B 2Y5FA 1SFQB 1T31A 1EKBB 1GQ4A 1W0JD 1DXWA 1YYY1 2O2TA 1O39A 1P01A 1XM1A 4LOYH 4P00A 1I16A 3ZZBA 5FPTA 1SFIA 2J98B 1D9IA 5CDFE 1TALA 4DG4A 2PKAA 3HPKA 1CHGA 2WV5A 3TK9A 4Y76A 1C4V2 1QJ7B 1CT4E 4H4FA 2KPKA 4H6SB 2ZFRH 4JL7A 2WZQA 3SFJA 4MLFB 2VWMA 3QDZB 1TNLA 3SU3A 3FFGA 2BD7A 1N7FA 5C67A 4TY7A 3AAVA 1TQ7B 2HWLB 4X6NA 2A32A 1K9OE 1DDJA 3DFJA 4JJ0A 1O35A 3VXEH 1RGWA 1AUJA 1SLWB 2SGQE 4JOFA 1LDTT 1LVMA 1MCVA 3F9GA 1YCPH 2WPMS 2AFQB 2VRFA 2ZTZA 2YTWA 1EJAA 2PUQH 3RXGA 2ZU3A 1A7SA 2FN5A 2Q6FA 2SFAA 1P9UA 1B8QA 3TJUA 5JBAS 1C5SA 1QJ1B 1QHRB 3OYPA 2F9NA 3EQ0H 3F2FA 5F8TA 2BD5A 1MKWH 4MPWA 4THNH 1T8MA 3LJJA 2DE9A 1X8SA 3HGPA 2Z9GA 1W3CA 2M0UA 1ELTA 4FUIA 1KDQB 2Y7ZA 5DP4A 1OWHA 1C2EA 1AB9B 2KAIB 1WI2A 1GI3A 4AZ2B 1DM4B 2FEQH 2WV4A 3TSVA 1ZSKA 2D26C 5FCRA 3V7TA 1BOQA 2A7CA 4I33A 3E16B 3ID1A 1ZRBA 1NU9A 1V3XA 1ZMLA 4X2XA 3BTME 1O3MA 1FCFA 4AX9H 2A0QB 1Y5UT 2XBWA 2GX4A 2ZHDA 2RCZA 3MOCA 4CBNA 4Y10E 4UFEH 2FP7B 4ZHMU 1ZPZA 1SG8B 1RY4A 1TMBH 1EXFA 2LC7A 1QRWA 2ZDLA 4IBLH 2L6OA 1EAUA 1H9IE 5C0TA 1K21H 1A5GH 2LPRA 3LGWA 1YPGH 3Q77A 1ZJDA 4NWKA 3UNSA 3UNRA 1T2MA 4CHAC 5GCHF 2HGAA 2G8TA 4YZUA 1GG6B 2O8WA 2TGPZ 1K1PA 2AHME 3VB4A 1OWDA 3SU5A 1S81A 1Y3WA 1YLDA 3FP7E 2VINA 3GY3A 3GCNA 1N6YA 1EZXC 1I92A 2ESTE 2AIPA 5C3NA 1MKXH 1ZTLA 1C5OH 2QF4A 1AMHA 1D3DB 2F4LA 3RUOA 1UM1A 1O3LA 1PJPA 2KR7A 2J95A 1ESBA 3B76A 2A4QA 5FX6A 2ZU1A 5HIYA 1AU8A 3PO1B 3ZV8A 5BRRE 2CHAB 2TGTA 3ATLA 1G3CA 1JRTA 1LKBA 1S84A 1IHSH 2VWNA 1UHBA 2BD2A 3ZZ9A 1MD8A 2BY5X 1W0KD 2ODYB 3A7YA 5I46H 3ZZCA 3FKSD 1KWAA 2CMYA 1C1RA 2BDHA 1P04A 2KJKA 2BDCA 2FX4A 5DG6A 4NMQA 5EJLA 2GCHF 2V6NA 3IITA 1KTTB 2GZ7A 2ZU4A 1TRNA 3HATH 4RT0A 1UJVA 4NGAH 5DP6A 1EP6A 2Z94A 4BAHB 2PW8H 3RLYH 4Y7AA 1HRTH 5GIBA 2HLDD 1Y3UA 2WYJA 1CO7E 3F9EA 4SGAE 4CR5A 1KTSB 2QT5A 3SUDA 1W13U 1HAYB 2CN0H 3I78A 2NWNA 3F9FA 1GHYH 2GMTB 3EE0B 2ODPA 3MNXA 2ZA5A 1SR5C 4OS1A 2ZGJA 5G1EA 2X7ZA 3W94A 1GI0A 4DIIH 4XBBA 1W9OA 1WF8A 1SC8U 2O8TA 4IW4E 3TPIZ 4F4OC 2AWXA 1RTLA 1BMNH 4X0WU 1FV9A 1Y8TA 1NRRH 2Z3EA 1YPHC 3SNBA 2ZDMA 1FNIA 2GDEH 5A2MH 5C94A 3DCLA 3WKMA 1JRSA 3QTOH 5LGOA 1W0ZU 3P92A 5SGAE 1GMHG 2YMSD 1XVMA 2AERH 2BLVA 3OEHD 3A8CA 4B75A 4E34A 1NTPA 1UMAH 4K6YA 3SNEA 1FN8A 1UHBB 1KLIH 2C8YB 3ZV9A 5EW2H 3R0HA 5EXLA 1NRNH 1MC7A 1O3NA 1N99A 2XBXA 4FUDA 1MMJN 3KDKA 1GI6A 1Q3XA 4FGMA 1SB1H 2UUYA 5EJZA 3U8OH 3OU0A 2V35A 4NZQA 1IHTH 2D90A 1WUNH 4O3UA 1IQNA 1K0HA 1C5RA 4NMRA 1UEZA 3ID2A 3SV2H 1CGJE 2YMSB 5CHAB 3BTQE 1C2HA 2A4RA 1V2WT 2KCPA 2ZNKH 2I6QA 4NIYA 1ZZZA 1V5LA 2MX6A 5EPYA 3PV2A 4YDPA 1W7XH 1THRH 4NXPA 5DO4H 1HBTH 1GQ5A 1DX5M 3NGHA 2KL1A 5A2PA 2JSNA 2VWLA 4FUGA 3WKLA 4U30A 3GCHC 4R8TB 4INHA 4RKJB 3V12A 4OS5A 1QTFA 2LUIA 2Y80A 3P8OA 3TK5A 1CHOF 3UFAA 2A1DB 3NFLA 1T4UH 1C1TA 3GY6A 1W14U 3BTEE 3FP8E 1FC9A 1XZ9A 3PWBA 1EZQA 1KXAA 1C4Y2 1WYKA 4IMQA 4AFZA 3PDVA 1ZUBA 5L6NH 1TGTA 1FAKH 2M3MA 1E0FD 3QO6A 2PDZA 1EZUC 5EU8A 2P59A 5A09A 3TLOA 2M2AA 5HF4A 2F91A 2DMZA 1Z6JH 1Q3OA 2EI8A 5DK1A 3UUZA 4I32A 1QAVB 1LHCH 1OP2A 2H9EH 5A8ZA 3FO8D 3SI4H 3GDVA 1YPKH 1BRCE 1TMTH 4P02A 5EG4A 4N6XA 1QB1A 8KME2 1CA0B 1PPCE 5HXFA 2QIQA 5ETXA 2HNTF 5C1XA 2G55A 2Q6GA 1LHEH 2ZU5A 2JETC 2JJ1D 4HI3A 3HPMA 1KXBA 2A45B 5HDYA 3T27A 1MQ6A 2OSGA 1C5PA 3IWMA 4NA9H 2EEIA 1CT2E 2EGKA 2KCOA 2YUYA 1Y59T 1XXFA 2OZFA 2HPPH 3GY2A 1Y3VA 2Z3CA 2ZHFH 1Z8RA 1L6OA 5HGGA 5TCCA 2WPKS 1PYTD 1C2MA 2TGDA 1KYNA 1O3EA 3MO9A 3DJAA 1EPTB 3DT0H 2VJ1A 2K1ZA 5HETA 1SGQE 4UE7H 3UWJH 3JZ2B 1T8NA 7KMEH 1T8LA 4X6OA 1LPGB 1V2ST 1BRAA 3H7TA 3MNCA 1O3KA 1TLDA 1UCYK 3BTGE 1GMCG 5IDKA 1C1PA 1C1NA 4GHTA 5FHTA 2KZ4A 4I8GA 1TAWA 4K8BA 1H8ED 5EXNA 4WXVA 1BRBE 1MH0A 3MH6A 2FLRH 3E0PB 4OGXA 4CH2B 1UJDA 2FM2A 5ABWA 3UQVA 1X9ZA 1AVWA 1O3HA 1OBXA 2ZDVH 1FY1A 2WPHS 3OAAD 4XSKU 1P11E 4ZH8A 1A1RA 1HB0B 1X7AC 1P57B 1C9PA 5GLJA 3QX5H 4X2VA 1DT2A 4R0IA 4WMFA 2UWPA 1INCA 2L97A 2M0VA 5JB9S 1O2PA 4K5ZA 1K1IA 1GJDB 2BX3A 3KNXA 3MO3A 3GICB 4GHNA 1MFLA 2LNCA 5FPSA 5DTHA 1V2NT 1NU7B 2WPLS 1GI8B 1O2JA 1S0QA 3S9CA 1YPMH 1T32A 4AFUA 3KYGA 4CBOA 1GI2A 2AWUA 1W10U 5C1UA 2KBSA 3GGEA 3MTYA 1MZAA 5KECA 4CRDA 1KLJH 1VITH 1SGFA 3TVJB 1A4WH 1LQDB 2J9NA 3M5MA 3A8DA 5DJ7A 4ZCNA 2F0AA 4JZIA 1GL0E 1ABJH 1QQUA 3HK3B 3D65E 2I6SA 3ID3A 1O3GA 2A4GA 1O36A 2BXTH 3CS0A 5HFDA 1TBRH 1DWDH 2TIOA 1ORFA 4XHVA 1XUIA 4JORA 3UOUA 3BEIB 5PTPA 1MQ5A 3MNBA 4HZHA 1GMDF 1DY8A 1NBMD 1OYTH 1ZLRA 1O3JA 2XC4A 1AB9C 1WJLA 1ELDE 4MQAA 5B6OA 1O5GH 4GUXA 3CENA 1CGHA 5G4BA 6GCHF 2VIQA 2FTMA 1TPSA 3R3GB 1L1NA 1EOLA 2SNVA 4X2YA 3STJA 1ZMNA 3BG8A 3LC5A 1ANEA 1IU0A 2J97A 2W4FA 1A0LA 2WSSD 1NN6A 1CA8B 1AE8H 1O5AB 1SSXA 1GVZA 2XYAA 3N7EA 2JH0D 4IN1A 2BM2A 1L2EA 3HKIB 4B71A 4DW2U 2ZTXA 2ZGHA 4DCDA 1P05A 2GCHG 1X45A 1Z1IA 2ZFSA 2PKUA 2ODQA 1W8BH 7ESTE 2PKSB 3RC6A 1NRPH 2BD9A 3NCLA 4INKA 5EIYA 1QY6A 2ZCKP 4FOUC 1V62A 4BOHA 4K8YA 3SHCH 1FY5A 3S7HB 4NXQA 4Y8ZA 5T1VA 2F3CE 2IWPA 2BX4A 1BTWA 2BYAX 2C4FH 1WQVH 2BLOA 3I1EA 2ANKH 2PSXA 2DC2A 1W2KH 2EV8A 3RL8A 5C17A 5HEBA 1TBZH 1GG6C 1GVKB 2FDAA 4ISOA 2TPIZ 5EODA 3PMAB 1XXDA 3P95A 4I86A 5AFZH 3SJ9A 1GBTA 1NBME 3IG6B 3T5FH 3VFEA 1UITA 1O2HA 1VCPA 1Z6EA 1EAXA 1N8OC 1YLCA 2RDEA 3B23B 3GOVB 4TWYA 1YPHE 5HJ1A 4ACAA 1BT7A 1LHFH 3P70B 3ZIAD 1F2SE 3A8BA 4Q2NA 1AO5A 1ARBA 1SLXB 1WQSA 2VIOA 3T26A 4LZ4B 4OM9A 3DSOA 1A0HB 2F9UA 3PO1C 3RLWH 3SGAE 1GBIA 2AIQA 3OEED 1V2PT 2CHAC 3VEQB 2FCFA 5HYOA 1Z1JA 2CJIA 1O2VA 3RXIA 2VWOA 4K72A 5ESBA 4FUBA 1AVXA 2WUCA 1KY9A 1OWJA 4Z8JA 1UCYE 3GCHB 4MG3A 1HAIH 4JYTA 4JK6A 3LJOA 1XUJA 4AN7A 3DSGA 4UDWH 3MU4A 2XOKD 3QGNB 1A3EH 1NZQH 1ZOKA 2J98A 2WPJS 2DKRA 1HPGA 1ELFA 1BHXB 1GBFA 1SKYE 1RD3B 2P93A 1TWXB 4UU6A 3TNTA 3SOSA 2ALPA 3DD2H 3NKKA 4AFSA 1XX9A 4WVPE 1UVOA 2ZGCA 2DAZA 8GCHF 5B6LA 2EEHA 2A7HA 2PFEA 1D3QB 2VVUA 3LNXA 2VH6A 3RXTA 2L74A 3LC3A 2VBCA 1YBOA 3E3TA 3LONA 1VA8A 5DSFA 4JJ3A 1C2FA 1XUHA 2ZQ2A 3F0PA 4O9VA 2BDBA 2QAAA 4ZXXH 2ALVA 4AOQA 3M3SA 2GMTC 2ZG0H 4D7FA 1ELEE 4NIVA 1MTWA 1E36B 4K1SA 2I6VA 2W6ID 3TJVA 2STBE 1V2RT 3GYLB 5A0CA 2HGTH 1Z8IB 5B42A 4CRGA 3E91A 3SUGA 3KCGH 1P12E 1GBBA 3S9AA 1LCYA 5FPYA 3VB3A 2G4TA 1QLCA 1MTNB 1ZRKA 1E35B 3ZVCA 3ZZAA 4YOGA 9LPRA 1TP3A 2M0ZA 4ZKNU 2R2WU 3OTPA 2R3YA 1A5IA 1GCTC 3QN7A 1KDQA 2C8WB 2B9LA 2VIVA 3U69H 1C1OA 5LPFA 1Y7NA 4YESB 1WG6A 1CVWH 2UUJB 2KAIA 2FOGA 4K1EA 4AORA 3LNYA 1UEWA 1TQ0B 1IQHA 1K1NA 4KFVA 1WHDA 4Q2KA 5LPRA 2P3UB 1XMNB 2FOAA 2ZGBH 3BG4B 3NK8A 1C5VA 1ESTA 2A31A 2CF8H 1CQQA 2AWWA 2H3LA 2ZPMA 1MAXA 3K82A 1G36A 2R2MB 4TPYA 1TA2A 3P8GA 3SI3H 4BANB 5F6MA 4AYYB 1GI5A 1LMWB 1YGCH 4WMDA 1YP9A 1C5UA 2C90B 1WI4A 1VZQH 2JKHA 4U01A 1LKAA 3TIUA 2YMSC 4Y6DA 5CHAC 1HAGE 2P16A 4MPUA 1HJ8A 1N6DA 2QXHA 1BTPA 1BTYA 1U38A 1PQ7A 6ESTA 1DWEH 1WDIA 3M61U 3N7OA 3U1IB 5E21A 4Q7XA 3ZZDA 3A89A
chains in the Genus database with same CATH topology
3SNDA 2KRGA 3BN9A 1AZ8A 4UFFH 1VAEA 3A7ZA 3V0XA 1E34B 3CS7A 1UCYH 1LPZB 4BAKB 3RXEA 1DSTA 2W7SA 3RXHA 3U8TH 2AH4X 1ELBA 2QA9E 2VVVA 3M5NA 1O5DH 3SU4A 3M7UA 5A8YA 3EA7A 4TYDA 2ZDNA 1V2KT 1MU8B 4Q2OA 1HGTH 2FX6A 2C8XB 2PTNA 1O2KA 5AF9H 2CV3A 2DLSA 2UWLA 1B0FA 2ZGXH 3MU0A 3RU4T 2VSPA 5EYZA 2ILNA 5JB8S 1U6QA 1ZMJA 3A80A 3SUEA 2W26A 3ODFA 1CA0C 1DANH 2ENOA 8ESTE 1UEPA 2R0LA 1RXPA 4E06H 1GMCF 4OEOA 3M37A 1PFXC 1RGRA 5BPEA 3NXPA 1VCQA 1CSOE 4K69A 1BIOA 1EB1H 2A2QH 1CGIE 2GZVA 1ZSLA 3GYMA 1RZXA 3T62A 3TNSA 3JXTA 5L30H 5E2OA 4Y79A 1L0ZA 3A82A 4DJZB 2FYQA 4LMMA 2W7UA 1EPTC 1SGCA 3ZRTA 5GNDA 2FE5A 1GMDG 3V3MA 3M5OA 4ABGA 5AVDA 1WBGB 3FZDA 2D8WA 3A7WA 4ZKRU 1NC6A 3E6PH 6GCHG 4ABHA 1GL1A 3ID4A 2JH5D 2G5NA 1OSSA 2UUKB 2PWXA 1THSH 1C2KA 3QK1A 1O3CA 1GI9B 3QE1A 4Y0YE 1MUEB 2VVCA 4WMEA 2ZHEH 5GWZA 4NIXA 4VGCC 2FYRA 1SGRE 3VB5A 4D7GA 1BBRK 4MVNA 4RI0A 3OY5U 2PGQB 2BY6X 3D49H 1O30A 1N8OB 3EDXB 3SU0A 2J34A 1PPGE 1SL3A 3O8DA 3RXFA 3ZZ7A 5C2ZA 1TOCB 3FY5A 2CF9H 5DP7A 5E0HA 2FI5E 2PLXA 2BOHB 1P2QA 4Y7BA 1TB6H 4JOEA 4NMTA 2IJOB 4U32A 1PPZA 2H2BA 1AGJA 2EI6A 1C1SA 5HFFA 1Y5AT 1IQLA 2FOFA 2IOTA 1OKXA 2BHGA 4JYUH 1HUTH 1HYLA 4JZ1A 2YT8A 3AASA 3HPTB 1QA7A 3ODDA 1EAIA 3MYWA 4UFDH 1QB9A 2F83A 3GSLA 2XC5A 1ARCA 3TH4H 1EX3A 1GBHA 2I04A 2EC9H 3NWUA 5DP8A 1F5RA 2KPLA 2F9VA 5F3XA 1WCZA 2QCYA 1SBWA 4BNRA 4BAMB 2Z7FE 3DA9B 3LGVA 1V6DA 3PMHB 2HE4A 2WINI 2Q1JA 1O2XA 1DE7H 1O2YA 2FESH 2ULLA 1IQEA 3VXFH 1ZSJA 3SQEE 3GABA 5AFYH 1E38B 2BD4A 2EEKA 3BIUH 4JZDH 3A81A 3DFLA 1FQ3A 1DSUA 3M35A 1AUTC 2O8UA 2OP9A 3PMJA 4J2YB 2BB4A 4E7NA 2P3FH 4K2YA 4PROA 1TNGA 2ZCLP 2XC0A 1T8OA 2K1QA 4P2AB 1UFXA 2FWWA 4O06A 4REYA 2ZWLH 5HM2A 2KA9A 1GBMA 4GVUA 2PKSC 3SORA 2UZCA 3CP7A 2BVSH 3RXOA 4AGKA 1W0YH 1HV7A 5E1YA 3KIDU 2W3KA 2Z17A 8GCHG 2TBSA 4RSPA 2AMPA 1F0UA 1P8VC 4XFQA 1GJ7B 3SNCA 5JXBA 4YT7H 3NPSA 4Q7ZA 1QAVA 3SHUA 1AI8H 3MWIU 1GCTB 1KXDA 2PA1A 2IPHA 4O3TA 4OAJA 1DUEA 1WV7H 3ATMA 1M5ZA 4JOGA 1ELGA 1FMGA 3HK6B 3SU6A 1U39A 3L6PA 5TCAA 4F8KA 1J17T 3F68H 4K1TA 4MNYA 3BTFE 3T25A 3TH2H 2ZFTA 3QIKA 4KTSA 2RG3A 1JIRA 1S85A 1FLEE 1MAYA