3OU0A

Re-refined 3cs0
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
392
Chain Sequence
b'QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic serine endoprotease DegP
molecule tags Hydrolase
source organism Escherichia coli
publication title Covalent Linkage of Distinct Substrate Degrons Controls Assembly and Disassembly of DegP Proteolytic Cages.
pubmed doi rcsb
total genus 82
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3ou0A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3ou0A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ou0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ou0A01
1IAUA 2KBSA 2M0TA 1M9UA 1Y3WA 4AGJA 1J16A 3TMHA 2QXIA 3BN9A 7GCHF 3GYMA 1Q31A 2EI8A 1AE8H 4VGCB 4FU8A 1N6EA 2OC8A 4GHQA 1HXEH 5EW2H 3URDA 1Z6JH 2DB5A 5HM9A 2NU0E 1XUGA 3F9EA 1TGCA 1XMNB 1FY1A 4CHAC 1SG8B 2NWNA 2V90A 3KHFA 4OAJA 1V6BA 2A5IA 3BTGE 3RU4T 2SGFE 3TSWA 1ANCA 2GCHF 1OPHB 5HYOA 1TOMH 1ZSLA 1EOJA 3DIWA 3NK8A 2JH0D 5HM2A 1D6WA 2FMJA 2JOAA 1PFXC 1GHWH 4REYA 1W7GH 3A81A 5LH8A 8LPRA 4P2AB 1H8DH 2OCSA 1TONA 1VITF 2OC1A 5K0HA 1ELGA 5F8ZA 4YLUA 1ORFA 3P8NA 1Q3PA 1NT1A 1XKAC 1EP6A 3SUEA 4AX9H 3M7QA 3E8LA 4ZXYH 1MC7A 2XBVA 4B76A 1TBQH 2FOGA 3PO1C 1BRCE 5FPSA 2A7JA 1RIWC 1GHBG 1T7CA 4ZKOU 1NO9H 5C67A 3RMMH 1QB9A 4FUDA 2BDAA 1K28D 1E38B 1C9PA 3T26A 2Y82A 6GCHG 3EGKH 4BNRA 2PWXA 1K2I1 5HEDA 6LPRA 3KGPA 3FZZA 1PPEE 2WPLS 3MNXA 3LGWA 2PKAA 2FI5E 4K76A 4IBLH 4FUHA 2TGPZ 3A7YA 2QXHA 4H42U 5EQSA 1O2VA 4ZHLU 2AFQB 3FVFB 4DIHH 2W4FA 1L1NA 3P8GA 2LC7A 1HAYB 2DLUA 2IN2A 2ZCHP 1NY22 2CHAB 1J9CH 1Y3VA 4BTTB 5C5OA 3RLWH 2FNEA 4RI0A 3TK9A 1C5XB 3Q3XA 2EHRA 3FP8E 4MNVA 3ZVEA 2TGAA 1ZUBA 3DORA 2VRFA 4F49A 2YNBA 1NC6A 1CSOE 4I8GA 2LC6A 1OP2A 4X0WU 3PV2A 1GVLA 1F5KU 1YM0A 3W95A 1EPTB 1IHJA 4I8HA 3ZZBA 1YPJH 2FOBA 5AFYH 1MD7A 4Y6DA 3A80A 2FOEA 4H6SB 4K78A 1MTUA 4FUJA 2QXGA 4OS4A 3H5CB 4TWWA 2JIKA 3TGJE 2R0KA 3RXBA 2IOTA 3SHUA 1UEPA 4WXVA 1O5AB 1UTMA 4IW4E 1TNIA 2A32A 3T62A 1WI4A 3B9FH 1Z71A 5DP8A 3FY5A 3P8OA 3PB1E 1GQ4A 2PNTA 1GMCG 1SI5H 1CQQA 2BOKA 3K2UA 2PGBB 1O34A 1A5HA 2CN0H 4K8YA 2ZFRH 3MI4A 4JYVH 4CR5A 2AWWA 4KKDA 2ILNA 2ZZUH 1EKBB 1EAIA 2G2LA 3SU2A 4UONA 3R68A 1AO5A 4UDWH 5T6FA 3ZRTA 2ZGBH 1G2LA 2TGDA 3KQCA 3LGVA 4H4FA 2ZPQA 2ZU2A 2CJIA 4Y79A 5FBIA 2ODPA 2WUCA 3MO6A 5L2YH 2DAZA 3RXUA 2BDHA 3RXOA 1N6FA 1TA2A 1AFQC 2CGAA 1SLWB 2TIOA 4GVUA 2B5TB 2Y5GA 3BTME 1O3DA 3SHWA 2UUJB 2EV8A 1EOLA 1AFQB 2ANMH 5F3XA 1GBMA 1GBFA 1O3LA 2QXJA 1Y5AT 3UFAA 1GJ5H 5EPNA 1IU0A 1OOKB 2VVVA 2RDLA 4FUBA 2VWOA 4Y7BA 1O2JA 4OS7A 1YLCA 2C8ZB 2GT8A 1RY4A 2THFB 5FBEA 4HOPA 3QN7A 1Y5BT 4NMSA 1A0JA 2OC0A 2ZDNA 8KME2 1ELVA 4MPXA 1DE7H 1QURH 3QUMP 1O2LA 1NRQH 3AW0A 2YT7A 1K1IA 1X5QA 4KFVA 1YPMH 3QE1A 2FX4A 1TWXB 1Z1IA 1UTLM 1EAXA 3Q76A 2LPRA 2BY9X 2H2BA 2PLXA 4JMYA 2L97A 3A7TA 3PS4A 1GM1A 5JB9S 2WPMS 2A4OA 3UIRA 1VJAU 4YTAA 1YPHC 2ZHQH 2J95A 2ZDVH 3UQVA 1GVZA 1LMWB 2KOHA 2H6MA 5JBAS 1FXYA 5E2PA 2SNVA 1SGNE 5HFCA 2ESTE 1QLCA 3P92A 4NIYA 1R6JA 2F9OA 3DJ1A 4TY6A 3R0FA 1SQOA 1P04A 3ODFA 2VIOA 4AGKA 2A2XH 3PMBB 2EXGA 3MNSA 2GMTC 2PW8H 1P01A 5C2ZA 1OWDA 1ZRKA 2BDYA 3F9GA 4D8NA 3PV5A 5SGAE 1ABJH 4I32A 2RA3A 4Q80A 2VIWA 1VCPA 3SI3H 1ARBA 1UVTH 1W12U 4B71A 1ZRBA 4ISNA 4OGXA 6CHAC 1DY8A 3GY8A 3GGEA 1DWBH 2BLQA 3CS0A 1ELEE 1T32A 2FTLE 4BANB 1V2MT 2VIQA 2VH6A 4WMFA 1O2HA 5FPYA 2UWLA 1WIFA 2ZNKH 3SI4H 1KEFA 2HE4A 3GDVA 3BEUA 1BMAA 1ZHMA 1P2NA 3TNSA 3MU8A 4XFQA 2RCZA 1GBLA 2P93A 4GLYA 4LZ4B 2AS9A 1H8IH 5EGMA 4YOJA 6GCHF 2JREA 2WUBA 1EUFA 5HXFA 1BTPA 1C1NA 1N7FA 2V6NA 2ZHEH 1T31A 2YT8A 3WKLA 1JBUH 1FPCH 2ZQ1A 3SGQE 1U38A 4DG4A 3PYHA 2CS5A 1M5ZA 2YUYA 2WINI 3SO3A 2AMDA 4GPGA 1GI0A 3DD2H 4YT7H 3S9AA 3ZZ5A 3SQEE 1SOZA 1GDQA 1W13U 2VGCB 1QAVB 2W3KA 1DLEA 4B2CA 4Q2NA 1A1RA 1V2PT 4RSPA 4BXWA 4E7NA 1AB9B 2EEHA 5D13A 1C2IA 3PO1B 3KCGH 2I4SA 1OP8A 2FI3E 2W26A 4GCHG 2UZCA 4WH6A 1A3EH 1HAZB 2G8TA 4Q7ZA 5IYTA 4AFSA 4WY3A 1ELDE 1O30A 2WV4A 2NU3E 1YC0A 2VSPA 1DXWA 1DSTA 3SNDA 3PROA 2Y5FA 1AUTC 5JB8S 3BTQE 1CBWB 1SGDE 4JOEA 1BB0B 2QF3A 4B2BA 7GCHG 1O5BB 3UY9A 2QV1A 1AUJA 1HIAB 1QL7A 1O2KA 1TQ7B 1FAXA 4IMZA 1O2GH 9ESTA 5EW1H 2KAIA 1UEZA 1AY6H 2ANWA 2H3LA 2KAIB 3FP7E 3PDVA 1GMDG 4GUXA 5E21A 2WPKS 2FOHA 2BMGB 2FYRA 2JH6D 3P95A 1CHOG 3ZZDA 2BQ7B 4GVDA 2WPHS 4A1XA 3BSQA 1BFEA 2FDAA 3SV8A 1GMCF 1K1JA 4INLA 3B76A 5CHAB 3M36A 2ZECA 4U32A 1NTPA 3NPSA 4B75A 3ESTA 5GJ4B 1RS0A 3M3VA 1LHGH 4GVCA 4OS5A 1J15A 3Q3YA 1P8VC 2RCEA 2D90A 5F8XA 2JKHA 4CRBA 5C5NA 2UUKB 1FY4A 1XVOA 1ESBA 2ZDAH 2EDPA 4X8UH 4Y76A 3E0PB 4BTUB 2EEGA 4ABHA 4K5ZA 2JWEA 2C90B 2HGTH 2ZCLP 3KZEA 1KXFA 3BG8A 1SLXB 2GVFA 2BM2A 2SGDE 4UE7H 4DURA 2KOJA 1TGNA 1RXPA 4FXGH 1QRWA 2H5CA 3B8JA 2EEIA 4JOPA 1MKWK 1CE5A 1DLKB 2ZPSA 3TJNA 4CH8B 2OPGA 2F3CE 4NA7A 4D9QA 3KQEA 3S9BA 4FVBA 1ZR0A 2O8UA 3MOCA 1O31A 3C27B 4U30A 1CVWH 3GCNA 5EOKA 1TGBA 4NNLA 1C5OH 1U3BA 2QCYA 4Q3HA 3ZVAA 4AFZA 2WYGA 3SW2B 1G3DA 1ZSJA 2OUAA 3VQGA 5AFZH 1VAEA 1CGJE 1Z8IB 2BTCE 1UVUH 5AHGH 3SNAA 1A3BH 2IWPA 1WTHD 4IC5A 2EDZA 3KQDA 3GISB 1HBTH 1THPB 3ID4A 1O32A 1KLTA 4ZXXH 2B7DH 2GTBA 3PMAB 2A5KA 2PUXB 4AYVB 1QA0A 4I31A 4ZROA 1EAUA 4AYYB 3O46A 3IWMA 4M7GA 3K9XB 1N6YA 1WF8A 1HJ8A 4O3TA 1I16A 1AFEH 2Z3CA 1CT2E 1XUKA 1LQDB 4KTSA 1MFGA 3CH8A 2BVXH 4ZKSU 2ZPRA 5DO4H 2OLGA 2PSXA 1WOFA 1U6QA 2G5MB 2GX4A 3VGCB 2QIQA 1S0QA 4X1RU 2GZ9A 1LDTT 1VR1H 1QQ4A 1EB2A 1TNLA 2GD4B 4YDPA 3GY6A 4X1PU 4AG1A 5A8ZA 2ZU4A 2A4QA 2IWNA 3R3GB 4Y7AA 1UO6A 2OP9A 2KA9A 1N7EA 4U2WA 1OZIA 3SUGA 3ZV9A 2PKAB 1W7XH 1UTOA 1LHEH 4MPVA 1C5TA 1RTKA 4NWKA 1O3OA 1C5YB 2OBOA 2ZDMA 2VB0A 2ZA5A 1C2DA 4A1TA 1GBDA 1TA6A 5HF4A 1SGYE 1MTNC 1GHZA 2OSGA 1WF7A 2EGNA 1OKXA 1OWEA 1P2JA 4WMDA 2BVSH 3RM0H 3RXPA 1OP0A 1K1MA 2A31A 1L2EA 2ALVA 2AGGX 2C4FH 1LVBA 2GDEH 4Z0KA 3KNXA 3EA8A 2YUBA 1GCTB 3TNTA 1EATA 4AB9A 3LH1A 1VITH 5HETA 4JYUH 1G9IE 1ANDA 2P8OB 4CRCA 2FI4E 1P2KA 1GBCA 1TQ3A 1H9IE 3RUOA 3BTDE 2ZKSA 1X5RA 4TPYA 2Z9GA 3UR9A 1NTEA 5C1YA 1H4WA 3A86A 2PZDA 1WAYB 2CV3A 5EQQA 3C1KA 1MCTA 1LHCH 2B9LA 2VWLA 1PJPA 2FS9A 1DWCH 1OWHA 1TBRH 4R0IA 1L6OA 5GCHG 1O5GH 1OBZA 1IQLA 1GI3A 1UFXA 1G3CA 1RD3B 1GHYH 2M3MA 3QJNA 1QRXA 1KIGH 1D3QB 1V1TA 1A7SA 1AE5A 1EZXC 1O3NA 2OQUA 1CGIE 3K82A 2UWOA 4TY7A 1INCA 4ZUHA 3O5NA 1O3HA 1BTWA 4ABGA 2XBXA 4ZHAA 3ZYDA 4ESTE 3CBXA 1C5ZB 4X2XA 2FM2A 3RLYH 2GCTB 1P11E 2C8YB 1ZPBA 4H11A 1C2HA 5EQRA 1FY8E 1FAKH 2VVCA 2V3HH 1KTSB 2OS6A 1U39A 1LKBA 1GMHG 2HLCA 1NN6A 1P2IA 1TNGA 1C1PA 2HWLB 1DFPA 4THNH 3JXTA 1YKTA 1BTUA 5DP5A 2D8IA 3A7VA 1TPPA 1W10U 2KJPA 1ELCA 4NGAH 3M7UA 1TALA 2B0FA 2BYGA 1V5QA 2FOCA 4NA9H 4B74A 1HPGA 5C1XA 1KXBA 3JZ1B 5GLJA 1WG6A 1V2ST 1L4DA 1C5RA 4KP0A 1DXPA 1L1JA 4Y10E 1GBEA 1ZGVA 2ZGHA 2VPHA 1SGRE 1SL3A 4IS5A 3GOVB 1S82A 5I7ZA 2FWWA 3DJAA 1TX7A 3TGKE 3R0HA 3D62A 2JXOA 1QGFA 1KXAA 3AASA 3PLPA 4IMQA 2QGRA 3SN8A 4FU9A 5EXMA 1UVOA 1O2MA 3GY3A 1ETRH 4JYTA 1LKAA 5HF1A 1K21H 1YPEH 4OS6A 2HVXA 2XBYA 2YOLA 1BMNH 3RC5A 3E3TA 3S7KB 3WKMA 1O3IA 2D8WA 1QIXB 2P3FH 3E91A 2XC5A 5K7RA 2H2CA 2XNIA 1MTSA 2Q6GA 4ZAEA 2M0VA 1YPLH 5DG6A 3RXCA 1BBRH 3SGAE 1BTXA 1XUHA 2ZGXH 3L3TA 5CHAC 1O38A 3RM2H 4A92A 3EA9A 3A8CA 1YCPM 5ESBA 5HEBA 3D23A 1YPGH 4JZDH 5DP9A 1WU1A 1KDQA 1KLJH 5G1EA 3OTJE 1D3TB 1S81A 1W2KH 2DE8A 2GDDA 5EPYA 5C1UA 4I8LA 1L1GA 5ESTE 4OGYA 2BLOA 1O33A 3MO3A 2FOAA 4MNWA 1UJUA 1OBXA 1DM4B 1QAVA 4O97A 2FXRA 4AFUA 3LJOA 2J9NA 2HOBA 3OYPA 1XUIA 3SNBA 1AVGH 3STJA 2ZHDA 2CSJA 2D2DA 1NZQH 1MTNB 4YOIA 1V2QT 3A89A 1HJAC 3A8DA 3KL6A 4BAKB 2PKSB 1CT4E 2O8LA 1QBVH 1C5PA 1UK2A 3UPEA 1QJ6B 2SGQE 3URCA 2ZC9H 1Z8JB 1NESE 3U8RH 4X1SU 3M5NA 1EAWA 2AINA 5PTPA 2ODQA 1GI5A 2BHGA 2M5TA 4NZLA 4DW2U 2HGAA 1C2EA 1F0SA 4DOQA 3DT0H 5DKMA 4Q2KA 4CRDA 4JOGA 1GJ6A 1P09A 4ISIH 1QY6A 1V3XA 4CR9A 1BTYA 5JDUB 2A0QB 1MTWA 1BIOA 1F0TA 1AWFH 1O37A 1OYQA 1TYNA 3OY5U 3QGNB 4Y0ZE 1H9LB 1B8QA 4DCDA 4JL7A 4HZHA 1LVOA 3SHAH 1P12E 1TFXA 2FCFA 2R3YA 2ZO3H 2BD4A 2QKTA 3MWIU 1SGCA 1YCPK 5T6GA 4NNMA 3MH4A 1N1LA 2PFEA 2Q1JA 4JOFA 1J8AA 1O2ZA 3LOXA 3PTNA 1O3MA 1B0EA 1BHXF 2FOFA 3ZYEA 4LK4A 2BQ6B 3QIKA 2AMPA 1NRPH 2EJYA 5L30H 2Z3DA 2Z9IA 1RGRA 4AB8A 2NU1E 1GJBB 2FLRH 1GBKA 1ELFA 3SU4A 5F67A 3DJ3A 1ELAA 1H1BA 3ZZAA 4UFDH 1ESTA 1W0ZU 4IN2A 3GCOA 5FXLA 5C20A 1A0HB 2F9VA 2Y7ZA 4MQAA 3KF2A 2O2TA 1O5CB 2PUQH 1VCQA 2ZFSA 3IG6B 4F4OC 2ZG0H 2X7ZA 3BEFB 1TIOA 2H9EH 1WQSA 2PSYA 1EJMA 1VJ6A 1NRSH 1TPOA 1GI7B 4NIVA 1SPJA 1TP3A 4MPUA 1W9EA 1NS3A 2AIQA 1WSSH 3FAOA 2PTNA 3F68H 2XC0A 3P8FA 1NF3C 3E90B 2A7CA 4WF8A 3SU3A 4D7FA 5EYZA 5JBTA 1ZSKA 4NMPA 1MQ6A 1JXPA 3SUZA 1O2UA 1RGQA 2VH0A 1ZYOA 2V35A 4KTCA 1KDQB 2WPIS 1PPFE 2PHBA 1EJAA 1BTZA 4BXSA 1ZGIA 2FOMB 2QC2A 3E0NB 3QTVH 1BZXE 4FVDA 2AH4X 3A7ZA 4BAHB 1LO6A 2I6SA 3RXRA 3U1JB 2EC9H 1FC9A 2C8WB 1A0LA 2FO9A 1GBJA 4K1SA 1NFXA 2ZDLA 1GMDF 1ZJKA 2ANKH 2ANYA 2ZFTA 1BJVA 2DMZA 3I78A 4PROA 1TRYA 2A2QH 5TJXA 3RC6A 1G9OA 1EPTA 3RU4D 2L4SA 4JOJA 3T27A 1SB1H 2G5NA 2ZP0H 5ETXA 3AXAA 1P9UA 1C5WB 5LPEA 1TLDA 1N6DA 3V12A 5AF9H 2VIDA 1GL0E 1T8OA 1IHTH 1QJ7B 2AGEX 5DP6A 3AW1A 1WHAA 3RL7A 1FZZA 1QBNA 4XBCA 1NFYA 3BTWE 1V2OT 5T6DA 4ASHA 1JIRA 1SR5C 3SORA 3LIWA 3UNSA 3UUZA 1I92A 1BMMH 3I18A 3EAJA 1LVYA 5HDYA 3AVZA 3KIDU 4MNXA 4X1QU 1ESAA 1Z87A 2F9UA 4JK5A 1FLEE 4LXBH 2BY8X 1KLIH 5C3NA 2JILA 2MHOA 5HFBA 1E0FD 2ZWLH 2R3UA 1W14U 5DJ7A 4YYXA 1O36A 4NMTA 1W9QA 1TNJA 1HAGE 2OD3B 3V3MA 2XC4A 3NUMA 1C2LA 4K69A 4DY7B 2LOBA 5T3HA 5L2ZH 2XCNA 1QNJA 3MYWA 4I8JA 5BRRE 2ZEBA 3HPTB 3EYDA 1Y3XA 1V5LA 1Z8GA 1UCYE 4KGAA 1GL1A 3RXHA 1O5DH 3A84A 1AQ7A 1UJ1A 6ESTA 4O03A 3T28A 5GWZA 3LNYA 1OX1A 1YLDA 2FN5A 1SGQE 2ZQ2A 1GVKB 3SU6A 4Q2PA 1AVWA 3A87A 1RFNA 1OS8A 2EGOA 4JOKA 1O2SA 5B6OA 2BDCA 3DUXH 1LHDH 1BOQA 1WFVA 1FIZA 2F5YA 1ZOMA 4YESB 3P6ZB 5DP4A 3VQFA 1TNHA 1P3CA 3LC5A 4JCNA 4DGJA 1Y59T 1SHYA 2ZPMA 1Z6EA 4E34A 4JZIA 1Y8TA 1WYKA 1HAVB 2BD2A 2GP9B 3P70B 3GCTG 1C2MA 1QL8A 2AEIH 2HNTC 4X2VA 2H2ZA 2GMTB 1P05A 2ZU1A 2JETB 3KEEA 4XE4A 4BAOB 2WYJA 1FONA 3MNBA 1GQ5A 1UEQA 1TX6A 1EB1H 1EASA 2ZU3A 2EAQA 1BE9A 1BHXB 4X6PA 2W7RA 4FGMA 1EJNA 3A7XA 1ZOKA 1HXFH 1F2SE 2P94A 1O35A 2ZTZA 2DE9A 1AHTH 1TPAE 2XXLA 1G36A 1Q3XA 2Y81A 1K1NA 2VNTA 1C2JA 5B6LA 2ZPLA 4MVNA 1P2OA 1Q7XA 2FX6A 2QKVA 1PQ7A 3QWCH 4VGCC 2AYWA 1GHAF 3TH4H 3MO9A 1PPZA 4A5TS 1GCTC 2UWPA 3RMLH 1BITA 1W0YH 5FAHA 1TNKA 1RTLA 3S9CA 1VZQH 4F8KA 4AN7A 4TPIZ 2BY5X 4X6OA 1SFIA 4N6XA 4K6YA 1O3AA 1THSH 3A7WA 4MDSA 1IU2A 2AWUA 3HKJB 2D26C 1WCZA 3MH5A 4X8TH 4BTIB 5FB8C 2PA1A 4K72A 4GHTA 1DX5M 2KV8A 2XWBI 3ZVBA 1F5LA 1XM1A 4YO9A 2CXVA 1P57B 5TCAA 2EEKA 2F9BH 2C3SA 2C8XB 1BUIA 2BLWA 2OMJA 2XRCA 4K75A 5DP3A 2DLSA 1K1PA 1LPZB 2IWOA 2P8OC 3VB7A 5H3JA 1GBTA 1HAIH 1ZTLA 2PV9B 1UF1A 4ISHH 5EZ0A 4B73A 8GCHF 1TRNA 3M35A 3SJOA 4HOPB 2IJOB 1GI8B 1VGCC 4EDJA 2AMQA 2EEJA 1KWAA 1C1UH 3SV9A 1AU8A 5J4QA 2P3TB 2KPLA 1V2UT 2BD5A 2Y80A 5E11A 5EU8A 1SQAA 4Y8YA 4D7GA 1G37A 1YBOA 2F0AA 3U69H 2ZGCA 2LNCA 1AZZA 1AKSA 4CRAA 3RMOH 3LGYA 2G51A 1ETSH 3BIVH 3NZIA 1TX8A 4ABBA 3M5OA 3BIUH 3CBZA 2FESH 1YP9A 2OXSA 1GDNA 3BTKE 1EX3A 1O2PA 4XSKU 1MD8A 3U9AH 4R8TB 2R4HA 2J38A 4A6LA 1P03A 3VGCC 3UNQA 3ZZ9A 1LQEA 7KMEH 2SFAA 1BCUH 1HAVA 2R2MB 2Z7FE 2P95A 4NIWA 1TMBH 2FLBH 4JZFH 1QB6A 1UM1A 1E35B 4GAWA 2G52A 1XKBC 2I0IA 5CE1A 1MKWH 1NU7B 4WYTA 2CHAC 1ETTH 3I4WA 3ZVGA 3VB4A 3BG4B 5A0AE 4P0CA 4RKOB 1MMJN 3GJ9A 1PYTC 1QTFA 2EA3A 5DGJA 1MZDA 3TJUA 4BOHA 2I6VA 4QT8C 2KJKA 3BTTE 3F1SB 4ZKNU 2ODYB 1V2TT 4FUGA 3QLPH 1IOEA 3CBYA 1TGSZ 1BA8B 1D3DB 4K1EA 2J34A 1WBGB 3ODDA 3H7TA 2Z9JA 3TPIZ 2A7HA 3O8BA 2EI7A 4K1TA 2J4IA 4ABEA 2V3OH 3RXQA 5J4SA 3M37A 3TK6A 4JZEH 4OEOA 1V2KT 2SGAA 3LONA 4WVPE 4ABFA 3STIA 4GHNA 5FHTA 2O8TA 1IQFA 1C4V2 5DTHA 1VCWA 2BD9A 4CBNA 1K22H 2F83A 2PKSC 3A82A 2KYLA 2DUCA 2FPZA 2BXTH 3CENA 1U37A 2KG2A 1DUAA 2HRVA 1C1WH 1BRBE 3ATWA 1S0RA 4IC6A 1J14A 4FU7A 3SJ8A 1LTOA 1NM6A 1O3PB 1GCDA 1C5QA 1CA8B 1GBHA 2P59A 4AORA 2ZU5A 1HUTH 4ZKRU 4E7RG 3SZNA 2H9TH 2W3IA 3TK5A 3I1EA 2QF0A 1GBIA 4RKJB 1UTJA 3AAUA 3RC4A 5G4BA 1OWJA 4GSOA 2Q9VA 4Z6AH 1ZPCA 1C2FA 4CREA 1XXFA 4Y11E 1CHOF 2G81E 1Q3OA 3ATMA 4YM9A 1YBWA 1HAXB 4INHA 1GGDB 1VA8A 1O3BA 2BOHB 5A8XA 1EP5A 3QO6A 1Z8RA 3U8TH 3LGUA 4KFWA 2BDBA 2ENOA 5H4IB 4L8NA 1S5SA 1ELTA 3QZRA 4TWYA 1D6RA 1A4WH 3BTFE 4X6MA 3UNRA 3A88A 3PM3A 1UM7A 1OBYA 1TE0A 1UTQA 3KHVA 2FEQH 3LNXA 2EGKA 3UWJH 2JH5D 1LHFH 1GJCB 3KN2A 1HRTH 1A61H 2PKUA 1FI8A 2XBWA 5F8TA 1N7TA 1OSSA 1LPKB 4DT7B 2LA8A 1CT0E 1WJLA 4J2YB 1S6HA 2SGEE 1LCYA 1TABE 4NMQA 1WTGH 1XUFA 3Q00A 2OINA 4X8SH 3RXLA 1V6DA 5JYIA 1C5MD 2VVUA 3V0XA 1AB9C 2GZ7A 1V2RT 4Q7YA 3QTOH 3QK1A 2GCTC 1MH0A 1XX9A 1MQ5A 1UMAH 3ELAH 1AI8H 4NMVA 3FANA 2QT5A 2BLVA 1DPOA 1FY3A 1B0FA 1SQTA 2ZI2H 4A1VA 3O8CA 4NMOA 1TMTH 2ZF0H 2VWRA 1EQ9A 2K1QA 1H9HE 5E0JA 5FCRA 4A7IB 4OEPA 2J94A 1ZMLA 1A2CH 1SGPE 1KSNA 3RXTA 1N99A 4NXRA 4E05H 2XTTB 3PMJA 1KYNA 2QYIA 4JZ1A 4O06A 1P02A 1OYTH 1S83A 8ESTE 4YOGA 1KXEA 3HATH 2KPKA 3NGHA 1C5UA 1RZXA 2VU8E 3LJJA 3MU0A 4I8KA 1RTFB 3Q77A 1FQ3A 3L4FD 3ATKA 4ISOA 1RRKA 3ZZ4A 3RXEA 3TJOA 4K2YA 2QG1A 3LKWA 3H7OA 7LPRA 1K1LA 1ZPZA 5A8YA 4WYUA 2B8OH 1GWAA 4WMEA 1MTVA 5GDSH 2D92A 5HFFA 1GGDC 2J2UA 1MZAA 3LDXH 3ZZ6A 1P9SA 3ZZ7A 3M5LA 2RRMA 2FS8A 1C5NH 4X6NA 1ABIH 3CYYA 4I7YH 3PDZA 4E06H 1TRMA 1GBBA 4O3UA 4XDEA 1MU6B 1HNEE 2K1ZA 1ANBA 3GY7A 1PPBH 3QGLA 1W11U 1C5LH 1F7ZA 1O3GA 4FUFA 1MFLA 1V2WT 2A1DB 4NCYA 1TOCB 4MLFB 1QBOA 1SLVB 1ZHPA 3SU0A 1SSXA 4XOJA 1DITH 4D76A 4B2AA 1FN6A 1UHBB 3SNEA 2Q6DA 3NFLA 1ZZZA 2BQWB 2ZTXA 3NCLA 1DWEH 1TB6H 3FFGA 3M3TA 4ZH8A 2G55A 1SGTA 1B5GH 1GI4A 2XCFA 4MPWA 5G1DA 3ZZ3A 1QB1A 1ARCA 2ULLA 5E0HA 1DY9A 3F6UH 3BF6H 1IQMA 3L33A 3RXVA 5A0BA 2O9QA 1DT2A 1ID5H 1KY9A 3MU5A 1WQVH 3D49H 4TYDA 4LZ1H 1C1SA 1YPHE 3MFJA 3HK6B 2Q3GA 1YCPH 2R0LA 3LU9B 1OXGA 1QHRB 1S85A 3MNCA 1VITG 4JK6A 1D9IA 5I25A 1G3BA 2YTWA 1NPMA 3EGGC 1FUJA 2BZ6H 2TGTA 3SJIA 1UITA 3F9HA 5CMXH 1FN8A 1VJ9U 2BVRH 5GCHF 2HE2A 3TIUA 5HGGA 9LPRA 3SU5A 1UCYH 1O0DH 1XXDA 4AOQA 3IITA 1DWDH 1FIWA 4H6TA 5FX6A 4AMHA 3K6ZA 2GGVB 5HEYA 1SGEE 1G32B 2GV7A 2VWMA 1A5IA 1GI9B 2V0BA 1HLTH 1O39A 4HI3A 2Y7XA 1MKXK 2BY7X 3SV7A 1K32A 2Z6BD 1Y5UT 4Z8JA 1XUJA 1O3FA 4UU6A 3S69A 2XWAA 4U01A 1BJUA 3BG4C 5EXNA 2GKVE 2H9HA 2FE5A 1T2MA 2PR3A 1F5RA 2OC7A 1HDTH 1GJDB 1GPZA 5E8EH 1Z86A 2QBWA 3SOEA 4MPAA 4Y8XA 4NXQA 4AZ2B 2A4GA 2XYAA 5IDKA 4UEHH 3QDOA 3D65E 3T29A 3UWIA 1PQ8A 3RXDA 1T8LA 4O9VA 2OBQA 4D9RA 2HNTE 3VEQB 2AIPA 2FODA 2STAE 1CO7E 4PQWA 1KXDA 1MAYA 2KL1A 1AD8H 2H3MA 1V62A 3BEIB 3BV9B 4DJZB 1K1OA 4K60A 2CSSA 1GI2A 1IQJA 4MG3A 2GCHG 5E6PB 3WY8A 3A8AA 3ATLA 3OSYA 2BD8A 3S0NA 1AMHA 3F9FA 5FPTA 1T4UH 2VIVA 3ID1A 4XBDA 3VXEH 2GV6A 1SOTA 5E1YA 1C1VH 1QCPA 1QAUA 2W7SA 3E1XB 3SBKA 4LOYH 4NSVA 1QA7A 2A45B 1ZTKA 4HGCA 4NZQA 1E36B 1O5EH 2OTVA 4UD9H 3RXAA 1BBRK 2REYA 3V7TA 1V2LT 1IQNA 3DFLA 4J1YA 1O3CA 3HGPA 3SOSA 3T25A 4CRGA 1W8BH 3MMGA 1O2NA 3P17H 4BAMB 1Z7KA 1IQIA 2PTCE 1SBWA 1D4PB 5HFEA 3K50A 2KRGA 2H1UA 2Z9LA 2KQFA 1GHVH 3TSZA 5EODA 2QA9E 1BRAA 3K6YA 1Y7NA 2G4UA 3TU7H 3RXFA 3T5FH 2L4TA 3BTHE 2JINA 1QJ1B 4WJG2 2BD7A 2VINA 3TH3H 3UOPA 2DJTA 1C5VA 4R2ZA 1GJ7B 2EI6A 2AWXA 3EA7A 1C1MA 1F0UA 1GJ4H 2QY0B 2I1NA 1ELBA 1K9OE 2Z9KA 1GI1A 3M3SA 2GZVA 1HFDA 5L6NH 2W7UA 3EDXB 4ABJA 1O2QA 3MU1A 1NRNH 3M7TA 1XZ9A 2ZHFH 3UQOA 1UK4A 1VGCB 2P3UB 3ZZ8A 4AG2A 2HPQH 1O2YA 2A4RA 1NRRH 3MTYA 1O2XA 1J17T 3KZDA 3TJVA 1D3PB 1F0RA 3SJKA 4SGAE 1UJDA 2VZ5A 1PPCE 3GCHB 3HPKA 3R69A 1EPTC 1P1DA 2FTMA 1IQEA 2VGCC 5AVDA 3SV6A 5DPAA 1AN1E 1A46H 3N7OA 1WFGA 3RXJA 3VXFH 3SJ9A 2YNAA 4Q6SA 1WH1A 3MU4A 1W3CA 1B7XB 1VB7A 1HJAB 4NFEA 3SQHE 2R9PA 2I0LA 1QQUA 1C4U2 5E0GA 1DDJA 2GT7A 4ISLA 1ZMJA 1N6XA 3ZV8A 4Q7XA 1FPHH 3DFJA 3QDZB 1MKXH 1YF4A 1GBAA 1T8NA 1KTTB 3UOUA 5JBBS 1WHDA 1PQAA 1G3EA 1UTNA 4RN6A 3QX5H 1UTKA 3TITA 4NXPA 1E34B 2CF9H 4WH8A 1JRTA 2TBSA 2V1WA 1NFUA 4JORA 1UCYK 2H5DA 2VWNA 1GJ9B 4Y71A 1GJ8B 2OQSA 4XHVA 2ZGJA 3M5MA 2F91A 3SHCH 1LPGB 3Q3KA 4Q2OA 1AVXA 1ZHRA 3PWBA 3RMNH 1A5GH 3ZVFA 3TVJB 1BTHH 2M0ZA 4IN1A 1X5NA 5JBCS 5A2PA 1JOUB 1EZSC 2E7KA 1O2WA 3O8RA 1FV9A 4GCHF 2BDIA 2GZ8A 4ZHMU 1ZTJA 5FX5A 5F6MA 2AGIX 2ZFPH 5GXPA 2FP7B 1TQ0B 2BYAX 1X45A 1QFKH 3T2NA 2BZAA 3FZDA 3GY4A 1TMUH 3SUDA 1SGIB 5GNDA 6CHAB 3LH3A 2QN5T 3CP7A 5DK1A 1HIAA 5HMAA 1X6DA 3LGIA 3RU4E 1YPKH 3HGNA 2DC2A 1O5FH 2HPPH 1IQGA 4ZMAH 3M61U 4Y0YE 1TAWA 2QAAA 4IGDA 1CBWC 1RIWB 1CA0B 2FYQA 3UTUH 3CC0A 4CBOA 3NWUA 2WV5A 2M0UA 2HNTF 1THRH 3RDZA 1T4VH 3QJMA 1WI2A 3GDUA 5E22A 5DP7A 5A2MH 1UK3A 4NSYA 3L6PA 1ZJDA 1GG6B 2IWQA 1SLUB 1W9OA 3QZQA 2TPIZ 4Y8ZA 2M10A 2ZDKA 1GHAG 4Q6HA 3SU1A 1CGHA 2ASUB 1E37B 3TLOA 1MCVA 4Q2QA 1TGTA 3LPRA 4YLQH 2D1JA 1GHXH 3G01A 3NKKA 5LPFA 1C1RA 3A8BA 3JZ2B 5ABWA 3VB3A 3RXMA 5FCKA 3PTBA 2JETC 4X1NU 4YT6H 1C1TA 1FC7A 3TH2H 3V13A 1L0ZA 4FUIA 4UU5A 2UUFB 1V2NT 1YYY1 2SNWA 1DICA 1P0SH 3GYLB 2A5AA 3TGIE 1IQHA 1O2TA 1EZQA 1Z1JA 3OTPA 5LPRA 1C2KA 2NU4E 4ABDA 3GCTF 1FCFA 3S7HB 3PMHB 2OGPA 3SV2H 1O3KA 4JOHA 5JPMH 1HGTH 1SMFE 3RLEA 2G5VA 3E16B 4ABIA 1O3EA 3DHKH 4XBBA 3GDSA 2PGQB 2KOMA 1AZ8A 1WUNH 2Q6FA 2BXUH 1FY5A 2ZFFH 3LGTA 4B1TA 1Y3UA 1PYTD 1AKSB 1GI6A 1NFWA 3VB5A 4YZUA 2ZTYA 3SGBE 1N8OB 3GY5A 5I46H 3RXIA 1PPGE 1DS2E 2OQ5A 3OY6U 2DM8A 3ATIA 4NWLA 2WL7A 5E2OA 4X2YA 2O8MA 3GCHC 2HALA 1N8OC 4X2WA 1SFQB 1FC6A 1BBRE 3E6PH 1DSUA 4NIXA 2K20A 4K3JA 5GPIB 1CA0C 2STBE 1RGWA 1HYLA 4HFPB 3EGHC 2XW9A 3PLKA 4WWYA 3W94A 5A09A 3O8DA 1BRUP 4KELA 3AAVA 2O8WA 1L4ZA 1GDUA 2OZFA 2LUIA 1CU1A 1BQYA 1X8SA 4BAQB 2FZZA 3A83A 1HAOH 1C4Y2 1C1OA 3RP2A 1DUEA 2PKTA 4LMMA 1O2RA 3NFKA 1V2VT 1P2MA 2F9NA 4E3BA 1FDPA 3HVQC 1OWIA 4OS2A 2J92A 7ESTE 2R2WU 2P3WA 4FUCA 3B23B 3U8OH 1HB0B 3VB6A 1C5SA 2RA0A 4CHAB 3K65B 1QL9A 5LGOA 2RG3A 5BPEA 1P2QA 5A0CA 3A85A 1GHBF 4KTUA 1UVPA 1EZUC 4UFFH 1BDAA 3I77A 2Y5HA 4I33A 1Y3YA 1ACBE 3HK3B 3SFJA 1JMOH 1UHPA 1UVSH 1MBQA 1HV7A 1MBMA 3HKIB 4NFFA 1UTPA 4CRFA 1C2GA 3RXGA 1PDRA 3DA9B 3KQBA 4MTBA 2ZHWH 4UFEH 2BDGA 3NXPA 4NG9H 2VIPA 2ALPA 2G4TA 2UUYA 2MX6A 1JIMA 2C93B 2CMYA 3PV4A 5JXBA 1TBZH 4FUEA 4WXIA 1YGCH 3PWCA 2ZIQH 1V2JT 2P16A 3ITIA 5EXLA 1SC8U 1P10A 1ZLRA 1FJSA 1C1QA 2ZCKP 4DVAU 3BTEE 1AWHB 2BX3A 3UR6A 1P3EA 2NU2E 2OCVB 1IQKA 2W5EA 3ZVCA 2FIRH 1Q2WA 3ZVDA 1DOJA 4MNYA 4X8VH 1JWTA 2ZFQH 1S6FA 2I6QA 1NU9A 4SGBE 3E17A 3HPMA 4UFGH 2I04A 3UREA 2KJDA 5TCCA 2WPJS 1S84A 4CH2B 1P06A 1GG6C 1MAXA 3QGJA 1O2OA 1O2IA 2Z3EA 3GSLA 4DIIH 1NROH 5F03A 1JRSA 3VPKA 2Z17A 4Z33A 1MU8B 1G2MA 1KXCA 1OWKA 1SGFG 5GIBA 3MH7A 3U1IB 4E35A 1ANEA 3GICB 1P1EA 3ID3A 4INKA 1TPSA 4OS1A 1IHSH 1CHGA 3MH6A 3MHWU 1C9TA 1LVMA 1QR3E 1PQ5A 5HJ1A 2VSVA 1D5GA 1DVAH 3CS7A 1UEWA 3VFEA 3OX7U 2BD3A 1BMLA 4AFQA 4NMRA 1HAPH 2TRMA 1SHHB 1TP5A 1X7AC 2F9PA 2G00A 1AIXH 2BX4A 3PLBA 3RL8A 2QKUA 3ID2A 3OU0A 2CF8H 1UHBA 1UJVA 4ABAA 2VJ1A 3FP6E 3LT3A 1HCGA 1GJAB 2Y6TA 1DANH 3I29A 4G69A 3SNCA 3U98H 3BPUA 1BT7A 2PDZA 2SGPE 2EDVA 3K1RA 2KAWA 1EXFA 3EQ0H 4NA8A 2BB4A 2IPHA 1ZMNA 3GY2A 3ZZCA 1AGJA 2AERH 2BY6X 1O3JA 4K8BA 1HAHH 3TSVA 1G30B 8GCHG 4HTCH 3SUFA 1FNIA 5EG4A 3ENSB 3RXSA 2DKRA 3RXKA 1PPHE 5HFDA 1F92A 1WV7H 1MUEB 1T8MA 1XVMA 1QRZA 1SGFA 1HJ9A 2Z94A 3LC3A 3EE0B 1FMGA 1GMHF 1RJXB 1SVPA
chains in the Genus database with same CATH superfamily
1IAUA 2KBSA 2M0TA 1M9UA 1Y3WA 4AGJA 1J16A 3TMHA 2QXIA 3BN9A 7GCHF 3GYMA 1Q31A 2EI8A 1AE8H 4VGCB 4FU8A 1N6EA 2OC8A 4GHQA 1HXEH 5EW2H 3URDA 1Z6JH 2DB5A 5HM9A 2NU0E 1XUGA 3F9EA 1TGCA 1XMNB 1FY1A 4CHAC 1SG8B 2NWNA 2V90A 3KHFA 4OAJA 1V6BA 2A5IA 3BTGE 3RU4T 2SGFE 2QF4A 3TSWA 1ANCA 2GCHF 1OPHB 5HYOA 1TOMH 1ZSLA 1EOJA 3DIWA 3NK8A 2JH0D 5HM2A 1D6WA 2FMJA 2JOAA 1PFXC 1GHWH 4REYA 1W7GH 2CK3D 3A81A 5LH8A 8LPRA 4P2AB 1H8DH 2OCSA 1TONA 1VITF 2OC1A 5K0HA 1ELGA 5F8ZA 4YLUA 1MABB 1ORFA 3P8NA 1Q3PA 1NT1A 1XKAC 1EP6A 3SUEA 4AX9H 2K0QA 3M7QA 3E8LA 4ZXYH 3SYJA 1MC7A 2XBVA 3F2GA 4B76A 1TBQH 3MQKC 2FOGA 3PO1C 1BRCE 5FPSA 2A7JA 1RIWC 4ASUD 1GHBG 1T7CA 4ZKOU 1NO9H 5C67A 3RMMH 1QB9A 4FUDA 1NBME 2BDAA 1K28D 1E38B 1C9PA 3T26A 2Y82A 6GCHG 3EGKH 4BNRA 2PWXA 1K2I1 1UW7A 5HEDA 6LPRA 3KGPA 3FZZA 1PPEE 2WPLS 3MNXA 3VG8A 3LGWA 2PKAA 2FI5E 4K76A 4IBLH 4FUHA 2TGPZ 1SKYE 3A7YA 2QXHA 4FLNA 3U28C 4H42U 5EQSA 1O2VA 4ZHLU 2AFQB 3FVFB 4DIHH 2W4FA 1L1NA 3P8GA 2LC7A 1HAYB 2DLUA 2IN2A 2ZCHP 1NY22 2CHAB 1J9CH 1Y3VA 4BTTB 5C5OA 3RLWH 3F3BA 2FNEA 4RI0A 3TK9A 1C5XB 3Q3XA 2EHRA 3FP8E 4MNVA 5HKKD 3ZVEA 2TGAA 1ZUBA 3DORA 2VRFA 4F49A 2YNBA 1NC6A 1CSOE 4I8GA 2LC6A 1OP2A 4X0WU 3PV2A 1GVLA 1F5KU 1YM0A 2W6ID 3W95A 1EPTB 1IHJA 4I8HA 3ZZBA 2HLDD 3UB0A 1YPJH 2FOBA 5AFYH 1MD7A 4Y6DA 3A80A 2FOEA 4H6SB 4K78A 1MTUA 4FUJA 2QXGA 4OS4A 3H5CB 4TWWA 2JIKA 3TGJE 2R0KA 3RXBA 2IOTA 3SHUA 1UEPA 4WXVA 1O5AB 1UTMA 4IW4E 1TNIA 2A32A 3T62A 1WI4A 3B9FH 1Z71A 5DP8A 3FY5A 3P8OA 3PB1E 1GQ4A 2PNTA 1GMCG 1SI5H 1CQQA 2BOKA 3K2UA 2QF5A 2PGBB 1O34A 1A5HA 2CN0H 4K8YA 2ZFRH 1SQRA 3MI4A 4JYVH 4CR5A 2AWWA 4KKDA 2ILNA 2ZZUH 1EKBB 1EAIA 2G2LA 3SU2A 4UONA 3R68A 1AO5A 4UDWH 5T6FA 3ZRTA 2ZGBH 1G2LA 2TGDA 3KQCA 3LGVA 1VKYA 4H4FA 2ZPQA 2ZU2A 2CJIA 4Y79A 5FBIA 2ODPA 2WUCA 3MO6A 5L2YH 2DAZA 3RXUA 2BDHA 3RXOA 1N6FA 1TA2A 1AFQC 2CGAA 1SLWB 2TIOA 4GVUA 2B5TB 2Y5GA 3BTME 1O3DA 3SHWA 2UUJB 2EV8A 1EOLA 1AFQB 2ANMH 5F3XA 1GBMA 1GBFA 1O3LA 2QXJA 1Y5AT 3UFAA 4OM9A 1GJ5H 5EPNA 1IU0A 1OOKB 2VVVA 2RDLA 4FUBA 2VWOA 4Y7BA 5KEDA 1O2JA 4OS7A 1YLCA 2C8ZB 2GT8A 1RY4A 2THFB 5FBEA 4HOPA 3QN7A 1Y5BT 4NMSA 1A0JA 2OC0A 2ZDNA 8KME2 1ELVA 4MPXA 1DE7H 1QURH 3QUMP 1O2LA 1NRQH 3AW0A 2YT7A 1K1IA 1X5QA 4KFVA 5KECA 1YPMH 3QE1A 2FX4A 1TWXB 1Z1IA 1UTLM 1EAXA 3Q76A 2LPRA 2BY9X 2H2BA 2PLXA 3N99A 4JMYA 2L97A 3A7TA 3PS4A 1GM1A 3WWFA 5JB9S 2WPMS 2A4OA 3UIRA 1VJAU 4YTAA 1YPHC 1WXRA 2ZHQH 2J95A 2ZDVH 3UQVA 1GVZA 1LMWB 2KOHA 2H6MA 5JBAS 1X9ZA 1FXYA 5E2PA 2SNVA 1SGNE 5HFCA 2ESTE 1QLCA 3P92A 4NIYA 1R6JA 2F9OA 3DJ1A 4TY6A 3R0FA 1SQOA 1P04A 3ODFA 2VIOA 4AGKA 2A2XH 3PMBB 2EXGA 3MNSA 2GMTC 2PW8H 1P01A 5C2ZA 1OWDA 1ZRKA 2BDYA 3F9GA 4D8NA 1QZ8A 3PV5A 3F2HA 5SGAE 1ABJH 4I32A 2RA3A 4Q80A 2VIWA 1VCPA 3SI3H 1ARBA 1UVTH 1W12U 4B71A 1ZRBA 4ISNA 4OGXA 6CHAC 1DY8A 3FKSD 3GGEA 1DWBH 3GY8A 2BLQA 3CS0A 1ELEE 1T32A 2FTLE 4BANB 1V2MT 2VIQA 2VH6A 4WMFA 1O2HA 5FPYA 2UWLA 1WIFA 5IK2D 2ZNKH 3SI4H 1KEFA 2HE4A 3GDVA 3BEUA 1BMAA 1ZHMA 1P2NA 2HVYB 3TNSA 3MU8A 4XFQA 2RCZA 1GBLA 2P93A 4GLYA 4LZ4B 2AS9A 1H8IH 5EGMA 4YOJA 6GCHF 2JREA 2WUBA 1EUFA 5HXFA 1BTPA 1C1NA 1N7FA 2V6NA 2ZHEH 1T31A 2YT8A 3WKLA 1JBUH 1FPCH 2ZQ1A 3SGQE 1U38A 4DG4A 3PYHA 2CS5A 1M5ZA 2YUYA 2WINI 3SO3A 2AMDA 4GPGA 1GI0A 2LP6A 3PRDA 4YT7H 3S9AA 3ZZ5A 3DD2H 3SQEE 1K0HA 1SOZA 1GDQA 1W13U 2VGCB 1QAVB 2W3KA 1DLEA 4B2CA 3DSGA 4Q2NA 1A1RA 1V2PT 4RSPA 4BXWA 4E7NA 1AB9B 2EEHA 5D13A 1C2IA 3PO1B 3KCGH 2I4SA 1OP8A 2FI3E 2W26A 5F53A 4GCHG 2UZCA 4WH6A 1A3EH 1HAZB 2G8TA 4Q7ZA 5IYTA 4AFSA 4WY3A 1ELDE 1O30A 2WV4A 2NU3E 1YC0A 2VSPA 1DXWA 2F4LA 1DSTA 5EJLA 3SNDA 3PROA 2Y5FA 1AUTC 5JB8S 3BTQE 1CBWB 1SGDE 4JOEA 1BB0B 2QF3A 4B2BA 7GCHG 1O5BB 3UY9A 2QV1A 1AUJA 1HIAB 1QL7A 1O2KA 1TQ7B 1FAXA 4IMZA 1O2GH 9ESTA 5EW1H 2KAIA 1UEZA 1AY6H 2ANWA 2H3LA 2KAIB 3DSPA 3FP7E 3PDVA 1GMDG 4GUXA 5E21A 2WPKS 2FOHA 2BMGB 2FYRA 2JH6D 3P95A 1CHOG 3ZZDA 2J98B 2BQ7B 4GVDA 2WPHS 4A1XA 3BSQA 1BFEA 2FDAA 3SV8A 5CDFE 1GMCF 1K1JA 4INLA 3B76A 5CHAB 3M36A 2ZECA 4U32A 1NTPA 3NPSA 4B75A 3ESTA 5GJ4B 1RS0A 3M3VA 1LHGH 4GVCA 4OS5A 1J15A 3Q3YA 1P8VC 2RCEA 2D90A 5F8XA 2JKHA 4CRBA 5C5NA 2UUKB 1FY4A 1XVOA 1ESBA 2ZDAH 3ZIAD 2EDPA 4X8UH 4Y76A 3E0PB 4BTUB 2EEGA 4ABHA 4K5ZA 2JWEA 2C90B 2HGTH 2ZCLP 3KZEA 1KXFA 3BG8A 3OAAD 1SLXB 2GVFA 2BM2A 2SGDE 4UE7H 4DURA 2KOJA 1TGNA 1RXPA 4FXGH 1QRWA 2H5CA 3B8JA 2EEIA 4JOPA 1MKWK 1CE5A 1DLKB 2ZPSA 3TJNA 4CH8B 2OPGA 2F3CE 4NA7A 4D9QA 3KQEA 3S9BA 4FVBA 1ZR0A 2O8UA 3MOCA 1O31A 3C27B 4U30A 1CVWH 3GCNA 5EOKA 1TGBA 4NNLA 1C5OH 2WZQA 1U3BA 2QCYA 4Q3HA 3ZVAA 4AFZA 2WYGA 3SW2B 1G3DA 1ZSJA 2OUAA 3VQGA 5AFZH 1VAEA 1CGJE 1Z8IB 2BTCE 2KCPA 1UVUH 5AHGH 3SNAA 1A3BH 2IWPA 1WTHD 4IC5A 2EDZA 3KQDA 3GISB 1HBTH 1THPB 3ID4A 1O32A 1KLTA 4ZXXH 2B7DH 2GTBA 3PMAB 1H8ED 2A5KA 2PUXB 4AYVB 1QA0A 4I31A 4ZROA 1EAUA 4AYYB 3O46A 3IWMA 4M7GA 3K9XB 1N6YA 1WF8A 1HJ8A 4O3TA 1I16A 1AFEH 2Z3CA 1CT2E 1XUKA 1LQDB 4XRNA 4KTSA 1MFGA 3CH8A 2BVXH 4ZKSU 2ZPRA 5DO4H 2OLGA 2PSXA 1WOFA 3OEHD 1U6QA 2G5MB 2GX4A 3VGCB 2QIQA 1S0QA 4X1RU 2GZ9A 1LDTT 1VR1H 1QQ4A 1EB2A 1TNLA 2GD4B 4YDPA 3GY6A 4X1PU 4AG1A 5A8ZA 2ZU4A 2A4QA 2IWNA 3R3GB 4Y7AA 1UO6A 2OP9A 2KA9A 1N7EA 4FETA 4U2WA 1OZIA 3SUGA 3ZV9A 2PKAB 1W7XH 4FOUC 1UTOA 1LHEH 4MPVA 1C5TA 1RTKA 4NWKA 1O3OA 1C5YB 2OBOA 2ZDMA 2VB0A 2ZA5A 1C2DA 4A1TA 1GBDA 1TA6A 5HF4A 1SGYE 1MTNC 1GHZA 2OSGA 1WF7A 2EGNA 1OKXA 1OWEA 1P2JA 4WMDA 2BVSH 3RM0H 3RXPA 1OP0A 1K1MA 2A31A 1L2EA 2ALVA 2AGGX 2C4FH 1LVBA 2GDEH 4Z0KA 3KNXA 3EA8A 2YUBA 1GCTB 3TNTA 1EATA 4Q63A 4AB9A 3LH1A 1VITH 5HETA 4JYUH 1G9IE 1ANDA 2P8OB 4CRCA 2FI4E 1P2KA 1GBCA 1TQ3A 1H9IE 3RUOA 3BTDE 2ZKSA 1X5RA 4TPYA 2Z9GA 3UR9A 1NTEA 5C1YA 1H4WA 3A86A 2PZDA 1WAYB 2CV3A 5EQQA 3C1KA 1MCTA 1LHCH 2B9LA 2VWLA 1PJPA 2FS9A 1DWCH 1OWHA 1TBRH 4R0IA 1L6OA 5C0TA 4TT3D 5GCHG 1O5GH 1OBZA 1IQLA 1GI3A 1UFXA 1G3CA 5B42A 1RD3B 2YMSC 1GHYH 5DSFA 2M3MA 3QJNA 1QRXA 1KIGH 1D3QB 1V1TA 1A7SA 1AE5A 1EZXC 1O3NA 2OQUA 1CGIE 3K82A 2UWOA 4TY7A 1INCA 4ZUHA 3O5NA 1O3HA 1BTWA 4ABGA 2XBXA 4ZHAA 3ZYDA 4ESTE 3CBXA 1C5ZB 4X2XA 2FM2A 1E1RD 3RLYH 2GCTB 1P11E 2C8YB 1ZPBA 4H11A 1C2HA 5EQRA 1FY8E 1FAKH 2VVCA 2V3HH 1KTSB 2OS6A 1U39A 1LKBA 1GMHG 2HLCA 1NN6A 1P2IA 1TNGA 1C1PA 2HWLB 1DFPA 4THNH 3JXTA 1YKTA 1BTUA 2KFWA 5DP5A 2D8IA 3A7VA 1TPPA 1W10U 2KJPA 1ELCA 3KQ5A 4NGAH 3M7UA 1TALA 2B0FA 2BYGA 1V5QA 2FOCA 4NA9H 4B74A 1HPGA 5C1XA 1KXBA 3F0PA 4RT0A 3JZ1B 5GLJA 1WG6A 1V2ST 1L4DA 1C5RA 2EQNA 4KP0A 1DXPA 1L1JA 4Y10E 1GBEA 1ZGVA 3N7EA 2ZGHA 2VPHA 1SGRE 1SL3A 4IS5A 2WSSD 3GOVB 1S82A 5I7ZA 2FWWA 3DJAA 1TX7A 3TGKE 3R0HA 3D62A 2JXOA 1QGFA 1KXAA 3AASA 3PLPA 4IMQA 2QGRA 3SN8A 4FU9A 5EXMA 1UVOA 1O2MA 3GY3A 3OEED 1ETRH 4JYTA 2IPQX 1LKAA 5HF1A 1K21H 1YPEH 3PRBA 4OS6A 2HVXA 2XBYA 2YOLA 1BMNH 3RC5A 3E3TA 3S7KB 3WKMA 1O3IA 2D8WA 1QIXB 2KM0A 2P3FH 2XC5A 3E91A 5K7RA 2H2CA 2XNIA 1MTSA 4JJ0A 2Q6GA 4ZAEA 4HG6A 2M0VA 1YPLH 5DG6A 3RXCA 1BBRH 3KYGA 3DCLA 3SGAE 1BTXA 1XUHA 2ZGXH 3L3TA 5CHAC 1O38A 3RM2H 4A92A 3EA9A 3A8CA 1YCPM 5ESBA 5HEBA 3D23A 1YPGH 4JZDH 5DP9A 1WU1A 1KDQA 1KLJH 5G1EA 3OTJE 1D3TB 1S81A 1W2KH 2AHME 2DE8A 2GDDA 5EPYA 5T1VA 5C1UA 4I8LA 1L1GA 5ESTE 1COWD 4OGYA 2BLOA 1O33A 3MO3A 2FOAA 4MNWA 1UJUA 1OBXA 1DM4B 1QAVA 4O97A 2FXRA 4AFUA 3LJOA 2J9NA 2HOBA 3OYPA 1XUIA 3SNBA 1AVGH 3STJA 2ZHDA 2CSJA 2D2DA 1NZQH 1MTNB 4YOIA 1V2QT 3A89A 1HJAC 3A8DA 3KL6A 4BAKB 2PKSB 1CT4E 2O8LA 1QBVH 1C5PA 1UK2A 3UPEA 1QJ6B 2SGQE 3URCA 2ZC9H 1Z8JB 1NESE 3U8RH 4X1SU 3M5NA 1EAWA 2AINA 5PTPA 2ODQA 1GI5A 2BHGA 2M5TA 4NZLA 4DW2U 2HGAA 1C2EA 1F0SA 4F48B 1YWUA 4DOQA 3DT0H 5DKMA 2J98A 4Q2KA 4CRDA 4JOGA 1GJ6A 1P09A 4ISIH 1QY6A 1V3XA 4CR9A 1BTYA 5JDUB 2A0QB 1MTWA 1BIOA 1F0TA 1AWFH 1O37A 1OYQA 1TYNA 3OY5U 2GJGA 3QGNB 4Y0ZE 1H9LB 1B8QA 4DCDA 4JL7A 4HZHA 1LVOA 3SHAH 1P12E 1TFXA 2FCFA 2R3YA 2ZO3H 2BD4A 2QKTA 3MWIU 1SGCA 1YCPK 5T6GA 4NNMA 3MH4A 1N1LA 2PFEA 2Q1JA 4JOFA 1J8AA 1O2ZA 3LOXA 3PTNA 1O3MA 1B0EA 1BHXF 2FOFA 3ZYEA 4LK4A 2BQ6B 3QIKA 2AMPA 1NRPH 2EJYA 5L30H 2Z3DA 2Z9IA 1RGRA 4AB8A 2NU1E 1GJBB 2FLRH 1GBKA 1ELFA 3SU4A 5F67A 3DJ3A 1ELAA 1H1BA 3ZZAA 4UFDH 1ESTA 1W0ZU 4IN2A 3GCOA 5FXLA 5C20A 1A0HB 1NBMD 2F9VA 2Y7ZA 4MQAA 3KF2A 2O2TA 1O5CB 2PUQH 1VCQA 2ZFSA 3IG6B 4F4OC 3H09A 2ZG0H 2X7ZA 3BEFB 1TIOA 2H9EH 1WQSA 2PSYA 1EJMA 1VJ6A 1NRSH 1TPOA 1GI7B 4NIVA 1SPJA 1TP3A 4MPUA 1W9EA 1NS3A 2AIQA 1WSSH 3FAOA 2PTNA 4Q4LA 3F68H 2XC0A 3P8FA 1NF3C 3E90B 2A7CA 4TSFD 4WF8A 3SU3A 4D7FA 5EYZA 5JBTA 1ZSKA 4NMPA 1MQ6A 1RGQA 1JXPA 3SUZA 1O2UA 2VH0A 1ZYOA 2V35A 4KTCA 1KDQB 2WPIS 1PPFE 2KX4A 2PHBA 1EJAA 1BTZA 4BXSA 1ZGIA 2FOMB 2QC2A 3E0NB 1OHHD 3QTVH 1BZXE 3FOAA 4FVDA 2AH4X 3A7ZA 4BAHB 1LO6A 2I6SA 3RXRA 3U1JB 2EC9H 1FC9A 2C8WB 1A0LA 2FO9A 1GBJA 4K1SA 1NFXA 2ZDLA 1GMDF 1ZJKA 2ANKH 2ANYA 2ZFTA 4B6EA 1BJVA 2DMZA 3I78A 4PROA 3KYFA 1TRYA 2A2QH 5TJXA 3RC6A 1G9OA 1EPTA 3RU4D 2L4SA 4JOJA 3T27A 1SB1H 2G5NA 2ZP0H 5ETXA 3AXAA 1P9UA 1C5WB 5LPEA 1TLDA 1N6DA 3V12A 5AF9H 3GABA 2VIDA 1GL0E 1T8OA 1IHTH 1QJ7B 2AGEX 5DP6A 3AW1A 1WHAA 3RL7A 1FZZA 1QBNA 4XBCA 1NFYA 3BTWE 1V2OT 5T6DA 4ASHA 1JIRA 1SR5C 3SORA 3LIWA 3UNSA 3UUZA 1I92A 1BMMH 3I18A 2WPDD 3GS9A 3EAJA 1LVYA 5HDYA 3AVZA 3KIDU 4MNXA 4X1QU 1ESAA 1Z87A 2F9UA 4JK5A 1FLEE 4LXBH 2BY8X 1KLIH 5C3NA 2JILA 2MHOA 5HFBA 1E0FD 2ZWLH 2R3UA 1W14U 5DJ7A 4YYXA 1O36A 4NMTA 1W9QA 1TNJA 1HAGE 2OD3B 3V3MA 2XC4A 3NUMA 1C2LA 4K69A 4DY7B 2LOBA 5T3HA 5L2ZH 2IJD1 2XCNA 1QNJA 3MYWA 4I8JA 5BRRE 2ZEBA 3HPTB 5ILBA 3EYDA 1Y3XA 1V5LA 1Z8GA 2RFKC 1UCYE 4KGAA 1GL1A 3RXHA 1O5DH 3A84A 1AQ7A 1UJ1A 6ESTA 4O03A 3T28A 5GWZA 3LNYA 1OX1A 2FN5A 1YLDA 1SGQE 2ZQ2A 1GVKB 3SU6A 4Q2PA 1AVWA 3A87A 1RFNA 1OS8A 2EGOA 4JOKA 1O2SA 5B6OA 2BDCA 3DUXH 1LHDH 1BOQA 2WHXA 1WFVA 1FIZA 2F5YA 1ZOMA 4YESB 3P6ZB 5DP4A 3VQFA 1TNHA 1P3CA 3LC5A 4JCNA 4DGJA 1Y59T 1SHYA 2ZPMA 1Z6EA 4E34A 4JZIA 1Y8TA 1WYKA 1HAVB 3CNRA 2BD2A 2GP9B 3P70B 3GCTG 1C2MA 2LELA 1QL8A 2AEIH 2HNTC 4X2VA 2H2ZA 2GMTB 1P05A 2ZU1A 2JETB 3KEEA 4XE4A 4BAOB 2WYJA 1FONA 3MNBA 1GQ5A 1UEQA 1TX6A 1EB1H 1EASA 2ZU3A 2EAQA 1BE9A 1BHXB 4X6PA 2W7RA 4FGMA 1EJNA 3A7XA 1ZOKA 1HXFH 1F2SE 2P94A 1O35A 2ZTZA 2DE9A 1AHTH 1TPAE 2XXLA 1G36A 1Q3XA 2Y81A 1K1NA 2VNTA 1C2JA 5B6LA 2ZPLA 4MVNA 1P2OA 1Q7XA 2FX6A 2QKVA 1PQ7A 3QWCH 4VGCC 2AYWA 1GHAF 3TH4H 3MO9A 1PPZA 4A5TS 1GCTC 2UWPA 3RMLH 1BITA 1W0YH 5FAHA 1TNKA 1RTLA 3S9CA 1VZQH 4F8KA 4AN7A 4TPIZ 2BY5X 4X6OA 1SFIA 4N6XA 4K6YA 1O3AA 1THSH 3A7WA 4MDSA 1IU2A 2AWUA 3HKJB 2D26C 2JDID 2GEFA 1WCZA 3MH5A 4X8TH 4BTIB 5FB8C 2PA1A 4K72A 4GHTA 1DX5M 2KV8A 2XWBI 3ZVBA 1F5LA 1XM1A 4YO9A 2CXVA 1P57B 5TCAA 2EEKA 2F9BH 2C3SA 2C8XB 1BUIA 1E1QD 2BLWA 2OMJA 2XRCA 4B6FA 4K75A 5DP3A 2DLSA 1K1PA 1LPZB 2IWOA 2P8OC 3VB7A 5H3JA 1GBTA 1HAIH 1ZTLA 2PV9B 1UF1A 4ISHH 5EZ0A 4B73A 8GCHF 5IL9A 1TRNA 3M35A 3SJOA 4HOPB 2IJOB 1GI8B 1VGCC 4EDJA 2AMQA 2EEJA 1KWAA 1C1UH 3SV9A 1AU8A 5J4QA 2P3TB 2KPLA 1V2UT 2BD5A 2Y80A 5E11A 5EU8A 1SQAA 4Y8YA 4D7GA 1G37A 1YBOA 5DN6D 2F0AA 3U69H 2ZGCA 2LNCA 1AZZA 1AKSA 4CRAA 3RMOH 3LGYA 2G51A 1ETSH 3BIVH 3NZIA 1TX8A 4ABBA 3M5OA 3BIUH 3CBZA 2FESH 1YP9A 2OXSA 1GDNA 3BTKE 1H8HD 1EX3A 1O2PA 4XSKU 1MD8A 3U9AH 4R8TB 2R4HA 2J38A 4A6LA 1P03A 3VGCC 3UNQA 3ZZ9A 1LQEA 7KMEH 2SFAA 1BCUH 1HAVA 2R2MB 2Z7FE 2P95A 4NIWA 1TMBH 2FLBH 4JZFH 1QB6A 1UM1A 1E35B 4GAWA 2G52A 1XKBC 2I0IA 5CE1A 1MKWH 1NU7B 4WYTA 2CHAC 1ETTH 3I4WA 3ZVGA 3VB4A 3BG4B 5A0AE 4P0CA 4RKOB 1MMJN 3GJ9A 1PYTC 1QTFA 2EA3A 5DGJA 1MZDA 3TJUA 4BOHA 2I6VA 4QT8C 2KJKA 3BTTE 3F1SB 4ZKNU 2ODYB 1V2TT 4FUGA 3QLPH 1IOEA 3CBYA 1TGSZ 1BA8B 1D3DB 4K1EA 1BMFD 2J34A 1WBGB 3ODDA 3H7TA 2Z9JA 3TPIZ 2A7HA 2YMSD 3O8BA 2EI7A 4K1TA 2J4IA 4ABEA 3DSOA 2V3OH 3RXQA 5J4SA 3M37A 1WDIA 3TK6A 4JZEH 4OEOA 1V2KT 2SGAA 3LONA 4WVPE 4ABFA 3STIA 4GHNA 5FHTA 2O8TA 1IQFA 1C4V2 5DTHA 1VCWA 2BD9A 4CBNA 1K22H 2F83A 2PKSC 3OFND 3A82A 2KYLA 2DUCA 2FPZA 2BXTH 3CENA 1U37A 2KG2A 1DUAA 2HRVA 1C1WH 1BRBE 3ATWA 1S0RA 4IC6A 1J14A 4FU7A 3SJ8A 2KCAA 1LTOA 1NM6A 1O3PB 1GCDA 1C5QA 2M2AA 1CA8B 1GBHA 4F55A 2P59A 4AORA 2ZU5A 1HUTH 4ZKRU 4E7RG 3SZNA 4ACBA 2H9TH 2W3IA 3TK5A 3I1EA 2QF0A 1GBIA 4RKJB 1UTJA 2VBCA 5EIYA 3AAUA 3RC4A 5G4BA 1OWJA 4GSOA 2Q9VA 4Z6AH 1ZPCA 1C2FA 4CREA 1XXFA 4Y11E 1CHOF 2G81E 1Q3OA 3ATMA 4YM9A 3W1EA 1YBWA 1HAXB 4INHA 1GGDB 1VA8A 1O3BA 2BOHB 5A8XA 1EP5A 3QO6A 1Z8RA 3U8TH 3LGUA 4KFWA 2BDBA 2ENOA 5H4IB 4L8NA 1S5SA 1ELTA 3QZRA 4TWYA 1D6RA 1A4WH 3BTFE 4X6MA 3UNRA 3A88A 3PM3A 1UM7A 1OBYA 1TE0A 1UTQA 3KHVA 2FEQH 3LNXA 3UAIC 2EGKA 3UWJH 2JH5D 1LHFH 1KMHB 1GJCB 3KN2A 1HRTH 1A61H 2PKUA 1FI8A 2XBWA 5F8TA 1N7TA 1OSSA 1LPKB 4DT7B 2LA8A 1CT0E 1WJLA 4J2YB 1FX0B 2J5UA 1S6HA 2SGEE 1LCYA 1TABE 4NMQA 1WTGH 1XUFA 3Q00A 2OINA 4X8SH 3RXLA 1V6DA 5JYIA 1C5MD 2VVUA 3V0XA 1AB9C 2GZ7A 1V2RT 3F2FA 4Q7YA 3QTOH 3QK1A 2GCTC 1MH0A 1XX9A 1MQ5A 1UMAH 3ELAH 1AI8H 4NMVA 3FANA 2QT5A 2BLVA 1DPOA 1FY3A 1B0FA 1SQTA 2ZI2H 4A1VA 3O8CA 4NMOA 1TMTH 2ZF0H 2VWRA 1EQ9A 2K1QA 1H9HE 5E0JA 5FCRA 4A7IB 4OEPA 2J94A 1ZMLA 1A2CH 1SGPE 2F43B 1KSNA 3RXTA 1N99A 4NXRA 4E05H 2XTTB 3PMJA 1KYNA 2QYIA 4JZ1A 4O06A 1P02A 1OYTH 1S83A 8ESTE 4YOGA 1KXEA 3HATH 2KPKA 3NGHA 1C5UA 1RZXA 2VU8E 3LJJA 3MU0A 4I8KA 1RTFB 3Q77A 1FQ3A 3L4FD 3ATKA 4ISOA 1RRKA 2YMSB 3ZZ4A 3RXEA 3TJOA 4K2YA 2QG1A 3LKWA 3H7OA 7LPRA 1K1LA 1ZPZA 5A8YA 4WYUA 2B8OH 1GWAA 4WMEA 1MTVA 5GDSH 2D92A 5HFFA 1GGDC 2J2UA 1MZAA 3LDXH 3ZZ6A 1P9SA 3ZZ7A 3M5LA 2RRMA 2FS8A 1C5NH 4X6NA 1ABIH 2V3MA 3CYYA 4I7YH 3PDZA 4E06H 1TRMA 1GBBA 4O3UA 4P00A 4XDEA 1MU6B 3KDGA 1HNEE 2K1ZA 1ANBA 3GY7A 1PPBH 3QGLA 1W11U 1C5LH 1F7ZA 1O3GA 4FUFA 1MFLA 1V2WT 2A1DB 4NCYA 1TOCB 4MLFB 1QBOA 1SLVB 1ZHPA 3SU0A 1SSXA 4XOJA 1DITH 2XOKD 4D76A 4B2AA 1FN6A 1UHBB 3SNEA 2Q6DA 3NFLA 1ZZZA 2BQWB 2ZTXA 3NCLA 1DWEH 1TB6H 2L74A 3FFGA 3M3TA 4ZH8A 2G55A 1SGTA 1B5GH 1GI4A 2XCFA 4MPWA 5G1DA 3ZZ3A 1QB1A 1ARCA 2ULLA 5E0HA 1DY9A 3F6UH 3BF6H 1IQMA 3L33A 3RXVA 3NRLA 5A0BA 2O9QA 3WWBA 1DT2A 1ID5H 1KY9A 3MU5A 1WQVH 3D49H 4TYDA 4LZ1H 1C1SA 1YPHE 3MFJA 3HK6B 2Q3GA 1YCPH 2R0LA 3LU9B 1OXGA 1QHRB 1S85A 3MNCA 1VITG 4JK6A 1D9IA 5I25A 4DT4A 1G3BA 1NPMA 2YTWA 3EGGC 4JJ3A 1FUJA 2BZ6H 2TGTA 3SJIA 1UITA 3F9HA 5CMXH 1FN8A 1VJ9U 2BVRH 5GCHF 2HE2A 3TIUA 5C17A 5HGGA 2EY4C 9LPRA 3SU5A 1UCYH 1O0DH 1XXDA 4AOQA 3IITA 1DWDH 1FIWA 4H6TA 5FX6A 4AMHA 3K6ZA 2GGVB 5HEYA 1SGEE 1G32B 2GV7A 2VWMA 1A5IA 1GI9B 2V0BA 1HLTH 1O39A 3SZEA 4HI3A 2Y7XA 1MKXK 2BY7X 3SV7A 1K32A 2Z6BD 4Z8JA 1Y5UT 1XUJA 1O3FA 4UU6A 3S69A 2XWAA 4U01A 1BJUA 3BG4C 5EXNA 2GKVE 2H9HA 2FE5A 1T2MA 2PR3A 1F5RA 2OC7A 1HDTH 1GJDB 1GPZA 5E8EH 1Z86A 2QBWA 3SOEA 4MPAA 4Y8XA 4NXQA 4AZ2B 2A4GA 2XYAA 5IDKA 4UEHH 3QDOA 3D65E 3T29A 3UWIA 1PQ8A 2L6OA 3RXDA 1T8LA 4O9VA 2OBQA 4D9RA 2HNTE 3VEQB 2AIPA 2FODA 2STAE 4Z1MD 1CO7E 4PQWA 1KXDA 1MAYA 2KL1A 1AD8H 2H3MA 1V62A 3BEIB 3BV9B 4DJZB 1K1OA 4K60A 2CSSA 1GI2A 1IQJA 4MG3A 5FL7D 3WW7A 2GCHG 5E6PB 3WY8A 3A8AA 3ATLA 3OSYA 2BD8A 3S0NA 2JIZD 1AMHA 3F9FA 5FPTA 1T4UH 2VIVA 3ID1A 4XBDA 3VXEH 2GV6A 1SOTA 5E1YA 1C1VH 1QCPA 1QAUA 2W7SA 3E1XB 3SBKA 4LOYH 4NSVA 1QA7A 2A45B 1ZTKA 4HGCA 4NZQA 1E36B 3AK5A 4RT1A 1O5EH 2OTVA 4UD9H 3RXAA 1BBRK 2REYA 3V7TA 1V2LT 1IQNA 3DFLA 4J1YA 1O3CA 3HGPA 3SOSA 3T25A 4CRGA 1W8BH 3MMGA 1O2NA 3P17H 4BAMB 1Z7KA 1IQIA 2PTCE 1SBWA 1D4PB 5HFEA 3K50A 2KRGA 2H1UA 2Z9LA 2KQFA 1GHVH 3TSZA 2K8IA 5EODA 2QA9E 1BRAA 3K6YA 1Y7NA 2G4UA 3TU7H 3RXFA 3T5FH 2L4TA 3BTHE 2JINA 1QJ1B 5C0UA 4WJG2 5EJ1A 2BD7A 2VINA 3TH3H 3UOPA 2DJTA 1C5VA 4R2ZA 1GJ7B 2EI6A 2AWXA 3EA7A 1C1MA 1F0UA 4AC9A 1GJ4H 2QY0B 2I1NA 1ELBA 1K9OE 2Z9KA 1GI1A 3M3SA 2GZVA 1HFDA 5L6NH 2WV9A 2W7UA 3EDXB 4ABJA 1O2QA 3MU1A 1NRNH 3M7TA 1XZ9A 2ZHFH 3UQOA 1UK4A 1VGCB 2P3UB 3ZZ8A 4AG2A 3OE7D 2HPQH 1O2YA 2A4RA 1NRRH 3MTYA 1O2XA 1J17T 3KZDA 3TJVA 1D3PB 1F0RA 3SJKA 4SGAE 1UJDA 2VZ5A 1PPCE 3GCHB 3HPKA 3KDKA 3R69A 1EPTC 1P1DA 2FTMA 1IQEA 2VGCC 5AVDA 3SV6A 2V7QD 5DPAA 1AN1E 1A46H 3N7OA 1WFGA 3RXJA 3VXFH 3SJ9A 2YNAA 4Q6SA 1WH1A 3MU4A 1W3CA 1B7XB 1VB7A 1HJAB 4NFEA 3SQHE 2R9PA 2I0LA 1QQUA 1C4U2 5E0GA 3NCVA 1YY3A 1DDJA 2GT7A 4ISLA 1ZMJA 1N6XA 3ZV8A 4Q7XA 1FPHH 3FO8D 3DFJA 3QDZB 1MKXH 1YF4A 1GBAA 1T8NA 1KTTB 3UOUA 5JBBS 1WHDA 1PQAA 1G3EA 1UTNA 4RN6A 3QX5H 1UTKA 3TITA 4NXPA 1E34B 2CF9H 4WH8A 1JRTA 2TBSA 2V1WA 4P02A 1NFUA 4JORA 1UCYK 2H5DA 2VWNA 1GJ9B 4Y71A 1GJ8B 2OQSA 4XHVA 2ZGJA 3M5MA 2F91A 3SHCH 1LPGB 3Q3KA 4Q2OA 1AVXA 1ZHRA 3PWBA 3RMNH 1A5GH 3ZVFA 5EJZA 3TVJB 1BTHH 2M0ZA 4IN1A 1X5NA 5JBCS 5A2PA 5KGOA 1JOUB 1W0KD 1EZSC 2E7KA 1O2WA 3O8RA 1FV9A 4GCHF 2BDIA 2GZ8A 4ZHMU 1ZTJA 5FX5A 5F6MA 2AGIX 2ZFPH 5GXPA 2FP7B 1TQ0B 2BYAX 1X45A 1QFKH 3T2NA 2BZAA 2KZ4A 3FZDA 3GY4A 1TMUH 3SUDA 1SGIB 5GNDA 6CHAB 3LH3A 2QN5T 3CP7A 5DK1A 1HIAA 5HMAA 1X6DA 3LGIA 3RU4E 1YPKH 3HGNA 2DC2A 1O5FH 2HPPH 1IQGA 4ZMAH 3M61U 4Y0YE 1TAWA 2QAAA 4IGDA 1CBWC 1RIWB 3F0OA 1CA0B 2FYQA 3UTUH 3CC0A 4CBOA 3NWUA 2WV5A 2M0UA 2HNTF 1THRH 3RDZA 1T4VH 2XNDD 3QJMA 4ZCNA 1WI2A 3GDUA 5E22A 5DP7A 5A2MH 1UK3A 4NSYA 3L6PA 1ZJDA 1GG6B 2IWQA 1SLUB 1W9OA 3QZQA 2TPIZ 4Y8ZA 1W0JD 2M10A 2ZDKA 1GHAG 3EE7A 4Q6HA 3SU1A 1CGHA 2ASUB 1E37B 3TLOA 1MCVA 4Q2QA 4M9FA 1TGTA 3LPRA 4YLQH 2D1JA 1GHXH 3G01A 3NKKA 5LPFA 1C1RA 3A8BA 3JZ2B 5ABWA 5HIYA 3RXMA 3VB3A 5FCKA 3PTBA 2JETC 4X1NU 4YT6H 1C1TA 1FC7A 2KCOA 3TH2H 3V13A 4ACAA 1L0ZA 4FUIA 4UU5A 2UUFB 1V2NT 1YYY1 2SNWA 1DICA 1P0SH 3GYLB 2A5AA 3TGIE 1IQHA 1O2TA 1EZQA 1Z1JA 3OTPA 2KCYA 2JJ2D 1C2KA 2NU4E 4ABDA 5LPRA 3GCTF 1FCFA 3S7HB 3PMHB 2OGPA 3FN8A 3SV2H 1O3KA 4JOHA 5JPMH 1HGTH 1SMFE 3RLEA 2G5VA 3E16B 4ABIA 1O3EA 2OK5A 3DHKH 4XBBA 3GDSA 2PGQB 2KOMA 1AZ8A 1WUNH 2Q6FA 2BXUH 1FY5A 2ZFFH 3LGTA 4B1TA 1Y3UA 1PYTD 1AKSB 1GI6A 1NFWA 3VB5A 1S6LA 4YZUA 2ZTYA 3SGBE 1N8OB 3GY5A 5I46H 3RXIA 1PPGE 1DS2E 2OQ5A 3OY6U 2DM8A 3ATIA 4NWLA 2WL7A 5E2OA 4X2YA 2O8MA 3GCHC 2HALA 1N8OC 4X2WA 1SFQB 1FC6A 1BBRE 3E6PH 1DSUA 4NIXA 2K20A 4K3JA 5GPIB 1CA0C 2STBE 1RGWA 1HYLA 4HFPB 3EGHC 2XW9A 3PLKA 4WWYA 3W94A 5A09A 3O8DA 1BRUP 4KELA 3AAVA 2O8WA 1L4ZA 1GDUA 2OZFA 2LUIA 1CU1A 1BQYA 1X8SA 2RDEA 2FZZA 3A83A 4BAQB 1C4Y2 1HAOH 1C1OA 3RP2A 1DUEA 2PKTA 4LMMA 1O2RA 3NFKA 1V2VT 1P2MA 2F9NA 2KR7A 4E3BA 1FDPA 3HVQC 1OWIA 4OS2A 2J92A 7ESTE 2R2WU 2P3WA 4FUCA 3B23B 3U8OH 4XD7D 1HB0B 2JJ1D 3VB6A 1C5SA 2RA0A 4CHAB 3K65B 1QL9A 5LGOA 2RG3A 5BPEA 1P2QA 5A0CA 3A85A 1GHBF 1E79D 4KTUA 1UVPA 1EZUC 4UFFH 1BDAA 3I77A 2Y5HA 4I33A 1Y3YA 1ACBE 3HK3B 3SFJA 1JMOH 1UHPA 1UVSH 1MBQA 1HV7A 1MBMA 3HKIB 4NFFA 1UTPA 4CRFA 1C2GA 3RXGA 1PDRA 3DA9B 2J97A 3KQBA 4MTBA 2ZHWH 4UFEH 2BDGA 3NXPA 4NG9H 2VIPA 2ALPA 2G4TA 2UUYA 2MX6A 1JIMA 2C93B 2CMYA 3PV4A 5JXBA 1TBZH 4FUEA 4WXIA 1YGCH 3PWCA 2ZIQH 1V2JT 2P16A 3ITIA 5EXLA 1SC8U 4I86A 1P10A 1ZLRA 1FJSA 1C1QA 2ZCKP 4DVAU 3BTEE 1AWHB 2BX3A 3UR6A 1P3EA 2NU2E 2OCVB 1IQKA 2W5EA 5CHBA 3ZVCA 2FIRH 1Q2WA 3ZVDA 1DOJA 4MNYA 4X8VH 1JWTA 2ZFQH 1S6FA 2I6QA 1NU9A 4SGBE 5HIZA 3E17A 3HPMA 4UFGH 2I04A 3UREA 2KJDA 5TCCA 2WPJS 1S84A 4CH2B 1P06A 1GG6C 1MAXA 3QGJA 1O2OA 1O2IA 2Z3EA 3GSLA 4DIIH 1NROH 5F03A 1JRSA 3VPKA 2Z17A 4Z33A 1MU8B 1G2MA 1KXCA 1OWKA 1SGFG 5GIBA 3MH7A 1EFRD 3U1IB 4E35A 1ANEA 3GICB 1P1EA 3ID3A 4INKA 1TPSA 4OS1A 1IHSH 1CHGA 3MH6A 3MHWU 1C9TA 1LVMA 1YLNA 1QR3E 1PQ5A 5HJ1A 2VSVA 1D5GA 1DVAH 3CS7A 1UEWA 3VFEA 3OX7U 2BD3A 1BMLA 4AFQA 4NMRA 1HAPH 2TRMA 1SHHB 1TP5A 1X7AC 2F9PA 2G00A 1AIXH 2BX4A 2PP6A 4YXWD 3PLBA 3RL8A 2QKUA 3ID2A 3OU0A 2CF8H 3N7DA 5C94A 1UHBA 1UJVA 4ABAA 2VJ1A 3FP6E 3LT3A 1HCGA 1GJAB 2QE7D 2Y6TA 1DANH 3I29A 4G69A 3SNCA 3U98H 3BPUA 1BT7A 2PDZA 2SGPE 2EDVA 3K1RA 2KAWA 1EXFA 2W6JD 3EQ0H 4NA8A 2BB4A 2IPHA 1ZMNA 3GY2A 3ZZCA 1AGJA 2AERH 2BY6X 1O3JA 4K8BA 1HAHH 3TSVA 1G30B 8GCHG 4HTCH 3SUFA 1FNIA 5EG4A 3ENSB 3RXSA 2DKRA 3RXKA 1PPHE 2JSNA 5HFDA 1F92A 1WV7H 1MUEB 1T8MA 1XVMA 1QRZA 1SGFA 1HJ9A 2Z94A 3LC3A 3EE0B 1FMGA 1GMHF 1RJXB 1SVPA
chains in the Genus database with same CATH topology
1IAUA 2KBSA 2M0TA 1M9UA 1Y3WA 4AGJA 1J16A 3TMHA 2QXIA 3BN9A 7GCHF 3GYMA 1Q31A 2EI8A 1AE8H 4VGCB 4FU8A 1N6EA 2OC8A 4GHQA 1HXEH 5EW2H 3URDA 1Z6JH 2DB5A 5HM9A 2NU0E 1XUGA 3F9EA 1TGCA 1XMNB 1FY1A 4CHAC 1SG8B 2NWNA 2V90A 3KHFA 4OAJA 1V6BA 2A5IA 3BTGE 3RU4T 2SGFE 3TSWA 1ANCA 2GCHF 1OPHB 5HYOA 1TOMH 1ZSLA 1EOJA 3DIWA 3NK8A 2JH0D 5HM2A 1D6WA 2FMJA 2JOAA 1PFXC 1GHWH 4REYA 1W7GH 3A81A 5LH8A 8LPRA 4P2AB 1H8DH 2OCSA 1TONA 1VITF 2OC1A 5K0HA 1ELGA 5F8ZA 4YLUA 1ORFA 3P8NA 1Q3PA 1NT1A 1XKAC 1EP6A 3SUEA 4AX9H 3M7QA 3E8LA 4ZXYH 1MC7A 2XBVA 4B76A 1TBQH 2FOGA 3PO1C 1BRCE 5FPSA 2A7JA 1RIWC 1GHBG 1T7CA 4ZKOU 1NO9H 5C67A 3RMMH 1QB9A 4FUDA 2BDAA 1K28D 1E38B 1C9PA 3T26A 2Y82A 6GCHG 3EGKH 4BNRA 2PWXA 1K2I1 5HEDA 6LPRA 3KGPA 3FZZA 1PPEE 2WPLS 3MNXA 3LGWA 2PKAA 2FI5E 4K76A 4IBLH 4FUHA 2TGPZ 3A7YA 2QXHA 4FLNA 4H42U 5EQSA 1O2VA 4ZHLU 2AFQB 3FVFB 4DIHH 2W4FA 1L1NA 3P8GA 2LC7A 1HAYB 2DLUA 2IN2A 2ZCHP 1NY22 2CHAB 1J9CH 1Y3VA 4BTTB 5C5OA 3RLWH 2FNEA 4RI0A 3TK9A 1C5XB 3Q3XA 2EHRA 3FP8E 4MNVA 3ZVEA 2TGAA 1ZUBA 3DORA 2VRFA 4F49A 2YNBA 1NC6A 1CSOE 4I8GA 2LC6A 1OP2A 4X0WU 3PV2A 1GVLA 1F5KU 1YM0A 3W95A 1EPTB 1IHJA 4I8HA 3ZZBA 1YPJH 2FOBA 5AFYH 1MD7A 4Y6DA 3A80A 2FOEA 4H6SB 4K78A 1MTUA 4FUJA 2QXGA 4OS4A 3H5CB 4TWWA 2JIKA 3TGJE 2R0KA 3RXBA 2IOTA 3SHUA 1UEPA 4WXVA 1O5AB 1UTMA 4IW4E 1TNIA 2A32A 3T62A 1WI4A 3B9FH 1Z71A 5DP8A 3FY5A 3P8OA 3PB1E 1GQ4A 2PNTA 1GMCG 1SI5H 1CQQA 2BOKA 3K2UA 2PGBB 1O34A 1A5HA 2CN0H 4K8YA 2ZFRH 3MI4A 4JYVH 4CR5A 2AWWA 4KKDA 2ILNA 2ZZUH 1EKBB 1EAIA 2G2LA 3SU2A 4UONA 3R68A 1AO5A 4UDWH 5T6FA 3ZRTA 2ZGBH 1G2LA 2TGDA 3KQCA 3LGVA 4H4FA 2ZPQA 2ZU2A 2CJIA 4Y79A 5FBIA 2ODPA 2WUCA 3MO6A 5L2YH 2DAZA 3RXUA 2BDHA 3RXOA 1N6FA 1TA2A 1AFQC 2CGAA 1SLWB 2TIOA 4GVUA 2B5TB 2Y5GA 3BTME 1O3DA 3SHWA 2UUJB 2EV8A 1EOLA 1AFQB 2ANMH 5F3XA 1GBMA 1GBFA 1O3LA 2QXJA 1Y5AT 3UFAA 1GJ5H 5EPNA 1IU0A 1OOKB 2VVVA 2RDLA 4FUBA 2VWOA 4Y7BA 1O2JA 4OS7A 1YLCA 2C8ZB 2GT8A 1RY4A 2THFB 5FBEA 4HOPA 3QN7A 1Y5BT 4NMSA 1A0JA 2OC0A 2ZDNA 8KME2 1ELVA 4MPXA 1DE7H 1QURH 3QUMP 1O2LA 1NRQH 3AW0A 2YT7A 1K1IA 1X5QA 4KFVA 1YPMH 3QE1A 2FX4A 1TWXB