3OU0A

Re-refined 3cs0
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic serine endoprotease DegP
publication title Covalent Linkage of Distinct Substrate Degrons Controls Assembly and Disassembly of DegP Proteolytic Cages.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 82
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3ou0A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3ou0A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ou0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ou0A01
2W4FA 3EGHC 2XBVA 2ZTZA 1IQFA 2TIOA 1GI3A 3PV2A 1RRKA 2YT8A 4JYUH 1VJAU 2Z94A 3E1XB 2GT8A 3SJOA 5EU8A 5JDUB 4RKJB 1NFWA 3OTPA 2ILNA 1YCPH 3SUEA 3M5OA 2DKRA 3SNEA 1W12U 1VJ9U 2RCZA 3I18A 1O32A 1FAKH 4NZQA 4E06H 2X7ZA 1AQ7A 2Y80A 1PPGE 4YESB 1MAXA 4FXGH 1ESAA 2JKHA 4ZHLU 2VWRA 1GGDC 1FY8E 4JK5A 1IQGA 2FO9A 1UVSH 3D62A 3GJ9A 2P3WA 2BY6X 1NRRH 3CENA 1SSXA 2VSPA 1FQ3A 3OY5U 1A3BH 2ZP0H 4ISHH 1YGCH 2WPMS 1AN1E 1BE9A 1AU8A 4IBLH 4RI0A 3SQEE 4NIYA 4YDPA 2CSSA 3GY2A 4WYUA 2KYLA 2QKUA 4LZ1H 2KJDA 3MNCA 1UTLM 3VGCB 1QRXA 1QBVH 2GDDA 3I4WA 2GKVE 5EQRA 1FPHH 5FCRA 1CT2E 2ZZUH 1KLIH 1SVPA 1Z8IB 1BCUH 3SU5A 1O3CA 2BMGB 1BTUA 1QQ4A 4ZKNU 1J14A 2A7CA 1KDQA 4F49A 1C5VA 3HPTB 4L8NA 1SG8B 2HPPH 1N6YA 3TSWA 4X2WA 1K1LA 2TGAA 3SU2A 3IG6B 5D13A 1B0FA 1Q3XA 3LONA 3SU1A 4A6LA 1GI5A 3M3VA 4A92A 2GZ9A 1L4DA 3SUDA 1ZPBA 5GWZA 1T31A 2FLBH 2DM8A 3TVJB 4JZFH 3FP8E 3GYLB 1GI8B 1X5NA 3DIWA 3F9FA 1TBQH 2OMJA 1AB9C 5TCAA 1CT4E 1O31A 3ZZ6A 2G51A 3EA7A 1XVMA 3RXUA 3MNBA 4U01A 4AFSA 1WOFA 1P2IA 1LKAA 1THSH 5T6DA 1C5PA 1YLDA 1DXPA 1T2MA 3K82A 2G5NA 2K20A 1D3TB 1U37A 1Z86A 4CBNA 1VA8A 5G1DA 2FI4E 1BDAA 3MWIU 3S9CA 1M5ZA 4X2VA 5L30H 2V1WA 4F4OC 4CRCA 5EGMA 2CS5A 1AHTH 3K50A 3MU5A 1O35A 1GDNA 1GI2A 4H4FA 2ZPMA 3BV9B 4MNVA 5E0HA 1L1GA 4AOQA 1HAZB 1P1EA 1QLCA 1V62A 3ODDA 2HOBA 3OY6U 3QZRA 3GCOA 2XC4A 1IQKA 1OWJA 4OEOA 2XNIA 3PV5A 4Z8JA 5E0JA 1DT2A 1HAHH 2ZU5A 2M10A 3CS0A 3E91A 1O2UA 5E8EH 2XBWA 2NU4E 1IQJA 1CHGA 1TMTH 2W7RA 2SFAA 3TITA 1VCWA 2XRCA 1TPPA 5G1EA 5A0CA 2AYWA 3VQGA 5GLJA 4X6PA 4NSVA 3TJVA 5HDYA 4GPGA 5GCHG 3LNXA 1FC9A 2WPHS 1IHTH 1NZQH 5HM9A 4I7YH 1SLWB 1DY9A 3SJKA 3PLPA 1BBRE 4OAJA 4JMYA 1GJAB 1XUIA 3BTKE 4NNLA 2EEJA 4X1RU 1ELTA 3KQCA 1QGFA 1GBLA 2RA0A 1S81A 3TIUA 1E36B 6CHAC 4LOYH 1AVWA 2AMPA 1T8MA 1ZRBA 2I0IA 1Y3VA 1UTPA 1TAWA 3QIKA 3OYPA 1TOMH 1GG6C 3SHWA 4SGBE 3BIUH 1ANBA 1H9LB 2I4SA 1AGJA 3O8CA 1VITG 1UMAH 2UUYA 2GZ7A 1GHXH 1LMWB 2P93A 2A2QH 3M35A 2FOAA 3NWUA 1ETRH 3KQEA 3EQ0H 1SHYA 2ZGHA 1GI6A 2FIRH 2FI3E 2FOFA 2PUXB 4AB9A 1ZSJA 1GBDA 1WI2A 3KL6A 3ID2A 4B2AA 2Y7XA 4BTUB 4JOHA 2CXVA 2AFQB 3TLOA 1Z6JH 2GT7A 3VB5A 2O8LA 1MKXH 3K65B 1VGCC 1GJBB 3QN7A 3S0NA 4DIIH 3N7OA 2Y5FA 2OXSA 1QB6A 3TH3H 1I16A 4MG3A 1FMGA 2AMQA 3SO3A 1TNLA 4MNWA 1OBYA 3UWJH 1N99A 1F0SA 2VZ5A 3C1KA 1T8OA 1PPFE 1GHWH 2BB4A 2ZTYA 1FNIA 2D8IA 1W8BH 5FHTA 2WPLS 3E6PH 3GICB 3RM2H 3GGEA 1CHOF 1FZZA 3ZVEA 4NIXA 4CHAC 4I33A 2VIVA 3ZZ4A 3FAOA 1ESTA 5CMXH 3LPRA 1UJ1A 4H42U 2AINA 1QJ7B 1UJUA 2I04A 4PQWA 3R68A 2W26A 1ELVA 2YNAA 3P92A 1SGNE 2ANMH 1O2QA 3K6YA 2BVXH 1DUEA 1KIGH 2C4FH 1OS8A 1FUJA 1LPKB 2P94A 2KG2A 1NRQH 2ENOA 2AGIX 4Q80A 2KAIB 1IQIA 2BYAX 2BXTH 1EPTB 1NM6A 2HNTF 2PTNA 3ZVCA 1X6DA 1C1VH 5EXNA 2SGEE 3DT0H 1C9PA 3QJNA 3O46A 1BJUA 1YPHC 1TRNA 1EP6A 3UPEA 1WF8A 5HFEA 2LOBA 1WFGA 3U8RH 4AFUA 1DPOA 2AEIH 4OGXA 4B74A 2NWNA 4BNRA 1S5SA 4NMRA 2GD4B 2WPKS 3MYWA 5GJ4B 4ZKRU 2CHAC 1CA0B 4YOIA 2A45B 1KXBA 4INLA 2ZPLA 2BZ6H 2KJKA 2DAZA 2MX6A 3URCA 3ZVAA 1C5QA 1YPKH 3VB4A 2NU3E 1C1UH 1TE0A 4D9QA 2BLQA 4A1VA 4OS7A 2BY9X 2ZI2H 3EYDA 5B6LA 2B0FA 2FDAA 2OQ5A 2CN0H 4UONA 2BDYA 1SGPE 1V2TT 2EV8A 1EB2A 2F9NA 1IQHA 2K1ZA 4FU9A 3T2NA 4MPXA 3SGQE 2WL7A 1EJAA 1EZUC 1N7FA 2IWOA 1Q7XA 1V2VT 2BY8X 1SGCA 5E1YA 3TJOA 1TLDA 1GMDF 4FUIA 2KAIA 3TK9A 1S6FA 1ZLRA 1EPTA 4YT6H 1WHDA 2QG1A 4ABGA 1TONA 2BD9A 5EW1H 2H5CA 1GJ4H 1Y5AT 3SV7A 3A8BA 2ZHEH 1HDTH 1Z1JA 3NGHA 3P6ZB 4NMOA 2Y5HA 1ORFA 2ZCKP 3JXTA 1V6DA 2D1JA 2QXIA 4CREA 2G4TA 2CGAA 3PS4A 2XW9A 3BEFB 4FU8A 1F5KU 3SHCH 1D6RA 1U38A 3T28A 1G2MA 1G36A 1LVMA 1R6JA 1GCTB 4IGDA 1SLUB 2UUJB 1UTMA 2DC2A 2CV3A 1FY3A 3BTWE 3SORA 1SLVB 2HPQH 3SQHE 4CH8B 1ZGIA 1MZAA 1QA0A 1AUTC 3UQOA 2BDCA 4NXQA 1O5EH 1ZOKA 1C5XB 1FIWA 1AE5A 5EG4A 1WUNH 1UEPA 1PQAA 2QF0A 1GM1A 3M3TA 3SV2H 3SV9A 2FS8A 2C93B 1C4U2 3HKJB 1GVZA 3KHFA 1H9HE 4GHNA 3UQVA 2SGAA 4Y71A 5EOKA 3QLPH 4X2YA 2ZECA 3RXIA 3Q76A 2H2ZA 1V5QA 3U8OH 4MQAA 1K32A 1SGTA 3Q77A 1O2SA 1Q31A 2STAE 1O2JA 5JBAS 3EAJA 4ZUHA 4MPAA 2R0KA 2GV6A 2PHBA 1VITH 2P3FH 2J4IA 1C1MA 1XXDA 4F8KA 2SGPE 1ELGA 1IQNA 1EJMA 1V2LT 4B76A 2TRMA 1TGCA 4GLYA 1ZR0A 4DG4A 1ZUBA 4ZXYH 4Y7AA 3GY4A 1NTPA 1ZJDA 2HLCA 1JIMA 4DJZB 1SL3A 2TPIZ 2OPGA 3ODFA 3RL7A 3PTBA 4ISLA 2ZGCA 4AGKA 3GDUA 1TA6A 1TGBA 3R3GB 4BTTB 3UOPA 1JRSA 3RXBA 1GHBF 3CBZA 1K1NA 1O36A 3M7QA 5ABWA 1C1RA 1AWFH 2YT7A 2FOEA 4Q7ZA 3ID3A 1GBJA 4WH8A 4FUHA 3MI4A 3MU8A 5C67A 3QTOH 2BD7A 3LJJA 5A8YA 4WJG2 1B8QA 4GHTA 5DP9A 1QAUA 1CBWB 4FUCA 1KSNA 2FOHA 2G8TA 5CHAC 2ZFTA 3W94A 4DURA 1P04A 3A8CA 2KV8A 1TB6H 2FOCA 5LPRA 5HMAA 1GI4A 1JMOH 1QFKH 3TMHA 1GBEA 3M5LA 1GWAA 1XM1A 1UTKA 4CRFA 1BMAA 1G2LA 4PROA 1XXFA 1GQ5A 5C3NA 1W9QA 1BZXE 2FPZA 4HFPB 1HFDA 1TMUH 4MVNA 4NIWA 1T8LA 3LDXH 5EW2H 3SV6A 1AKSB 2VVUA 1DVAH 2FP7B 2P3UB 1GJ7B 3DJ3A 2HE4A 1BT7A 1MQ6A 3E0NB 5AVDA 1BITA 1UK3A 2Z9KA 1VB7A 1HGTH 3BTFE 1UK2A 3BEUA 4GCHG 1VCQA 2BD5A 3GCTF 1A5GH 2EA3A 1EOJA 3SOSA 3LGWA 1K9OE 2PKAB 4INHA 3PB1E 1S84A 1P09A 1N1LA 2LNCA 3DJAA 2VVCA 1W0ZU 3KHVA 5EYZA 2KPLA 1FN6A 1HLTH 1DICA 2F9PA 2V6NA 1ZSLA 3F6UH 3QK1A 1OYQA 2WYJA 3BIVH 1TGNA 5FAHA 3LC3A 1EP5A 3RXVA 1AWHB 1EAWA 3R0FA 3RU4T 1IHSH 2A2XH 3BTME 5TCCA 1CGIE 4OS6A 1UITA 1T7CA 3LGVA 3FFGA 1KXCA 3ZZ3A 4B1TA 1C1SA 2ZFFH 1MD8A 2ZFQH 1GJ5H 1W9EA 2KOMA 9LPRA 2QC2A 4WMEA 2I6QA 3ZZ9A 1ELAA 5A0BA 2ALPA 1UJDA 1FDPA 4AFQA 4X6MA 3KQBA 1G9OA 1P2NA 1UEQA 2ZHFH 2QT5A 1G3DA 1T8NA 2PSYA 2R3UA 4R8TB 2W3KA 1N7TA 1H1BA 4Z0KA 1SOZA 4XBDA 3R0HA 4BTIB 5JPMH 2BVRH 3K9XB 1N6DA 4DY7B 2V3HH 4IN1A 1A5HA 2TGTA 4H6TA 5B6OA 3TNTA 3TK5A 4OS1A 3SGAE 3H7OA 1IQEA 3A8DA 5C1XA 2Z3DA 3OTJE 1T4VH 1WTGH 1TIOA 2GP9B 4BAKB 1EUFA 3UNSA 4ZAEA 1ZZZA 4X0WU 1IU2A 2PKAA 3PLKA 2A7HA 4ABIA 2OUAA 2F83A 3UREA 3EGKH 3PV4A 1UK4A 2CF9H 1X8SA 1TRMA 1ZTLA 4WY3A 2WUCA 2QA9E 6GCHF 1K1IA 2JETC 4MPWA 2LC6A 3LGIA 1O2LA 1GBKA 2Y81A 2EI8A 1LQDB 2OLGA 2ZTXA 1AFQC 4Q6HA 4ABEA 5C1UA 1BBRK 1G3EA 1O2PA 2GV7A 2OC8A 1O3IA 4NMSA 1ANCA 1W2KH 3VPKA 3MH5A 2Y7ZA 3KZDA 1OBXA 1D4PB 1A0LA 1HJAB 3RXMA 1PPHE 2BD8A 4NMTA 1GL0E 3NXPA 3GCHC 4KGAA 4VGCB 1UEWA 4NGAH 1PFXC 3VFEA 2BQ6B 4O9VA 1Z8GA 1RZXA 4BXSA 1ANEA 4KP0A 2M3MA 3PDVA 4K69A 1EAIA 4CRAA 1HNEE 5BRRE 3QGLA 7ESTE 4HI3A 3A7VA 1ZMNA 3LH1A 1KDQB 3P8NA 5I25A 1ZJKA 1BRBE 3SV8A 3S69A 4IC5A 5HJ1A 4E3BA 1O33A 2I6SA 4B75A 1O37A 1MZDA 3RXLA 1H9IE 2BY5X 1AO5A 1V2RT 3T27A 2H1UA 4ESTE 1XUGA 3L6PA 3UIRA 5HGGA 1DE7H 1OSSA 5HM2A 1B5GH 1C2LA 4CBOA 2FEQH 2L4SA 1K1PA 1KXAA 1FONA 2P8OB 2NU1E 3PMJA 4LK4A 1B0EA 2Z9LA 4D76A 1Q3PA 4ABHA 1UCYH 7LPRA 2CMYA 4ISOA 5DTHA 1YBOA 3VB7A 3BPUA 4UU5A 2JILA 2L97A 1LHGH 1W3CA 4JK6A 4Y7BA 2ZQ2A 5JB9S 3QX5H 1A2CH 2O9QA 2ZEBA 3H5CB 2EC9H 4QT8C 4U32A 3LKWA 1RD3B 2FX6A 2FE5A 1PQ7A 3SNDA 3RMLH 2EEIA 2LA8A 4OGYA 4ABFA 1SLXB 3V7TA 1C1OA 1PPCE 1NRPH 4TPYA 1FIZA 2BDGA 3NPSA 1LO6A 4HZHA 1BJVA 4JORA 1MBMA 4BXWA 4FVBA 1GHBG 1Z8JB 2BD3A 2QCYA 3SU4A 4X8UH 1GHZA 3VGCC 3KCGH 2HNTC 3L3TA 1THRH 4Y79A 2IN2A 1GBIA 1GBHA 2ZU1A 3CS7A 1OP0A 1MFLA 3CH8A 3GY5A 1V2KT 1TQ3A 2VIOA 2PWXA 1QL9A 3A87A 2FXRA 4DGJA 2BDAA 1PPEE 1O38A 1ELCA 1P2MA 2IOTA 4D7FA 2ZO3H 2F0AA 1AB9B 1NFUA 2BVSH 2VH0A 3NK8A 3HPMA 1HAOH 1LTOA 1QURH 2Y6TA 3E16B 4OS5A 2I0LA 2F9BH 1GQ4A 2G5VA 2H5DA 2H3MA 3ZVGA 4M7GA 3GISB 3DHKH 1O3PB 1O3BA 1IQLA 1QA7A 1EB1H 4WMDA 3S7KB 4ZKSU 4LZ4B 1LVYA 2H9EH 1KTSB 2PNTA 1GMCF 2ZA5A 5J4SA 3GY7A 2JIKA 3GCNA 2PA1A 2ODPA 4WH6A 4YOJA 3A81A 1HAPH 2VH6A 4B2CA 1NRSH 2ESTE 4KFWA 3IWMA 4JZEH 1O3HA 1BIOA 4DIHH 2EJYA 3NFKA 2ZG0H 1E38B 1L1NA 2A4GA 4A5TS 1P8VC 1NROH 1C2GA 3RC6A 5HF1A 3SI4H 1DXWA 2Y5GA 2GDEH 2LUIA 2BM2A 3GCTG 1MBQA 4YZUA 1UHBB 1SGDE 4FVDA 1GMHG 1IOEA 3CC0A 1Y8TA 4JCNA 3SNBA 4X1NU 2OCVB 1AVGH 1C2JA 1CE5A 1C1TA 3ZVDA 4H11A 1XVOA 1BRAA 5T6GA 1O0DH 2VIWA 1D3QB 1A0HB 2JH6D 4DW2U 2XC0A 1K1OA 5E21A 1QQUA 2IWPA 2YOLA 1SQAA 3U1IB 2C8WB 3ZYDA 3U1JB 1KLJH 4OEPA 1Y59T 6CHAB 1X45A 5GIBA 3L4FD 5EQQA 1W11U 1OX1A 4ISIH 1SMFE 2G52A 3TK6A 7GCHF 1SB1H 1GVLA 1O3EA 1GHYH 2LPRA 3K2UA 3UY9A 2JWEA 5HF4A 4AYVB 2GGVB 1QRWA 1Y3UA 4J2YB 1NY22 2G2LA 1OWHA 2D92A 3P17H 6ESTA 1O2WA 2GTBA 3PMHB 1NESE 2BTCE 2F5YA 1C5MD 2HGTH 2VIPA 1WQVH 1O2RA 1DM4B 2V90A 5IDKA 1UHBA 2ANWA 2EGKA 1C1NA 1BUIA 1C5ZB 1BTZA 5T3HA 1W7XH 3E3TA 4O3UA 2VRFA 1VGCB 3GSLA 2QYIA 2EXGA 2ZGJA 3TU7H 3PO1B 1WHAA 2MHOA 5DG6A 1A3EH 1NU7B 4XDEA 1FY1A 1PYTC 1FCFA 3PWBA 3AAVA 2VWOA 4LXBH 3MOCA 2W7SA 3SU6A 1BQYA 1QCPA 2NU0E 4NCYA 4NMQA 1MUEB 1RS0A 1YKTA 4Z33A 4Q2OA 1A46H 4ABDA 2H6MA 3P70B 1MU8B 2ZKSA 4ZKOU 4NNMA 1M9UA 2HRVA 5E2PA 1NS3A 2Z9JA 2G55A 1CSOE 3C27B 1E0FD 5HXFA 1Z6EA 4B71A 1RTLA 1G3BA 2FS9A 2PFEA 3BG4C 2EDZA 3P8OA 5K7RA 4X1QU 2K1QA 1UTJA 3GOVB 1P01A 2ZDNA 1WF7A 3RXGA 1YPGH 4FUEA 2TGDA 1TNKA 2RDLA 1SR5C 4XOJA 1GJ9B 1FC6A 2XWAA 2PZDA 1VR1H 2ZCLP 2AIQA 1K1MA 2VB0A 3DFJA 3TH4H 1OOKB 3W95A 1A5IA 1GL1A 2VWMA 3EA8A 3U98H 4ABAA 4ZXXH 1NTEA 2GCTC 1S83A 1ZOMA 2YNBA 4A1TA 1JRTA 5GNDA 2H2BA 4HOPA 1T32A 2WYGA 4FU7A 3PYHA 2KAWA 1DWEH 1X5QA 1TPAE 1MMJN 1EPTC 2FMJA 1YPMH 5LGOA 1FI8A 2XBXA 2CHAB 2Z17A 1AMHA 2A5IA 1C2EA 1V2QT 5AFZH 1KLTA 4N6XA 4NFEA 2C8ZB 2DE9A 3L33A 1C4V2 1GHVH 1YBWA 1UJVA 3A84A 2Z7FE 3EA9A 1C5RA 3T25A 4X8VH 5EODA 1HV7A 4GVDA 5DK1A 3QUMP 2REYA 1CA0C 1V2OT 1HB0B 1RY4A 1XKBC 4NWKA 2VJ1A 2JINA 2UWOA 3ESTA 5H3JA 3BTQE 3RXPA 4Y8YA 3CBYA 4INKA 3Q3YA 1OBZA 3ID4A 1P0SH 1ETSH 3PMBB 2VVVA 1S82A 3M7UA 2PUQH 3BSQA 3KEEA 3RC4A 5DO4H 1WH1A 1BMMH 1QR3E 2ZU3A 3QGJA 5FPSA 3M3SA 4UEHH 4DCDA 1Z8RA 1WU1A 1YC0A 2J9NA 1A61H 1BTHH 3A7WA 3T5FH 4TYDA 5TJXA 3A7ZA 1EKBB 2A5AA 1HAXB 1O2NA 4I31A 2FWWA 3QWCH 3MU4A 4KTSA 1O5CB 4NZLA 2VINA 1SOTA 2I6VA 1SGFG 3SJIA 1P10A 2ODQA 1JWTA 1LPGB 1G37A 3M36A 1K21H 5HFFA 1CO7E 3RXAA 2VGCB 4BANB 5HETA 3RXCA 2R4HA 1O2YA 3A86A 3AW1A 2O8MA 1BRCE 3UOUA 2ZU2A 2RRMA 2C3SA 1KXDA 1TNJA 3B8JA 1V5LA 4Q2QA 2ZCHP 1XUFA 2PGQB 1C2HA 1GCTC 2QXHA 3V3MA 1C2DA 3DD2H 5JB8S 1I92A 1P05A 1EQ9A 1C5YB 2OBQA 1DFPA 1GMCG 1AE8H 1XUJA 4E7NA 3TSZA 1KY9A 3T29A 2ZDMA 3IITA 1AFEH 1EZQA 4B2BA 3MNXA 1O3JA 1NFYA 1XUHA 1J9CH 3SUGA 1MTNB 1MH0A 1HAGE 5L2YH 2Q9VA 4KTCA 4D8NA 1P9SA 5C20A 2QF3A 1XZ9A 1D3PB 2ZQ1A 1QJ1B 3D23A 1S85A 4JOPA 2L4TA 4CRDA 5FB8C 3SNAA 1HBTH 3ATKA 1O5AB 1UM1A 1O5FH 2EDVA 3TSVA 1QTFA 3RXOA 1Z87A 1RJXB 2OTVA 1YPHE 1K2I1 3BTHE 2C8YB 4REYA 3D49H 5AFYH 4MDSA 1GDUA 2DUCA 4YM9A 4AN7A 3F9HA 4I8GA 1EZXC 4FUFA 1NC6A 3NKKA 1T4UH 1LHFH 5DP6A 4AX9H 4MPVA 4A1XA 1FXYA 2H9TH 1WIFA 1F0UA 2BOKA 1V2UT 3AW0A 4DVAU 1Q2WA 4JOEA 6LPRA 2OGPA 3QJMA 3TGIE 3ZZAA 1BTPA 1O2OA 5FXLA 3DORA 1PPBH 3PWCA 3ZZDA 3B9FH 5DGJA 1ABIH 4YLQH 2J92A 1OP2A 1TPOA 3MHWU 1O2HA 1O5DH 1V3XA 1MKWK 3ZZ7A 3HVQC 5K0HA 1UO6A 2JH5D 3KGPA 3ID1A 1F5RA 2FN5A 1EAXA 5CHAB 3AAUA 1IU0A 3I29A 4O97A 4ABJA 3ZV9A 1C1WH 1KTTB 1AD8H 1O3OA 1LPZB 1OXGA 2GMTC 3D65E 1TWXB 2UUKB 1SGRE 4YTAA 1Z7KA 4YLUA 1Z71A 3RMOH 2H3LA 1F5LA 4CR5A 1ARCA 4U2WA 2EDPA 2BOHB 2VIDA 4GSOA 4K75A 1HXEH 1GJDB 1DSUA 4KFVA 3Q3KA 2NU2E 1F0RA 2J94A 3ZZBA 5HFDA 3LGTA 1HAVB 5DP4A 4ZMAH 1J15A 2QBWA 4BAMB 1VZQH 2PTCE 1NPMA 2E7KA 3RU4D 3Q3XA 3I78A 2A4OA 1C5OH 4RSPA 4Q2KA 1N8OB 3GY6A 4E7RG 1J17T 1ZYOA 4AMHA 1ZHPA 3A7YA 4CH2B 3NZIA 2KBSA 4JOGA 1DX5M 3B23B 1WJLA 3MTYA 2BHGA 1GBAA 4FUJA 1YCPM 1NF3C 2DMZA 1CHOG 1D9IA 1P2QA 3P8FA 3RXTA 1HYLA 1O3MA 1UVTH 2M5TA 3MO6A 2QAAA 1WG6A 5L6NH 3TGKE 2W3IA 3RXSA 2OC7A 2A7JA 2QKVA 4K6YA 3FZDA 2ZIQH 3UR6A 3P95A 1QY6A 4DT7B 1O30A 3SU0A 4GVCA 3MH7A 1SQTA 1P11E 3STJA 1V2JT 2F9UA 2W7UA 1YCPK 1FN8A 1BA8B 4K1TA 1X7AC 3UNQA 2OC0A 2EAQA 5F3XA 2OINA 1ZSKA 2KOJA 1N6FA 1C5NH 1HAVA 1W10U 3SU3A 2ANYA 1C5LH 1FLEE 1YPEH 1RTFB 3PTNA 1UTQA 5FCKA 1O34A 3LH3A 1XMNB 2FODA 4B73A 1GDQA 2AWXA 2HVXA 3LOXA 2ZPRA 1P3CA 4UFFH 3HPKA 1C5WB 2YUYA 2B8OH 2ZU4A 4FGMA 5DP7A 1CQQA 4K60A 5T6FA 1OWKA 1PQ8A 3UNRA 4NIVA 4MLFB 8KME2 2O2TA 3VQFA 1JXPA 1G9IE 1MCTA 4H6SB 2BQWB 1C2IA 3ZV8A 3CYYA 2B9LA 2O8WA 2KOHA 2RG3A 3E0PB 5HFBA 1ZPCA 3BG8A 1Z1IA 1O2KA 2BYGA 2M0TA 5C5NA 2A0QB 1Y3WA 2FOMB 2OBOA 5FX6A 2ZDKA 1TYNA 3A82A 4D7GA 1YP9A 2BD2A 3FY5A 2QGRA 2IPHA 3RXHA 1BTYA 3EDXB 1RIWC 4FUGA 1W0YH 2PKSB 1L0ZA 1GMDG 3V0XA 5E0GA 2HGAA 3MU1A 1BHXB 5JYIA 5GXPA 3U69H 2GZ8A 2BDHA 2ALVA 1V2MT 4Y10E 2KJPA 1S6HA 4AYYB 1LVOA 4HTCH 2F91A 1H4WA 1HIAB 2EEHA 3UUZA 3GYMA 3ENSB 4AORA 3K6ZA 1LKBA 1MFGA 2J34A 4NXRA 3O8BA 2D2DA 1A7SA 1ACBE 1BTXA 4Q2PA 1AVXA 2Y82A 3SOEA 1GJ8B 1HJAC 3BTTE 2DE8A 2TGPZ 1HJ8A 1TOCB 2R2MB 2Q6FA 4Y8XA 4WYTA 1PJPA 1PYTD 3SW2B 8ESTE 1AI8H 4O03A 3B76A 5EXLA 3MU0A 1BB0B 1WSSH 4BAQB 4JOFA 1CGJE 1CGHA 1GGDB 2Q6DA 4U30A 1Y7NA 3RDZA 3BF6H 5H4IB 1QJ6B 4UE7H 1ZHMA 1V2PT 1O5GH 1NT1A 3QDZB 1RGRA 2THFB 5A8ZA 1H8DH 2EGOA 4I8KA 5F8XA 4K76A 1EZSC 1O5BB 3KZEA 3HATH 1INCA 1OWDA 2BDIA 2XCNA 4WXIA 4YOGA 3ZYEA 4AFZA 1C4Y2 1TRYA 1O2XA 4IN2A 3GY8A 1VJ6A 3TGJE 1OWEA 3HK6B 1OWIA 4BAHB 2P8OC 2VWLA 2WV5A 4K8BA 5DP5A 2TBSA 1F92A 1TGSZ 3A88A 4XE4A 3E17A 2XTTB 1N6XA 4EDJA 3UR9A 1HIAA 1C2MA 3ITIA 1O2VA 5J4QA 2M0ZA 2D26C 2FTLE 1V6BA 2SNVA 2OD3B 2WV4A 2PDZA 3QDOA 4Q3HA 3RC5A 3ATLA 2QXGA 4Y6DA 1YLCA 4IC6A 2EEGA 3ZVBA 2OSGA 1QAVB 1GJ6A 2ZHDA 4MPUA 4XHVA 3A85A 1RTKA 4MTBA 2XYAA 3FANA 2R0LA 1YYY1 2BDBA 3RXFA 3M61U 4AZ2B 1A1RA 3ZZCA 1DOJA 3O8RA 1JIRA 1DS2E 1BBRH 2F9OA 4I8HA 1AIXH 3MNSA 3RXKA 2IWQA 1A0JA 2Z9IA 4JZ1A 1U39A 3LC5A 5AHGH 3EGGC 1E34B 2ZFPH 3MFJA 8LPRA 1IHJA 4E34A 3RLEA 1ETTH 4KTUA 1MU6B 1MC7A 1QIXB 5EPYA 4MNYA 3TNSA 1HJ9A 1J8AA 4DOQA 3FP7E 2YUBA 1D3DB 5LPEA 1GHAF 3PROA 2EI7A 1BMLA 3AVZA 3KN2A 3DFLA 1C1QA 1JBUH 1WV7H 2EEKA 5F03A 4I8JA 1IQMA 1MKXK 3JZ2B 3SHUA 2ZFRH 1DITH 2Q6GA 3URDA 4Q6SA 1UCYE 5CE1A 1TMBH 4X8TH 2OQSA 2HALA 1UVPA 1TNGA 2C8XB 1UM7A 3TJUA 5HFCA 1DUAA 2WINI 1QL7A 1W13U 2UWPA 4Y11E 3EE0B 1QAVA 2H2CA 1NN6A 1OPHB 3ATMA 4Z6AH 2CF8H 1ESBA 3RXJA 1P9UA 1WBGB 4TY7A 5FPYA 1OZIA 1HXFH 1O2TA 1C1PA 1EASA 2FOBA 3NFLA 3ELAH 1J16A 2O8UA 1FJSA 1QNJA 2SGDE 2PW8H 1BTWA 1HPGA 2XXLA 1O3KA 1FV9A 1TA2A 3ATWA 3UTUH 2OC1A 4GHQA 5C5OA 3V13A 3S9BA 3O8DA 1KXEA 1VCPA 2KPKA 3ZVFA 2B5TB 3MO9A 4G69A 1EJNA 3FVFB 4I32A 2IWNA 4UFDH 1DY8A 4K3JA 3F9EA 1GG6B 3AASA 4TY6A 1MD7A 3RXEA 5GDSH 1O3LA 2G81E 3MO3A 1TGTA 4AGJA 2W5EA 3CBXA 1BHXF 8GCHF 2KQFA 3A80A 4CRBA 1MTVA 4ISNA 4UD9H 2QV1A 2GVFA 1P2JA 2FZZA 3F68H 3VXFH 1IAUA 4D9RA 4AG1A 2OCSA 1ZPZA 5HEDA 4P0CA 1JOUB 2HNTE 2PLXA 3RU4E 2ODYB 4K5ZA 4HOPB 1TNHA 1O3DA 2SGFE 1SQOA 2HE2A 3SGBE 4JZDH 4XBCA 1C5UA 1P02A 1DDJA 2V35A 5HYOA 2CSJA 1P1DA 2UUFB 1GJCB 2C90B 3VB6A 5C2ZA 6GCHG 1G30B 2VPHA 2SGQE 1FC7A 3TH2H 2KA9A 2JOAA 2PR3A 3PMAB 5JBTA 3SBKA 3A7XA 3MH6A 1GVKB 1O3GA 4R0IA 3PO1C 5EXMA 2BQ7B 5FX5A 1LHDH 4CHAB 2ANKH 1TQ7B 2AH4X 4K1EA 1EXFA 2AGEX 2BX4A 3QTVH 3DA9B 1TABE 5JBCS 4GCHF 4R2ZA 1RGQA 1G32B 3ZRTA 3BG4B 2D90A 5EPNA 1TPSA 1HAYB 2DB5A 3WY8A 2FI5E 5DPAA 1QBOA 2XWBI 2F3CE 2KL1A 2R2WU 3KNXA 1EX3A 2J2UA 3VXEH 1C5TA 1SFQB 4XFQA 3LGYA 4XSKU 1WQSA 2BLOA 1GBFA 2P3TB 3SUFA 1C2FA 3PM3A 3DUXH 3HGPA 3I77A 1V1TA 2SNWA 3S7HB 2FNEA 2XC5A 5SGAE 5I7ZA 4UU6A 3M5NA 2Q1JA 1W9OA 1YM0A 4RN6A 4YT7H 3QE1A 2GCTB 1TX8A 2P16A 3G01A 3NCLA 4GAWA 1BMNH 1F7ZA 4Y8ZA 1AZ8A 5JXBA 1WTHD 5E2OA 3BTGE 1W14U 4BOHA 1P2KA 1P03A 3MMGA 3LGUA 2BXUH 4IS5A 2QXJA 3M7TA 1C5SA 2VU8E 2FYRA 2ZFSA 3E8LA 5FPTA 2PSXA 4IMQA 1RGWA 2UZCA 1VAEA 1ELDE 2OQUA 2OZFA 1SBWA 2FTMA 1QB9A 2ZNKH 2ZF0H 3HK3B 3DJ1A 3LJOA 1O2MA 1BOQA 1SGIB 2A32A 1DSTA 2ASUB 4JZIA 4K8YA 5A2MH 2GCHF 2ZHQH 1MQ5A 2EI6A 1UVUH 2V0BA 4IMZA 4X6NA 1CU1A 1ZTJA 2FOGA 2OP9A 1LDTT 3RLWH 5FBEA 2J95A 4NA7A 4GUXA 1FY4A 1DANH 4FUBA 1U6QA 2VWNA 1KWAA 1ABJH 1TBZH 4Q7XA 1TX7A 2ZPQA 4TWYA 2WUBA 3RL8A 4BAOB 3HKIB 2R3YA 1UTNA 2EHRA 2QKTA 1EAUA 1WCZA 1YF4A 4WF8A 2ZHWH 2VIQA 1GCDA 3WKMA 4NXPA 3LT3A 4YO9A 5JBBS 2FCFA 2I1NA 5A8XA 1GBBA 2A4QA 3T26A 2DLUA 1DLKB 1SPJA 3RLYH 1D6WA 1V2ST 2Z3CA 2GZVA 1Y3YA 1E35B 1HRTH 1FAXA 1L4ZA 2VNTA 1B7XB 1SI5H 2PV9B 2P95A 1LHEH 2JH0D 1RFNA 1ZGVA 5DKMA 4ZH8A 3OX7U 3UWIA 3STIA 5A2PA 4Y0YE 1CA8B 1MTUA 2B7DH 4K72A 3V12A 1GHAG 1LQEA 1PDRA 4NMVA 1GI9B 2J38A 3MH4A 3RXDA 3ZZ8A 5DP8A 1P3EA 2VGCC 1UHPA 3SN8A 5ESBA 4NWLA 2ZPSA 3BTDE 1XUKA 2M0VA 3SFJA 2QY0B 7KMEH 3QGNB 3FZZA 1TX6A 5IYTA 5I46H 1NU9A 1GBCA 1LHCH 1S0QA 5LH8A 4XBBA 4ASHA 4THNH 2A1DB 1O2ZA 3M37A 1Q3OA 3SNCA 1DWCH 1ZMJA 4TWWA 3U8TH 3AXAA 1HUTH 2GX4A 1SGQE 3TPIZ 3RM0H 3RXRA 1O39A 1D5GA 5BPEA 1P06A 1AUJA 2ZGXH 9ESTA 1YPJH 3QZQA 1L1JA 1SFIA 1XX9A 2FYQA 1WFVA 3QO6A 4ZHMU 2HWLB 1UVOA 1NFXA 1CVWH 1L6OA 1MTNC 5ESTE 2XCFA 4Q2NA 5ETXA 2Z9GA 4CR9A 1OYTH 3UFAA 4HGCA 4CRGA 3SUZA 3E90B 4X2XA 1G3CA 4K2YA 3H7TA 2FM2A 5PTPA 3A89A 2G00A 1ANDA 1DWBH 1N7EA 1O3FA 1GBMA 1K28D 4A7IB 3P8GA 1MAYA 5LPFA 1MTSA 2DLSA 3KIDU 4Y0ZE 4NMPA 1KXFA 2R9PA 1O2IA 4Y76A 1SGEE 2CJIA 3GY3A 4E35A 7GCHG 3GDSA 3GDVA 2AMDA 3RUOA 1L2EA 4JOJA 2A5KA 1QHRB 1THPB 1ZHRA 1GPZA 3RMMH 3ZZ5A 1TP3A 2GMTB 1HCGA 1OKXA 4O06A 1HAIH 1F2SE 2UWLA 8GCHG 5E22A 3R69A 3BEIB 4GVUA 3CP7A 1XKAC 2QIQA 1CBWC 2BLVA 3NUMA 1Y5UT 1V2NT 1O2GH 2QN5T 4NSYA 5F67A 2BZAA 1DWDH 1Y5BT 1QRZA 3F9GA 3FP6E 4AB8A 1QBNA 3OSYA 4KKDA 1UEZA 2O8TA 3A7TA 1OP8A 3LU9B 2ZWLH 1CT0E 4IW4E 1GBTA 4JL7A 1ZTKA 4RKOB 4UDWH 2M0UA 1QB1A 3SZNA 2AIPA 2AS9A 5C1YA 4X6OA 2D8WA 2V3OH 4NA9H 3WKLA 5EZ0A 5DP3A 4UFEH 4AG2A 2ZDLA 2PGBB 1SHHB 3LNYA 2YTWA 1C9TA 1TQ0B 2ZGBH 2Q3GA 3SHAH 1WI4A 4JYTA 1BRUP 4TPIZ 2AERH 5AF9H 3RMNH 1TBRH 3PDZA 3T62A 2ZDAH 2P59A 2WPJS 1AZZA 1WAYB 5DJ7A 3VEQB 1FY5A 1N8OC 4WVPE 3VB3A 5A09A 1ID5H 3KQDA 4JOKA 3O5NA 1EOLA 1PPZA 5HEYA 2FLRH 5F8TA 1SGYE 4X1SU 1NRNH 1P12E 2ZC9H 1NO9H 3SI3H 1O3AA 1TALA 1GMHF 1ZMLA 2JREA 1U3BA 3BN9A 4UFGH 4WWYA 4ABBA 2PKTA 2KRGA 2F9VA 4NG9H 1ELEE 2FESH 3ATIA 5GCHF 3Q00A 3F1SB 1TFXA 1UF1A 5E11A 3JZ1B 2G4UA 4X1PU 2RA3A 3TJNA 1YPLH 1BFEA 1E37B 2BX3A 1P57B 1EATA 3A8AA 4Q7YA 1GI7B 1A4WH 3M5MA 4SGAE 2A4RA 5F8ZA 1P2OA 2BLWA 3SJ8A 1S0RA 1H8IH 4J1YA 3A83A 1MKWH 1K22H 2G5MB 1UCYK 4WMFA 2LC7A 2RCEA 2Z3EA 1ZRKA 1VITF 1V2WT 4OS4A 4WXVA 3K1RA 5E6PB 4FUDA 1AKSA 3BTEE 3LIWA 2JXOA 2AGGX 3SJ9A 2ZDVH 2A31A 2ULLA 1KYNA 3S9AA 1QL8A 2H9HA 4O3TA 1PQ5A 1KEFA 3U9AH 3KF2A 4E05H 5F6MA 4OS2A 4YYXA 2JETB 2OS6A 5FBIA 4LMMA 1SGFA 4I8LA 2GCHG 1ARBA 1TNIA 2WPIS 4P2AB 2DJTA 5HEBA 4NA8A 4X8SH 1Y3XA 1AFQB 2FX4A 1RIWB 3I1EA 2PKUA 2VSVA 5G4BA 5A0AE 1GI0A 3OU0A 4JYVH 2BD4A 1LCYA 4KELA 2AWUA 1SC8U 1RXPA 3GCHB 4ZROA 4K1SA 2AWWA 1F0TA 3PLBA 1AY6H 1MCVA 1UTOA 4NFFA 3RXQA 2IJOB 2PKSC 5EQSA 2EGNA 1DLEA 2STBE 3RP2A 1K1JA 1X5RA 1GI1A 1ELBA 1W7GH 1C2KA 2XBYA 1ELFA 5GPIB 1N6EA 3HGNA 1O3NA 4ZHAA 1LVBA 1FPCH 2Z6BD 1TP5A 4K78A 1MTWA 1UFXA 1WYKA 5L2ZH 4VGCC 4MNXA 2BY7X
chains in the Genus database with same CATH superfamily
2W4FA 3EGHC 2XBVA 2ZTZA 1IQFA 2TIOA 1GI3A 3PV2A 1RRKA 2YT8A 3N7EA 4JYUH 1VJAU 2Z94A 3E1XB 2GT8A 3SJOA 5EU8A 5JDUB 4RKJB 1NFWA 3OTPA 2ILNA 1YCPH 2L74A 2M2AA 3SUEA 3M5OA 2DKRA 3SNEA 1W12U 1VJ9U 2RCZA 3I18A 1O32A 1FAKH 4NZQA 4E06H 2X7ZA 1AQ7A 2Y80A 1PPGE 4YESB 1MAXA 4FXGH 1ESAA 2JKHA 4ZHLU 2VWRA 1GGDC 1FY8E 4JK5A 1IQGA 2FO9A 1UVSH 3D62A 3GJ9A 2P3WA 2BY6X 1NRRH 3CENA 1SSXA 2VSPA 1FQ3A 3OY5U 1A3BH 2ZP0H 4ISHH 1YGCH 2WPMS 3OE7D 1AN1E 1BE9A 1AU8A 2K8IA 4IBLH 4RI0A 3SQEE 4NIYA 4YDPA 3NRLA 2CSSA 2F4LA 3GY2A 4WYUA 2KYLA 3W1EA 2JDID 2QKUA 4LZ1H 3F3BA 2KJDA 3MNCA 1UTLM 3VGCB 1QRXA 1QBVH 2GDDA 3I4WA 2GKVE 5EQRA 1FPHH 5FCRA 2WPDD 1CT2E 2ZZUH 1KLIH 1SVPA 1Z8IB 1BCUH 3SU5A 1O3CA 2BMGB 2LELA 1BTUA 1QQ4A 4ZKNU 1J14A 2A7CA 1KDQA 4F49A 1C5VA 3HPTB 4L8NA 1SG8B 2HPPH 1N6YA 3TSWA 4X2WA 1K1LA 2TGAA 3SU2A 3IG6B 5D13A 1B0FA 1Q3XA 3LONA 3SU1A 4A6LA 1GI5A 3M3VA 4A92A 2GZ9A 1L4DA 3SUDA 1ZPBA 5GWZA 1VKYA 1T31A 2FLBH 3DSOA 2DM8A 3TVJB 4JZFH 3FP8E 3GYLB 1GI8B 1X5NA 3DIWA 3F9FA 1TBQH 2OMJA 3ZIAD 1AB9C 5TCAA 1CT4E 1O31A 3ZZ6A 2G51A 4OM9A 3EA7A 1XVMA 3RXUA 3MNBA 4U01A 3F2HA 4AFSA 1WOFA 1P2IA 1LKAA 1THSH 5T6DA 1C5PA 1YLDA 1DXPA 1T2MA 3K82A 2G5NA 2K20A 1D3TB 1U37A 1Z86A 4HG6A 4CBNA 1VA8A 5G1DA 2FI4E 1BDAA 3MWIU 3S9CA 1M5ZA 4X2VA 5L30H 2V1WA 4F4OC 4CRCA 5EGMA 2CS5A 1AHTH 3K50A 3MU5A 1O35A 1GDNA 1GI2A 3FN8A 4H4FA 2ZPMA 3BV9B 4MNVA 5E0HA 1L1GA 4AOQA 1HAZB 1P1EA 1QLCA 1V62A 3ODDA 2HOBA 3OY6U 3QZRA 3GCOA 2XC4A 1IQKA 1OWJA 4OEOA 2XNIA 3PV5A 4Z8JA 5E0JA 1DT2A 1HAHH 2ZU5A 2M10A 3CS0A 3E91A 1O2UA 5E8EH 2XBWA 2NU4E 1IQJA 1CHGA 1TMTH 2W7RA 2SFAA 3TITA 1VCWA 2XRCA 1TPPA 5EJ1A 5G1EA 5A0CA 2AYWA 3VQGA 5GLJA 4X6PA 4NSVA 3TJVA 5HDYA 4GPGA 3F2GA 5GCHG 3LNXA 1FC9A 2WPHS 1IHTH 1NZQH 5HM9A 4I7YH 1SLWB 1DY9A 3SJKA 2V7QD 3PLPA 1BBRE 4OAJA 4JMYA 1GJAB 1XUIA 3BTKE 4NNLA 2EEJA 4X1RU 1ELTA 3KQCA 1QGFA 1GBLA 2RA0A 1S81A 3TIUA 1E36B 3N99A 6CHAC 4LOYH 1AVWA 2AMPA 1T8MA 1ZRBA 2I0IA 3DSGA 1Y3VA 1UTPA 1TAWA 3QIKA 3OYPA 1TOMH 1GG6C 3SHWA 4SGBE 3BIUH 1ANBA 1H9LB 2I4SA 3GS9A 1AGJA 2J97A 1VITG 3O8CA 1UMAH 2UUYA 2GZ7A 1GHXH 1LMWB 2P93A 2A2QH 3M35A 2FOAA 3NWUA 1ETRH 3KQEA 3EQ0H 1SHYA 2ZGHA 1GI6A 2FIRH 2FI3E 2FOFA 2PUXB 4AB9A 1X9ZA 1ZSJA 1GBDA 1WI2A 3KL6A 3ID2A 4B2AA 2Y7XA 4BTUB 4JOHA 2CXVA 2AFQB 2QF5A 3TLOA 1Z6JH 2GT7A 3VB5A 2O8LA 1MKXH 3K65B 1VGCC 1GJBB 3QN7A 3S0NA 4DIIH 3N7OA 2Y5FA 2OXSA 1QB6A 3TH3H 1I16A 4MG3A 1FMGA 2AMQA 3SO3A 1TNLA 4MNWA 3KYGA 1OBYA 3UWJH 1N99A 1F0SA 2VZ5A 3C1KA 1T8OA 1PPFE 1GHWH 2BB4A 2ZTYA 1FNIA 2D8IA 1W8BH 5FHTA 2WPLS 3E6PH 3GICB 3RM2H 3GGEA 1CHOF 1FZZA 3ZVEA 4NIXA 4CHAC 4I33A 2VIVA 3ZZ4A 3FAOA 1ESTA 5CMXH 3LPRA 1UJ1A 4H42U 2AINA 1QJ7B 1UJUA 2I04A 4PQWA 3R68A 2W26A 1ELVA 2YNAA 2YMSD 3P92A 1SGNE 2ANMH 1O2QA 3K6YA 2BVXH 1DUEA 1KIGH 2C4FH 1OS8A 1FUJA 1LPKB 2P94A 2KG2A 1NRQH 2ENOA 2AGIX 4Q80A 2KAIB 1BMFD 1IQIA 2BYAX 2BXTH 1EPTB 1NM6A 2HNTF 2PTNA 3ZVCA 1X6DA 1C1VH 5EXNA 2SGEE 3DT0H 2KCPA 1C9PA 3QJNA 3O46A 1BJUA 1YPHC 1TRNA 1EP6A 3UPEA 4ASUD 1WF8A 5HFEA 2LOBA 1WFGA 3U8RH 4AFUA 1DPOA 2AEIH 4OGXA 4B74A 2NWNA 4BNRA 1S5SA 4NMRA 2GD4B 2WPKS 3MYWA 5GJ4B 4ZKRU 2CHAC 1CA0B 4YOIA 3OFND 2A45B 1KXBA 4INLA 2ZPLA 2BZ6H 2KJKA 2DAZA 2MX6A 3URCA 3ZVAA 1C5QA 1YPKH 3VB4A 2HVYB 2NU3E 1C1UH 1TE0A 4D9QA 3KYFA 2BLQA 4A1VA 4OS7A 2BY9X 2ZI2H 3EYDA 5B6LA 2B0FA 2FDAA 2OQ5A 2CN0H 4UONA 2BDYA 1SGPE 2QF4A 1V2TT 2EV8A 1EB2A 2F9NA 1IQHA 2K1ZA 4FU9A 3T2NA 4MPXA 3SGQE 2WL7A 1EJAA 1EZUC 1N7FA 2IWOA 1Q7XA 1V2VT 2BY8X 1SGCA 5E1YA 3TJOA 1TLDA 1GMDF 4FUIA 2KAIA 3TK9A 1S6FA 1ZLRA 1EPTA 4YT6H 1WHDA 2QG1A 4ABGA 1TONA 2BD9A 5EW1H 2H5CA 1GJ4H 1Y5AT 3SV7A 3A8BA 2ZHEH 1HDTH 1Z1JA 3NGHA 3P6ZB 4NMOA 2Y5HA 1ORFA 2ZCKP 3JXTA 1V6DA 2D1JA 2QXIA 4CREA 2G4TA 2CGAA 3PS4A 2XW9A 3BEFB 4FU8A 1F5KU 3SHCH 1D6RA 1U38A 3T28A 1G2MA 1G36A 1LVMA 1R6JA 1GCTB 4IGDA 1SLUB 2UUJB 1UTMA 2DC2A 2CV3A 1FY3A 3BTWE 3SORA 1SLVB 2HPQH 3SQHE 4CH8B 1ZGIA 1MZAA 1QA0A 1AUTC 3UQOA 2BDCA 4NXQA 1O5EH 1ZOKA 1C5XB 1FIWA 1AE5A 5EG4A 1WUNH 1UEPA 1PQAA 2QF0A 1GM1A 3M3TA 4B6EA 3SV2H 3SV9A 2FS8A 2C93B 1C4U2 3HKJB 1GVZA 3KHFA 1H9HE 4GHNA 3UQVA 2SGAA 4Y71A 5EOKA 3QLPH 4X2YA 2ZECA 3RXIA 3Q76A 2H2ZA 1V5QA 3U8OH 4MQAA 1K32A 1SGTA 3Q77A 1SQRA 1O2SA 1Q31A 2STAE 1O2JA 5JBAS 3EAJA 4ZUHA 4MPAA 2R0KA 2GV6A 2PHBA 1VITH 2P3FH 2J4IA 1C1MA 1XXDA 4F8KA 2SGPE 4XRNA 1ELGA 1IQNA 1EJMA 1V2LT 4B76A 5F53A 2TRMA 1TGCA 4GLYA 1ZR0A 4DG4A 1ZUBA 4ZXYH 4Y7AA 3GY4A 1NTPA 1ZJDA 2HLCA 1JIMA 4DJZB 1SL3A 2TPIZ 2OPGA 3ODFA 3RL7A 3PTBA 4ISLA 2ZGCA 4AGKA 3GDUA 1TA6A 1TGBA 3R3GB 4BTTB 2KR7A 3UOPA 2IPQX 1JRSA 3RXBA 1GHBF 3CBZA 1K1NA 1O36A 3M7QA 5ABWA 1C1RA 1AWFH 2YT7A 2FOEA 4Q7ZA 3ID3A 1GBJA 3F0PA 4WH8A 4FUHA 3MI4A 3MU8A 5C67A 3QTOH 2BD7A 3LJJA 5A8YA 4WJG2 1B8QA 4GHTA 5DP9A 1QAUA 3FOAA 1CBWB 4FUCA 5EJLA 1KSNA 2FOHA 2G8TA 5CHAC 2ZFTA 3W94A 4DURA 1P04A 3A8CA 2KV8A 1TB6H 2FOCA 5LPRA 5HMAA 1GI4A 1JMOH 1QFKH 3TMHA 1GBEA 3M5LA 1GWAA 1XM1A 1UTKA 4CRFA 1BMAA 1G2LA 4PROA 1XXFA 1GQ5A 5C3NA 1W9QA 1BZXE 2FPZA 4HFPB 1HFDA 1TMUH 4MVNA 4NIWA 1T8LA 3LDXH 5EW2H 3SV6A 1AKSB 2VVUA 1DVAH 2FP7B 2P3UB 1GJ7B 3DJ3A 2HE4A 1BT7A 1MQ6A 3E0NB 5AVDA 1BITA 1UK3A 1WXRA 2Z9KA 1VB7A 1HGTH 3BTFE 1UK2A 1KMHB 3BEUA 4GCHG 1VCQA 2BD5A 3GCTF 1A5GH 2EA3A 1EOJA 3SOSA 3LGWA 1K9OE 2PKAB 4INHA 3PB1E 1S84A 1P09A 1N1LA 2LNCA 3DJAA 2VVCA 1W0ZU 3KHVA 5EYZA 2KPLA 1FN6A 1HLTH 1DICA 2F9PA 2V6NA 1ZSLA 3F6UH 3QK1A 3KDKA 1OYQA 2WYJA 3BIVH 1TGNA 5FAHA 3LC3A 1EP5A 3RXVA 1AWHB 1EAWA 3R0FA 3RU4T 1IHSH 2A2XH 3BTME 5TCCA 1CGIE 4OS6A 1UITA 1T7CA 3LGVA 3FFGA 1KXCA 3ZZ3A 4B1TA 1C1SA 2ZFFH 1MD8A 2ZFQH 1GJ5H 1W9EA 2KOMA 9LPRA 2QC2A 4WMEA 2I6QA 3ZZ9A 1ELAA 5A0BA 2ALPA 1UJDA 1FDPA 4AFQA 4X6MA 3KQBA 1G9OA 1P2NA 1UEQA 2ZHFH 2QT5A 1G3DA 1T8NA 2KCYA 2PSYA 2R3UA 4R8TB 2W3KA 1N7TA 1H1BA 4Z0KA 1SOZA 4XBDA 3R0HA 4BTIB 5JPMH 2BVRH 3K9XB 1N6DA 4DY7B 2V3HH 1NBME 4IN1A 1A5HA 2TGTA 4H6TA 5B6OA 3TNTA 3TK5A 4OS1A 3SGAE 3H7OA 1IQEA 3A8DA 3F0OA 5KGOA 3UAIC 2Z3DA 3OTJE 1T4VH 1WTGH 4ZCNA 1TIOA 5C1XA 2GP9B 4BAKB 1EUFA 3UNSA 4ZAEA 1ZZZA 3OEED 4X0WU 1IU2A 2PKAA 3PLKA 2A7HA 4ABIA 2OUAA 2F83A 3UREA 3EGKH 3PV4A 1UK4A 2CF9H 1X8SA 1TRMA 1ZTLA 4WY3A 2WUCA 2QA9E 6GCHF 1K1IA 2JETC 4MPWA 2LC6A 3LGIA 1O2LA 1GBKA 4M9FA 2Y81A 2EI8A 1LQDB 2OLGA 2ZTXA 1AFQC 4Q6HA 4ABEA 5C1UA 1BBRK 1G3EA 1O2PA 2GV7A 2OC8A 1O3IA 4NMSA 1ANCA 1W2KH 3VPKA 3MH5A 2Y7ZA 3KZDA 1OBXA 1D4PB 1A0LA 1HJAB 3RXMA 1PPHE 5ILBA 2BD8A 4NMTA 1GL0E 3NXPA 3GCHC 4KGAA 4VGCB 1UEWA 4NGAH 1PFXC 3VFEA 2BQ6B 4O9VA 1Z8GA 1RZXA 4BXSA 1ANEA 4KP0A 2M3MA 3PDVA 4K69A 1EAIA 4CRAA 1HNEE 5BRRE 3QGLA 7ESTE 4HI3A 3A7VA 1ZMNA 3LH1A 1KDQB 3P8NA 5I25A 1ZJKA 2KFWA 1BRBE 4Q4LA 3AK5A 3SV8A 3S69A 4IC5A 5HJ1A 4E3BA 1O33A 1QZ8A 2I6SA 4B75A 1O37A 1MZDA 3RXLA 1H9IE 2BY5X 1AO5A 1V2RT 3T27A 2H1UA 4ESTE 1XUGA 3L6PA 3UIRA 5HGGA 1DE7H 1OSSA 5HM2A 1B5GH 1C2LA 4CBOA 3KDGA 2L4SA 1K1PA 1KXAA 1FONA 2FEQH 2NU1E 2P8OB 3PMJA 1B0EA 2Z9LA 4LK4A 4D76A 1Q3PA 4ABHA 1UCYH 7LPRA 2CMYA 4ISOA 5DTHA 1YBOA 3VB7A 3BPUA 4UU5A 2JILA 2L97A 1LHGH 1W3CA 4JK6A 4Y7BA 2ZQ2A 5JB9S 3QX5H 1A2CH 2O9QA 2ZEBA 3H5CB 2EC9H 4QT8C 4U32A 3LKWA 1RD3B 2FX6A 2FE5A 1PQ7A 3SNDA 3RMLH 2EEIA 2LA8A 4OGYA 4ABFA 1SLXB 3V7TA 1C1OA 1PPCE 4P00A 1NRPH 4TPYA 1FIZA 2BDGA 3NPSA 1LO6A 4HZHA 1BJVA 4JORA 1MBMA 4BXWA 4FVBA 1GHBG 1Z8JB 2BD3A 2QCYA 3SU4A 4X8UH 1GHZA 3VGCC 3KCGH 2HNTC 3CNRA 3L3TA 1THRH 4Y79A 2IN2A 1GBIA 1GBHA 2ZU1A 3CS7A 1OP0A 1MFLA 2WSSD 3CH8A 3GY5A 1V2KT 1TQ3A 2VIOA 2PWXA 1QL9A 3A87A 2FXRA 4DGJA 2BDAA 1PPEE 1O38A 1ELCA 1P2MA 2IOTA 4D7FA 2ZO3H 2F0AA 1AB9B 1NFUA 2BVSH 2VH0A 3NK8A 3HPMA 1HAOH 1LTOA 1QURH 2Y6TA 3E16B 4OS5A 2I0LA 2F9BH 1GQ4A 1MABB 2G5VA 2H5DA 2H3MA 3ZVGA 4M7GA 3GISB 3DHKH 1O3PB 1O3BA 1IQLA 1QA7A 1EB1H 4WMDA 3S7KB 4ZKSU 4LZ4B 1LVYA 4Z1MD 2H9EH 1KTSB 2PNTA 1GMCF 2ZA5A 5J4SA 3GY7A 2JIKA 3GCNA 5C0UA 2PA1A 2ODPA 4JJ0A 4WH6A 4YOJA 3A81A 1HAPH 2VH6A 4B2CA 1NRSH 2ESTE 4KFWA 3IWMA 5KECA 4JZEH 1O3HA 1BIOA 4DIHH 2EJYA 3NFKA 2ZG0H 1E38B 1L1NA 2A4GA 4A5TS 1P8VC 1NROH 1C2GA 3RC6A 5HF1A 5IL9A 3SI4H 1DXWA 2Y5GA 2GDEH 2LUIA 1H8HD 2BM2A 3GCTG 1MBQA 4YZUA 1UHBB 1SKYE 1SGDE 4FVDA 1GMHG 1IOEA 3CC0A 1Y8TA 4JCNA 3SNBA 4X1NU 2OCVB 1AVGH 1C2JA 1CE5A 1C1TA 3ZVDA 4H11A 1XVOA 1BRAA 5T6GA 1O0DH 2VIWA 1D3QB 1A0HB 2JH6D 4DW2U 2XC0A 1K1OA 5E21A 1QQUA 2IWPA 2YOLA 1SQAA 3U1IB 2C8WB 3ZYDA 3U1JB 1KLJH 4OEPA 1Y59T 6CHAB 1X45A 5GIBA 3L4FD 5EQQA 1W11U 1OX1A 4ISIH 1SMFE 2G52A 3TK6A 7GCHF 1SB1H 1GVLA 1O3EA 1GHYH 2LPRA 3K2UA 3KQ5A 3UY9A 2JWEA 5HF4A 4AYVB 1YY3A 2GGVB 1QRWA 1Y3UA 4J2YB 1NY22 2G2LA 1OWHA 2D92A 3P17H 6ESTA 1O2WA 2GTBA 3PMHB 1NESE 1NBMD 2BTCE 2F5YA 1C5MD 2HGTH 2VIPA 1WQVH 1O2RA 1DM4B 2V90A 5IDKA 1UHBA 2ANWA 2EGKA 1C1NA 1BUIA 1C5ZB 1BTZA 5DN6D 5T3HA 1W7XH 2VBCA 1S6LA 3E3TA 4O3UA 2VRFA 1VGCB 3GSLA 2QYIA 2EXGA 2ZGJA 3TU7H 3PO1B 1WHAA 2MHOA 5DG6A 1A3EH 1NU7B 4XDEA 1FY1A 1PYTC 1FCFA 3PWBA 3AAVA 2VWOA 4LXBH 3MOCA 2W7SA 3SU6A 1BQYA 1QCPA 2NU0E 4NCYA 4NMQA 1MUEB 1RS0A 1YKTA 4Z33A 4Q2OA 1A46H 4ABDA 2H6MA 3P70B 1MU8B 2ZKSA 4ZKOU 4NNMA 1M9UA 2HRVA 5E2PA 1NS3A 2Z9JA 2G55A 1CSOE 3C27B 1E0FD 5HXFA 1Z6EA 4B71A 1RTLA 1G3BA 2FS9A 2PFEA 3BG4C 2EDZA 3P8OA 5K7RA 4X1QU 2K1QA 1UTJA 3GOVB 1P01A 2ZDNA 1WF7A 3RXGA 1YPGH 4FUEA 2TGDA 1TNKA 2RDLA 1SR5C 4XOJA 1GJ9B 1FC6A 2XWAA 2PZDA 1VR1H 2ZCLP 2AIQA 1K1MA 2VB0A 3DFJA 3TH4H 1OOKB 3W95A 4FLNA 1A5IA 1GL1A 2VWMA 3N7DA 3EA8A 3U98H 4ABAA 4ZXXH 1NTEA 2GCTC 1S83A 1ZOMA 2YNBA 4A1TA 1JRTA 5GNDA 2H2BA 4HOPA 1T32A 2WYGA 4FU7A 3PYHA 2KAWA 1DWEH 1X5QA 1TPAE 1MMJN 1EPTC 2FMJA 1YPMH 5LGOA 1FI8A 2XBXA 2CHAB 2Z17A 1AMHA 2A5IA 1C2EA 1V2QT 5AFZH 1KLTA 4N6XA 4NFEA 2C8ZB 2DE9A 3L33A 1C4V2 1GHVH 1YBWA 1UJVA 3F2FA 3A84A 4JJ3A 2Z7FE 3EA9A 1C5RA 3T25A 4X8VH 5EODA 1HV7A 4GVDA 5DK1A 3QUMP 2REYA 3SZEA 1CA0C 1V2OT 1HB0B 4Q63A 2RFKC 1RY4A 1XKBC 4NWKA 2VJ1A 2JINA 2UWOA 3ESTA 3FKSD 5H3JA 3BTQE 3RXPA 4Y8YA 3CBYA 4INKA 3Q3YA 1OBZA 3ID4A 1P0SH 1ETSH 3PMBB 2VVVA 1S82A 3M7UA 2PUQH 3BSQA 3KEEA 3RC4A 5DO4H 1WH1A 1BMMH 1QR3E 2ZU3A 3QGJA 5FPSA 3M3SA 4UEHH 4DCDA 1Z8RA 1WU1A 1YC0A 2J9NA 5B42A 1E1RD 1A61H 1BTHH 3A7WA 3T5FH 4TYDA 5TJXA 3A7ZA 1EKBB 2A5AA 1HAXB 1O2NA 4I31A 2FWWA 3QWCH 3MU4A 4KTSA 1O5CB 4NZLA 2VINA 1SOTA 2I6VA 1SGFG 3SJIA 1P10A 2ODQA 1JWTA 1LPGB 1G37A 3M36A 1K21H 5HFFA 1CO7E 3RXAA 2VGCB 4AC9A 4BANB 5HETA 3RXCA 2R4HA 1WDIA 1O2YA 3A86A 3AW1A 2O8MA 1BRCE 3UOUA 2ZU2A 2RRMA 2C3SA 1KXDA 1TNJA 3B8JA 1V5LA 4Q2QA 2ZCHP 1XUFA 2PGQB 1C2HA 1GCTC 2IJD1 2QXHA 1C2DA 3V3MA 5JB8S 1I92A 3DD2H 1P05A 1EQ9A 1C5YB 2OBQA 1DFPA 1GMCG 1AE8H 1XUJA 4E7NA 3TSZA 1KY9A 3VG8A 3T29A 2ZDMA 3IITA 1AFEH 1EZQA 4B2BA 3MNXA 1O3JA 1NFYA 1XUHA 1J9CH 3SUGA 1MTNB 1MH0A 1HAGE 5L2YH 2Q9VA 4KTCA 4D8NA 1P9SA 5C20A 2QF3A 1XZ9A 1D3PB 2ZQ1A 1QJ1B 3D23A 1S85A 4JOPA 2L4TA 4CRDA 5FB8C 5T1VA 3SNAA 1HBTH 3ATKA 1O5AB 1UM1A 1O5FH 2EDVA 3TSVA 1QTFA 3RXOA 1Z87A 1RJXB 2OTVA 1YPHE 1K2I1 3BTHE 2C8YB 4REYA 3D49H 5AFYH 4MDSA 1GDUA 2DUCA 3UB0A 4YM9A 4AN7A 3F9HA 4I8GA 1EZXC 4DT4A 4FUFA 1NC6A 3NKKA 2V3MA 1T4UH 1LHFH 5DP6A 4AX9H 4MPVA 4A1XA 1FXYA 2H9TH 2W6ID 1WIFA 1F0UA 2BOKA 1V2UT 3AW0A 4DVAU 1Q2WA 4JOEA 6LPRA 2OGPA 3QJMA 3TGIE 3ZZAA 1BTPA 1O2OA 5FXLA 3DORA 1PPBH 3PWCA 3ZZDA 3B9FH 5DGJA 1ABIH 4YLQH 2J92A 1OP2A 1TPOA 3MHWU 1O2HA 1O5DH 1V3XA 1MKWK 3ZZ7A 3HVQC 5K0HA 1UO6A 2JH5D 3KGPA 3ID1A 1F5RA 2FN5A 1EAXA 5CHAB 3AAUA 1IU0A 3I29A 4O97A 4ABJA 3ZV9A 1C1WH 1KTTB 1AD8H 1O3OA 1LPZB 1OXGA 2GMTC 3D65E 1TWXB 2UUKB 1SGRE 4YTAA 1Z7KA 4YLUA 1Z71A 3RMOH 2H3LA 5EJZA 1F5LA 4CR5A 1ARCA 2WV9A 4U2WA 2EDPA 2BOHB 2VIDA 4GSOA 2YMSB 4K75A 1HXEH 1GJDB 1DSUA 4KFVA 3Q3KA 2NU2E 1F0RA 2J94A 3ZZBA 5HFDA 4FOUC 3LGTA 1HAVB 5DP4A 4ZMAH 1J15A 2QBWA 4BAMB 3WWBA 1VZQH 2PTCE 1NPMA 2E7KA 3RU4D 3Q3XA 3I78A 2A4OA 1C5OH 4RSPA 1OHHD 4Q2KA 1N8OB 3GY6A 4E7RG 4YXWD 1J17T 1ZYOA 4AMHA 1ZHPA 3A7YA 4CH2B 3NZIA 2KBSA 4JOGA 1DX5M 3B23B 1WJLA 3MTYA 2BHGA 1GBAA 4FUJA 1YCPM 1NF3C 5DSFA 2DMZA 2EQNA 1CHOG 3OAAD 1D9IA 1P2QA 3P8FA 3RXTA 1HYLA 1O3MA 1UVTH 2M5TA 4FETA 3MO6A 2QAAA 1WG6A 5L6NH 3TGKE 2W3IA 3RXSA 2OC7A 2A7JA 2QKVA 4K6YA 3FZDA 2ZIQH 3UR6A 3P95A 1QY6A 5EIYA 4DT7B 1O30A 3SU0A 4GVCA 3MH7A 1SQTA 1P11E 3STJA 1V2JT 2F9UA 2W7UA 1YCPK 1FN8A 1BA8B 4K1TA 1X7AC 3UNQA 2OC0A 2EAQA 5F3XA 2OINA 2GJGA 1ZSKA 2KOJA 1N6FA 1C5NH 1HAVA 1W10U 3SU3A 2ANYA 1C5LH 1FLEE 1YPEH 1RTFB 3PTNA 1UTQA 5FCKA 1O34A 3LH3A 1XMNB 2FODA 4B73A 1GDQA 2AWXA 2HVXA 3LOXA 2ZPRA 1P3CA 4UFFH 3HPKA 4RT1A 1C5WB 2YUYA 3PRDA 2B8OH 2ZU4A 4FGMA 5DP7A 1CQQA 4K60A 5T6FA 1OWKA 1PQ8A 3UNRA 4NIVA 4MLFB 3SYJA 2O2TA 3VQFA 1JXPA 2J98B 8KME2 1G9IE 1MCTA 4H6SB 2BQWB 1C2IA 3ZV8A 3CYYA 2B9LA 2O8WA 3MQKC 2KOHA 2RG3A 3E0PB 5HFBA 1ZPCA 4P02A 3BG8A 1Z1IA 1O2KA 2BYGA 2M0TA 5C5NA 2A0QB 1Y3WA 2FOMB 2OBOA 5FX6A 2ZDKA 1TYNA 3A82A 4D7GA 1YP9A 2BD2A 3FY5A 2QGRA 2IPHA 3RXHA 1BTYA 3EDXB 1RIWC 4FUGA 1W0YH 2PKSB 1L0ZA 1GMDG 3V0XA 5E0GA 2HGAA 3MU1A 1BHXB 5JYIA 5GXPA 3U69H 2GZ8A 2BDHA 2ALVA 1V2MT 4Y10E 2KJPA 1S6HA 2PP6A 4AYYB 1LVOA 4HTCH 2F91A 1H4WA 1HIAB 2EEHA 3UUZA 3GYMA 3ENSB 4AORA 3K6ZA 1LKBA 2XOKD 1MFGA 2J34A 4NXRA 3O8BA 2D2DA 1A7SA 1ACBE 1BTXA 4Q2PA 1AVXA 2Y82A 3SOEA 1GJ8B 1HJAC 3BTTE 2DE8A 2TGPZ 1HJ8A 1TOCB 2R2MB 2Q6FA 4Y8XA 4WYTA 1PJPA 1PYTD 3SW2B 8ESTE 1AI8H 4O03A 3B76A 2J98A 5EXLA 3MU0A 1BB0B 1WSSH 4BAQB 4JOFA 1CGJE 1CGHA 1GGDB 2Q6DA 4U30A 1Y7NA 3RDZA 3BF6H 5H4IB 1QJ6B 4UE7H 1ZHMA 1V2PT 1O5GH 1NT1A 3QDZB 1RGRA 2THFB 5A8ZA 1H8DH 2EGOA 4I8KA 5F8XA 4K76A 1EZSC 1O5BB 3KZEA 3HATH 1INCA 1OWDA 2BDIA 2XCNA 4WXIA 4YOGA 3ZYEA 4AFZA 1C4Y2 2K0QA 1TRYA 1O2XA 4IN2A 3GY8A 1VJ6A 3TGJE 1OWEA 3HK6B 1OWIA 4BAHB 2P8OC 2VWLA 2WV5A 4K8BA 5DP5A 2TBSA 1F92A 1TGSZ 3A88A 4XE4A 3E17A 1H8ED 2XTTB 1N6XA 2KCAA 4EDJA 3UR9A 1HIAA 1C2MA 3ITIA 1O2VA 5J4QA 2M0ZA 4F55A 2D26C 4I86A 2FTLE 1V6BA 2SNVA 2OD3B 2WV4A 2PDZA 3QDOA 4Q3HA 2CK3D 3RC5A 3ATLA 2QXGA 4Y6DA 1YLCA 4IC6A 2EEGA 3ZVBA 2OSGA 1QAVB 2EY4C 1GJ6A 2ZHDA 4MPUA 4XHVA 3A85A 1RTKA 4MTBA 2XYAA 3FANA 2R0LA 1YYY1 2BDBA 3RXFA 3M61U 4AZ2B 1A1RA 3ZZCA 2WZQA 1DOJA 3O8RA 1JIRA 1DS2E 1BBRH 2F9OA 4I8HA 1AIXH 3MNSA 3RXKA 2IWQA 1A0JA 2Z9IA 4JZ1A 1U39A 3LC5A 5AHGH 3EGGC 1E34B 2ZFPH 1COWD 3MFJA 1YWUA 8LPRA 1IHJA 4E34A 3RLEA 1ETTH 4KTUA 1MU6B 1MC7A 1QIXB 5EPYA 4MNYA 3TNSA 1HJ9A 1J8AA 4DOQA 3FP7E 2YUBA 1D3DB 5LPEA 1GHAF 3PROA 2EI7A 1BMLA 3AVZA 3KN2A 3EE7A 3DFLA 1C1QA 1JBUH 1WV7H 2EEKA 5F03A 1FX0B 4I8JA 1IQMA 1MKXK 3JZ2B 3SHUA 2ZFRH 1DITH 2Q6GA 3URDA 4Q6SA 4XD7D 1UCYE 5CE1A 1TMBH 4X8TH 2OQSA 2HALA 1UVPA 1TNGA 2C8XB 5HIYA 1UM7A 3TJUA 5HFCA 1DUAA 2WINI 1QL7A 1W13U 2UWPA 4Y11E 3EE0B 1QAVA 2H2CA 1NN6A 1OPHB 2XNDD 3ATMA 4Z6AH 2CF8H 1ESBA 4RT0A 3RXJA 1P9UA 1WBGB 4TY7A 5FPYA 1OZIA 1HXFH 1O2TA 1C1PA 1EASA 2FOBA 3NFLA 5HIZA 3ELAH 1J16A 2O8UA 1FJSA 1QNJA 2RDEA 2SGDE 2PW8H 1BTWA 1HPGA 2XXLA 3WWFA 1O3KA 1FV9A 1W0KD 1TA2A 3ATWA 3UTUH 2OC1A 4GHQA 5C5OA 3V13A 3S9BA 3O8DA 1KXEA 1VCPA 2KPKA 3ZVFA 2B5TB 3MO9A 4G69A 1EJNA 3FVFB 4I32A 2IWNA 4UFDH 1DY8A 4K3JA 3F9EA 1GG6B 3AASA 4TY6A 1MD7A 3RXEA 5GDSH 1O3LA 2G81E 3MO3A 1TGTA 5CDFE 4AGJA 2W5EA 3CBXA 1BHXF 8GCHF 2KQFA 3A80A 4CRBA 1MTVA 4ISNA 4UD9H 2QV1A 2GVFA 1P2JA 2FZZA 5KEDA 3F68H 3VXFH 1IAUA 4D9RA 5C0TA 4AG1A 2OCSA 1ZPZA 5HEDA 4P0CA 1JOUB 4TT3D 2HNTE 2PLXA 3RU4E 2ODYB 4K5ZA 4HOPB 1TNHA 1O3DA 2SGFE 1SQOA 2HE2A 3SGBE 4JZDH 4XBCA 1C5UA 1P02A 1DDJA 2V35A 5HYOA 2CSJA 1P1DA 2UUFB 1GJCB 2C90B 3VB6A 1W0JD 5C2ZA 6GCHG 1G30B 2VPHA 2SGQE 1FC7A 3TH2H 2KA9A 2J5UA 3DSPA 2JOAA 2PR3A 3PMAB 5JBTA 3SBKA 3A7XA 3MH6A 1GVKB 1O3GA 4R0IA 3PO1C 5EXMA 2BQ7B 5C17A 5FX5A 1LHDH 4CHAB 2ANKH 1TQ7B 2AH4X 4K1EA 1EXFA 2AGEX 2BX4A 3H09A 3DA9B 3QTVH 1TABE 5JBCS 4GCHF 4R2ZA 1RGQA 1G32B 3ZRTA 3BG4B 2D90A 5EPNA 1TPSA 1HAYB 2DB5A 2L6OA 2FI5E 5DPAA 1QBOA 3WY8A 2XWBI 2F3CE 2KL1A 2R2WU 3KNXA 2KM0A 1EX3A 3WW7A 2J2UA 3VXEH 1C5TA 2W6JD 1SFQB 4XFQA 3LGYA 4XSKU 1WQSA 2BLOA 1GBFA 2P3TB 3SUFA 1C2FA 3PM3A 3DUXH 3HGPA 3I77A 2LP6A 1V1TA 2SNWA 3S7HB 2FNEA 2XC5A 5SGAE 5I7ZA 4UU6A 3M5NA 2Q1JA 1W9OA 1YM0A 4RN6A 4YT7H 3QE1A 2GCTB 1YLNA 1TX8A 2P16A 3G01A 3NCLA 4GAWA 1BMNH 2GEFA 1F7ZA 4Y8ZA 1AZ8A 5JXBA 1WTHD 5E2OA 3BTGE 3DCLA 1W14U 4BOHA 1P2KA 1P03A 3MMGA 3LGUA 2BXUH 5HKKD 4IS5A 2QXJA 1E1QD 3M7TA 1C5SA 2VU8E 1E79D 2FYRA 2ZFSA 3E8LA 5FPTA 2PSXA 4IMQA 1RGWA 2UZCA 1VAEA 1ELDE 2OQUA 2OZFA 1SBWA 2FTMA 1QB9A 2ZNKH 2ZF0H 3HK3B 3DJ1A 3LJOA 1O2MA 1BOQA 1SGIB 2KX4A 2A32A 1DSTA 1UW7A 2ASUB 4JZIA 4K8YA 5A2MH 2GCHF 2ZHQH 1MQ5A 2EI6A 1UVUH 2V0BA 4IMZA 4X6NA 1CU1A 1ZTJA 2FOGA 2OP9A 1LDTT 3RLWH 5FBEA 2J95A 4NA7A 4GUXA 1FY4A 4F48B 1DANH 4FUBA 1U6QA 2VWNA 4TSFD 1KWAA 1ABJH 1TBZH 2KCOA 1TX7A 4Q7XA 2ZPQA 3PRBA 4TWYA 2WUBA 3RL8A 4BAOB 3HKIB 2R3YA 1K0HA 1UTNA 2EHRA 2QKTA 1EAUA 1WCZA 1YF4A 4WF8A 2ZHWH 2VIQA 1GCDA 3WKMA 4NXPA 3LT3A 4YO9A 5JBBS 2AHME 2FCFA 2I1NA 2WHXA 5A8XA 1GBBA 2A4QA 3T26A 2DLUA 1DLKB 1SPJA 3RLYH 1D6WA 1V2ST 2Z3CA 2GZVA 1Y3YA 1E35B 1HRTH 1FAXA 1L4ZA 3NCVA 2VNTA 1B7XB 1SI5H 2PV9B 2P95A 1LHEH 2JH0D 1RFNA 1ZGVA 5DKMA 4ZH8A 3OX7U 3U28C 3UWIA 3STIA 5A2PA 4Y0YE 1CA8B 1MTUA 2B7DH 4K72A 3V12A 1GHAG 1LQEA 1PDRA 4NMVA 1GI9B 3GABA 2J38A 3MH4A 3RXDA 3ZZ8A 5DP8A 1P3EA 2VGCC 1UHPA 3SN8A 5ESBA 4NWLA 2ZPSA 3BTDE 1XUKA 5FL7D 2M0VA 3SFJA 2QY0B 7KMEH 3QGNB 3FZZA 1TX6A 5IYTA 5I46H 1NU9A 1GBCA 1LHCH 1S0QA 5IK2D 5LH8A 4XBBA 4ASHA 2KZ4A 2A1DB 1O2ZA 3M37A 1Q3OA 4THNH 3SNCA 1DWCH 1ZMJA 4TWWA 3U8TH 3AXAA 1HUTH 2GX4A 1SGQE 3TPIZ 3RM0H 3RXRA 1O39A 1D5GA 5BPEA 1P06A 1AUJA 2ZGXH 9ESTA 1YPJH 3QZQA 1L1JA 1SFIA 1XX9A 2FYQA 1WFVA 3QO6A 4ZHMU 2HWLB 1UVOA 1NFXA 1CVWH 1L6OA 1MTNC 5ESTE 2XCFA 4Q2NA 5ETXA 2Z9GA 4CR9A 1OYTH 3UFAA 4HGCA 4CRGA 3SUZA 3E90B 4X2XA 1G3CA 4K2YA 3H7TA 2FM2A 5PTPA 3A89A 2G00A 1ANDA 1DWBH 1N7EA 1O3FA 1GBMA 1K28D 4A7IB 3P8GA 1MAYA 2F43B 5LPFA 1MTSA 2DLSA 3KIDU 4Y0ZE 2OK5A 4NMPA 1KXFA 2R9PA 1O2IA 4Y76A 1SGEE 2CJIA 3GY3A 4E35A 7GCHG 3GDSA 3GDVA 2AMDA 3RUOA 1L2EA 2JIZD 4JOJA 2A5KA 1QHRB 1THPB 1ZHRA 1GPZA 3RMMH 3ZZ5A 5C94A 1TP3A 2GMTB 1HCGA 1OKXA 4O06A 1HAIH 1F2SE 2UWLA 8GCHG 5E22A 3R69A 2HLDD 3BEIB 4GVUA 3CP7A 1XKAC 2QIQA 2JJ1D 1CBWC 2BLVA 2JSNA 1Y5UT 1V2NT 3NUMA 1O2GH 2QN5T 4NSYA 5F67A 2BZAA 1DWDH 1Y5BT 1QRZA 3F9GA 3FP6E 4AB8A 1QBNA 3OSYA 4KKDA 1UEZA 2O8TA 3A7TA 1OP8A 3LU9B 2ZWLH 1CT0E 4IW4E 1GBTA 4JL7A 1ZTKA 4RKOB 4UDWH 2M0UA 1QB1A 3SZNA 2AIPA 2AS9A 5C1YA 4X6OA 2D8WA 2V3OH 4NA9H 2YMSC 3WKLA 5EZ0A 5DP3A 4UFEH 4AG2A 2ZDLA 2PGBB 1SHHB 3LNYA 2YTWA 1C9TA 1TQ0B 2ZGBH 2Q3GA 3SHAH 1WI4A 4JYTA 1BRUP 4TPIZ 2AERH 5AF9H 3RMNH 1TBRH 3PDZA 3T62A 2ZDAH 2P59A 2WPJS 1AZZA 1WAYB 5DJ7A 3VEQB 1FY5A 1N8OC 4WVPE 3VB3A 5A09A 1ID5H 3KQDA 4JOKA 3O5NA 1EOLA 1PPZA 3FO8D 5HEYA 2FLRH 5F8TA 1SGYE 4X1SU 1NRNH 1P12E 2ZC9H 1NO9H 2JJ2D 1O3AA 1TALA 3SI3H 1GMHF 1ZMLA 2JREA 1U3BA 3BN9A 4UFGH 4WWYA 4ABBA 2PKTA 2KRGA 2F9VA 4NG9H 1ELEE 2FESH 3ATIA 5GCHF 3Q00A 3F1SB 1TFXA 1UF1A 5E11A 3JZ1B 2G4UA 4X1PU 2RA3A 3TJNA 1YPLH 1BFEA 1E37B 2BX3A 1P57B 1EATA 3A8AA 4Q7YA 1GI7B 1A4WH 3M5MA 4SGAE 2A4RA 5F8ZA 1P2OA 2BLWA 3SJ8A 1S0RA 4ACBA 1H8IH 4J1YA 3A83A 1MKWH 1K22H 2G5MB 1UCYK 4WMFA 2LC7A 2RCEA 2Z3EA 5CHBA 1ZRKA 1VITF 1V2WT 4OS4A 4WXVA 3K1RA 5E6PB 4FUDA 1AKSA 3BTEE 3LIWA 2JXOA 2AGGX 3SJ9A 2ZDVH 2A31A 2ULLA 1KYNA 3S9AA 1QL8A 2H9HA 4O3TA 1PQ5A 1KEFA 3U9AH 3KF2A 4E05H 5F6MA 4OS2A 4YYXA 2JETB 2OS6A 5FBIA 4LMMA 1SGFA 4I8LA 2GCHG 1ARBA 1TNIA 2WPIS 4P2AB 2DJTA 5HEBA 4NA8A 4X8SH 1Y3XA 2QE7D 1AFQB 2FX4A 1RIWB 3I1EA 2PKUA 2VSVA 5G4BA 5A0AE 1GI0A 3OU0A 4JYVH 2BD4A 1LCYA 4KELA 2AWUA 1SC8U 1RXPA 3GCHB 4ZROA 4K1SA 2AWWA 1F0TA 3PLBA 1AY6H 1MCVA 1UTOA 4NFFA 3RXQA 2IJOB 2PKSC 5EQSA 2EGNA 1DLEA 2STBE 3RP2A 1K1JA 1X5RA 1GI1A 1ELBA 1W7GH 1C2KA 3OEHD 2XBYA 1ELFA 5GPIB 1N6EA 3HGNA 1O3NA 4ZHAA 1EFRD 1FPCH 1LVBA 1TP5A 4K78A 1MTWA 1UFXA 1WYKA 2Z6BD 4ACAA 4B6FA 5L2ZH 4VGCC 4MNXA 2BY7X
chains in the Genus database with same CATH topology
2W4FA 3EGHC 2XBVA 2ZTZA 1IQFA 2TIOA 1GI3A 3PV2A 1RRKA 2YT8A 4JYUH 1VJAU 2Z94A 3E1XB 2GT8A 3SJOA 5EU8A 5JDUB 4RKJB 1NFWA 3OTPA 2ILNA 1YCPH 3SUEA 3M5OA 2DKRA 3SNEA 1W12U 1VJ9U 2RCZA 3I18A 1O32A 1FAKH 4NZQA 4E06H 2X7ZA 1AQ7A 2Y80A 1PPGE 4YESB 1MAXA 4FXGH 1ESAA 2JKHA 4ZHLU 2VWRA 1GGDC 1FY8E 4JK5A 1IQGA 2FO9A 1UVSH 3D62A 3GJ9A 2P3WA 2BY6X 1NRRH 3CENA 1SSXA 2VSPA 1FQ3A 3OY5U 1A3BH 2ZP0H 4ISHH 1YGCH 2WPMS 1AN1E 1BE9A 1AU8A 4IBLH 4RI0A 3SQEE 4NIYA 4YDPA 2CSSA 3GY2A 4WYUA 2KYLA 2QKUA 4LZ1H 2KJDA 3MNCA 1UTLM 3VGCB 1QRXA 1QBVH 2GDDA 3I4WA 2GKVE 5EQRA 1FPHH 5FCRA 1CT2E 2ZZUH 1KLIH 1SVPA 1Z8IB 1BCUH 3SU5A 1O3CA 2BMGB 1BTUA 1QQ4A 4ZKNU 1J14A 2A7CA 1KDQA 4F49A 1C5VA 3HPTB 4L8NA 1SG8B 2HPPH 1N6YA 3TSWA 4X2WA 1K1LA 2TGAA 3SU2A 3IG6B 5D13A 1B0FA 1Q3XA 3LONA 3SU1A 4A6LA 1GI5A 3M3VA 4A92A 2GZ9A 1L4DA 3SUDA 1ZPBA 5GWZA 1T31A 2FLBH 2DM8A 3TVJB 4JZFH 3FP8E 3GYLB 1GI8B 1X5NA 3DIWA 3F9FA 1TBQH 2OMJA 1AB9C 5TCAA 1CT4E 1O31A 3ZZ6A 2G51A 3EA7A 1XVMA 3RXUA 3MNBA 4U01A 4AFSA 1WOFA 1P2IA 1LKAA 1THSH 5T6DA 1C5PA 1YLDA 1DXPA 1T2MA 3K82A 2G5NA 2K20A 1D3TB 1U37A 1Z86A 4CBNA 1VA8A 5G1DA 2FI4E 1BDAA 3MWIU 3S9CA 1M5ZA 4X2VA 5L30H 2V1WA 4F4OC 4CRCA 5EGMA 2CS5A 1AHTH 3K50A 3MU5A 1O35A 1GDNA 1GI2A 4H4FA 2ZPMA 3BV9B 4MNVA 5E0HA 1L1GA 4AOQA 1HAZB 1P1EA 1QLCA 1V62A 3ODDA 2HOBA 3OY6U 3QZRA 3GCOA 2XC4A 1IQKA 1OWJA 4OEOA 2XNIA 3PV5A 4Z8JA 5E0JA 1DT2A 1HAHH 2ZU5A 2M10A 3CS0A 3E91A 1O2UA 5E8EH 2XBWA 2NU4E 1IQJA 1CHGA 1TMTH 2W7RA 2SFAA 3TITA 1VCWA 2XRCA 1TPPA 5G1EA 5A0CA 2AYWA 3VQGA 5GLJA 4X6PA 4NSVA 3TJVA 5HDYA 4GPGA 5GCHG 3LNXA 1FC9A 2WPHS 1IHTH 1NZQH 5HM9A 4I7YH 1SLWB 1DY9A 3SJKA 3PLPA 1BBRE 4OAJA 4JMYA 1GJAB 1XUIA 3BTKE 4NNLA 2EEJA 4X1RU 1ELTA 3KQCA 1QGFA 1GBLA 2RA0A 1S81A 3TIUA 1E36B 6CHAC 4LOYH 1AVWA 2AMPA 1T8MA 1ZRBA 2I0IA 1Y3VA 1UTPA 1TAWA 3QIKA 3OYPA 1TOMH 1GG6C 3SHWA 4SGBE 3BIUH 1ANBA 1H9LB 2I4SA 1AGJA 3O8CA 1VITG 1UMAH 2UUYA 2GZ7A 1GHXH 1LMWB 2P93A 2A2QH 3M35A 2FOAA 3NWUA 1ETRH 3KQEA 3EQ0H 1SHYA 2ZGHA 1GI6A 2FIRH 2FI3E 2FOFA 2PUXB 4AB9A 1X9ZA 1ZSJA 1GBDA 1WI2A 3KL6A 3ID2A 4B2AA 2Y7XA 4BTUB 4JOHA 2CXVA 2AFQB