3OU0A

Re-refined 3cs0
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic serine endoprotease DegP
publication title Covalent Linkage of Distinct Substrate Degrons Controls Assembly and Disassembly of DegP Proteolytic Cages.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 82
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3ou0A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3ou0A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ou0A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ou0A01
2BOHB 3SV2H 3GY2A 1GBDA 1HIAB 2ULLA 4X1QU 4JOJA 1TFXA 1AN1E 1FNIA 4NG9H 2ZDMA 2I04A 1A7SA 3PLBA 2XCFA 4ABEA 4MPUA 1MBMA 3U8RH 1DWCH 4HFPB 2RCZA 1OWJA 1YPLH 1HPGA 2W7UA 1J14A 3H7TA 4HOPA 4KFVA 3UQOA 1QTFA 2VH0A 4MNXA 1O2NA 2ZU3A 3S69A 2VVUA 3ATKA 3GDVA 3K6ZA 1AB9C 1LHGH 1X45A 1TBQH 4ABFA 4NFEA 3SV7A 1ZMNA 1H9LB 2DMZA 3LC5A 4EDJA 4K6YA 4NA9H 1WF8A 3IITA 2RRMA 3NFKA 5D13A 1V2RT 1ZGIA 1FONA 2KAWA 1C1VH 1GJ6A 2AYWA 2GMTB 3BSQA 3OTJE 1EQ9A 3BTGE 3W95A 1TRYA 1SL3A 1VAEA 2ZHQH 2WPLS 1Q3PA 2AIPA 1FC6A 3MH7A 4GLYA 2ALVA 3V0XA 1BQYA 1V2PT 1AUJA 1UEPA 1YPHE 3P8NA 3UFAA 1FXYA 4WF8A 3PROA 3MOCA 1O2SA 4IMQA 1GBIA 2F9VA 4THNH 5AFYH 4F8KA 3UWJH 2FOCA 2FCFA 3KQCA 5PTPA 4PQWA 1TLDA 1S6FA 1V6DA 1Y59T 2ZTXA 3LGWA 5FHTA 1RGQA 2VPHA 2A2XH 3SQEE 4MPXA 2ZWLH 1IAUA 2ZDKA 4KFWA 5DP4A 2GD4B 1GCTC 2OGPA 2BY9X 4B71A 4M7GA 3S9CA 2FPZA 1F5RA 3ELAH 1UMAH 1HYLA 4E06H 1HFDA 3MO3A 4K69A 4B2BA 5JBAS 4JOGA 1P02A 2AEIH 2R3UA 2ZPSA 2H2CA 3FAOA 1BOQA 2AWUA 1EP5A 3A7YA 1MZDA 1IQGA 1BITA 1JBUH 2YNBA 3NK8A 7ESTE 3WKLA 2PLXA 3I29A 2ZNKH 1ZRKA 2CS5A 2FODA 3SV8A 2BDHA 2A5AA 1THPB 5DKMA 3GY5A 4X2XA 1AFQC 1GDUA 3BG4C 1EZXC 1PYTC 1YP9A 3SN8A 1FIWA 3FFGA 2OCVB 2F3CE 3U9AH 1GQ4A 1ESBA 3QZRA 2KA9A 3PTBA 1QL7A 2OD3B 1EKBB 2GGVB 2F0AA 2FWWA 3TNSA 2KPKA 1K2I1 1VGCB 2IWQA 4DY7B 5F3XA 4I8HA 3C1KA 3SU2A 1C5TA 3PMJA 2EV8A 4D9RA 3QZQA 4GCHG 2KJPA 1XVOA 1TB6H 1O3CA 1GJAB 5IDKA 1WH1A 4XBDA 2DE9A 4R2ZA 1TNLA 3KQDA 1BTYA 2M0ZA 1EASA 2H1UA 1YPMH 9ESTA 2QAAA 3P8OA 4AORA 2Q6GA 3UNSA 1ABJH 1GMHF 2WUBA 1ZR0A 2O8UA 2J2UA 3T26A 2ASUB 1DY8A 2QXIA 2VIQA 1L4DA 4FVDA 3RC6A 3VXEH 4E05H 1CE5A 4B2CA 2KPLA 1YC0A 3TH2H 7GCHG 3D49H 3MU4A 1SFIA 4FUEA 3N7OA 1G9OA 1FY5A 3RXUA 2FX4A 2GDEH 2G2LA 1HJAB 1MKWK 2BY7X 3HK6B 1OYTH 2UWLA 3PDVA 1C1NA 1JIMA 1XXFA 3ZZAA 1TNHA 4DGJA 3ZZCA 3GCNA 5FX5A 1TALA 3K82A 4JL7A 3RU4E 4Q3HA 2WPKS 4F4OC 3QLPH 1HAXB 1B8QA 2OQ5A 1LQEA 2OS6A 3UWIA 1P2MA 2GZ8A 2FTLE 1YPGH 3I18A 4FUCA 2REYA 4OS2A 4A1VA 1N6EA 3A88A 1V2QT 1WI2A 2JREA 4JORA 7GCHF 1O3PB 1Y5UT 1FUJA 1O5AB 2IWOA 1GHBF 1EOLA 3H7OA 1X8SA 1FI8A 1EAXA 1YPKH 2ZF0H 5HFDA 1C5YB 4I8GA 3SI4H 3P8GA 3TJNA 5A8YA 2BDGA 3LGVA 2O8MA 2DLUA 2JINA 5HXFA 2ZGJA 4X6OA 2BB4A 1C2KA 4FU7A 2BD4A 2GV7A 1X5NA 2ZTYA 2PDZA 1C5LH 1YBWA 1GJ9B 3RM0H 2ZP0H 3SHAH 1F0SA 3SU5A 4I33A 4TY7A 1SMFE 1TPPA 3DORA 3KCGH 3TH4H 3KHVA 1D3TB 5LPFA 1C5UA 1EJMA 4J1YA 3UREA 4D7GA 1ABIH 1FQ3A 1P2JA 1IQMA 4Y8XA 2ZHDA 1O2HA 1C4U2 5LPRA 4WYTA 2DM8A 9LPRA 1MH0A 3A83A 3O5NA 4FGMA 1YPEH 2KOHA 2Z7FE 2ENOA 1G3EA 1O37A 4CBNA 3ZV8A 3HKJB 4Q2NA 2EI8A 2KL1A 1FAXA 1BIOA 4JK6A 1GCDA 4SGAE 1QAVA 3SGQE 5E2PA 3RXKA 1ZSLA 2ZDVH 3DUXH 3FZZA 1THRH 1W3CA 1BMMH 3GCOA 2BX3A 1MTSA 3GOVB 4UONA 3MFJA 4NWLA 3TSVA 1VCWA 3CH8A 2PSYA 4ABIA 1SFQB 3BTHE 1LMWB 4GHTA 1DLKB 5A0CA 1Y7NA 2V0BA 2BDCA 5LGOA 3GISB 3M7QA 1QRWA 2GT7A 1UTLM 1AI8H 1O2TA 1G2MA 1D3QB 3S7HB 3STIA 1A5GH 3ZVEA 1A46H 3P95A 5FCRA 2NWNA 1C2EA 4Y6DA 1N1LA 3A87A 1JRTA 3UNQA 2P8OB 3M5OA 1HAZB 4ZKSU 1XKAC 4MPAA 1D6RA 1GVZA 1TIOA 2OXSA 1TNKA 1KEFA 1W13U 2H5CA 3SU1A 1XZ9A 1UK2A 2FEQH 3TGKE 1IU0A 2EAQA 3U8TH 4WMEA 1O3MA 1JIRA 2AIQA 2ZFFH 1N6DA 3I78A 3TVJB 2L4TA 1SOTA 4IN1A 2CSJA 3BTKE 4INKA 4YM9A 3P70B 2FMJA 4Y0YE 3AXAA 5EOKA 1UVUH 2VB0A 1V2LT 3KF2A 4CR9A 1W14U 1L1GA 1O5GH 2SGAA 3NGHA 2A0QB 2EGOA 4KTCA 2P3TB 5CMXH 1A4WH 1FPCH 3GY6A 3JZ2B 3ZZ6A 5DPAA 2PGQB 1TQ7B 2FO9A 2D8WA 2GMTC 1JMOH 5EPYA 4A6LA 1ZSKA 2YUBA 1BRAA 1SGQE 3RM2H 4IC5A 1C1TA 3PDZA 1D6WA 1ZHPA 2GZ9A 4DW2U 1K1PA 4AYYB 2EDZA 1R6JA 1GMCG 2QKTA 1IQJA 2B5TB 1CT4E 4GHQA 2TRMA 4NA8A 2FP7B 4H11A 5HM9A 2WV4A 1V2KT 2QKUA 3B23B 5E1YA 5C5OA 4Q2QA 1A5IA 1GDQA 2SNVA 3PV2A 3SV9A 1DS2E 3QJMA 6LPRA 1DXPA 1Z71A 3B9FH 1DUAA 5HFCA 1I92A 1GVKB 4OEOA 1V3XA 1SGCA 4D7FA 1NRNH 1GI4A 1O2MA 2KQFA 1QL8A 2PGBB 1Q7XA 1F5LA 1G32B 2BQWB 1O3DA 5HF1A 1C2MA 1EXFA 1V2ST 4NMSA 2A32A 5JBBS 3TMHA 1Y3UA 5L6NH 4ZAEA 1GJ8B 1GMCF 1UTOA 1WQVH 2Y80A 3LH1A 1UTNA 2ALPA 2VJ1A 4XBBA 1AU8A 5A2PA 5DP3A 3A7ZA 2W26A 1NM6A 4B75A 1MTVA 1O3EA 1GBHA 1LQDB 1RTFB 1ZPZA 7LPRA 4RKJB 1CBWB 1O5FH 2G4UA 2VSPA 1F2SE 1ZTKA 4K8YA 5C5NA 6GCHG 4NWKA 4OGXA 2XBXA 1C2IA 1DM4B 2BOKA 2Y6TA 4KTUA 3ZVGA 3A86A 1BMAA 1YPJH 3I77A 3LGIA 3VFEA 1SGDE 2PKSB 3GY3A 1C9PA 3M7UA 1HJ9A 3KL6A 3TITA 1F7ZA 1J8AA 2H2ZA 1VGCC 3OX7U 1NS3A 4ZMAH 1RY4A 5J4SA 1UO6A 3TJUA 1HAOH 4YOGA 3Q00A 4AMHA 2KOJA 1C2FA 3PTNA 2D26C 4XOJA 3CS7A 5LH8A 2LC7A 3VQFA 2YOLA 2G55A 1BJUA 1UVPA 3FZDA 2FI4E 5CE1A 6CHAB 2I4SA 3DJ1A 1SHHB 1SPJA 4Y71A 3SJIA 1B7XB 1KDQA 1QNJA 6GCHF 2FDAA 2R4HA 5JYIA 5K0HA 2ANYA 2Z9GA 3GICB 1T8NA 5L2ZH 2DKRA 4HI3A 1NRPH 3F9FA 4X2YA 2VIPA 1EPTB 3CS0A 2PTCE 4NZQA 3Q3YA 3R0HA 1LVYA 3S0NA 2I1NA 4JOPA 1P2QA 1QJ7B 3TJOA 4MPVA 1MKXK 2QCYA 5I46H 5EW2H 5I7ZA 1UK4A 3QUMP 1BHXF 2FS8A 1AO5A 1G36A 2R9PA 5DP7A 3ID2A 4D8NA 4Y7AA 1WV7H 3SHCH 1GBBA 1O32A 2ZTZA 3MU8A 4ZUHA 1HJAC 1FV9A 3BIVH 4HZHA 4CH2B 5H4IB 2BDYA 3JZ1B 2I6VA 4Q2OA 1H8IH 1O0DH 2SGEE 2Z94A 1ZUBA 2ZPLA 4X8TH 2KAIA 5TCCA 3V3MA 1OZIA 1GJCB 1P3CA 4GAWA 1MU6B 1PJPA 3LIWA 3SOSA 3RMMH 2L97A 4NNMA 2JWEA 3MNBA 1HCGA 3GGEA 3E0PB 1KLJH 4JCNA 2ZO3H 1PFXC 3A84A 1T32A 3O8BA 2A7HA 4I8JA 4ZROA 2FX6A 8GCHG 2G00A 4XSKU 2VSVA 3RXBA 4X8UH 3SJKA 3RXIA 3L3TA 5FX6A 1GVLA 2OBQA 1NPMA 3SJOA 1CGIE 1N7EA 2JILA 1K1LA 3AW1A 5HEDA 2UUKB 1OWKA 5H3JA 1ZPBA 2BY6X 5HEBA 1DPOA 2A7CA 3DJAA 3SNBA 5EGMA 1TA2A 3LOXA 1IQFA 1FY3A 4ABJA 2W5EA 4JOEA 1QAUA 1ZMLA 3ATLA 3LGTA 4OEPA 4Y76A 2FE5A 3MNSA 3VPKA 5GPIB 3F9GA 2XC4A 3GDUA 2H9EH 3S9AA 1ZHMA 2ZFRH 1V2NT 3E17A 3A85A 2YUYA 3G01A 1AGJA 1BMNH 1AVXA 3EGGC 4JYUH 4DIIH 1HAHH 1O2VA 2GKVE 3OSYA 4AOQA 1D9IA 1SGFG 1LVMA 3ZVCA 1TABE 1WI4A 4IGDA 2GX4A 1O2WA 1Z8GA 3RXVA 2TBSA 4RI0A 2BM2A 3QTVH 2P3FH 4JZ1A 1ELEE 1RIWC 1E0FD 1C1QA 1C5OH 1O5DH 1J9CH 2PSXA 4Q6SA 3RL8A 3SFJA 1DUEA 2O8TA 2EI7A 2WPMS 3NUMA 1UHBA 2HVXA 3EGHC 3SJ9A 1EAUA 1DDJA 3ZVAA 2DJTA 2KV8A 1NRQH 3QDOA 5HF4A 1V2TT 3ZZ9A 2AFQB 3M3SA 1C4V2 5FCKA 5AF9H 4UU5A 1O3JA 3ODFA 4ISNA 4UFGH 4O97A 2UWOA 4WY3A 3URDA 1C2LA 1N8OB 2M0UA 1C5XB 4WMFA 1SGYE 2CGAA 5G1EA 2P8OC 4LZ1H 1TNGA 3ID1A 1EUFA 2CN0H 2C8YB 4U01A 4BTIB 1DOJA 1LDTT 2HGTH 1WJLA 3LGYA 3VB3A 2B9LA 1C5NH 2ZGBH 2C3SA 2LNCA 2O8LA 1ELDE 5GCHG 3U98H 1NZQH 4AB9A 2Z17A 3ZVDA 4R8TB 3MTYA 1V2VT 1P8VC 2CMYA 1DSUA 2UUJB 4MPWA 3CENA 4AGJA 2AH4X 1ELVA 1DICA 4RN6A 3U8OH 1UTPA 2VH6A 1TRNA 3PMBB 3ZV9A 2XYAA 1D3PB 4K3JA 4WMDA 1INCA 4ZXXH 5T6DA 3E1XB 2KBSA 1K21H 1IQEA 3TSZA 3F68H 1A0JA 1ZTJA 1QBVH 1TAWA 4P2AB 4NA7A 1BJVA 1OP2A 4K72A 2P93A 5BRRE 1S81A 1D5GA 5GCHF 1C5VA 1P9UA 4MNYA 1K9OE 3GCHB 1LVBA 1SGTA 2FNEA 2GT8A 3V7TA 4P0CA 2P16A 5HFFA 1ZJKA 3ZZ8A 1TPSA 3EA7A 4E3BA 2VU8E 3T5FH 1HAYB 1W7XH 1ETSH 2OINA 1ARBA 1N7FA 1O31A 1GI7B 3ATWA 2XCNA 5HMAA 5ABWA 1K1MA 4UDWH 3QJNA 2FS9A 2F9PA 3HKIB 1KYNA 3BTEE 4INLA 4CR5A 1TWXB 5A0AE 1AWFH 2BQ6B 3BV9B 1QBOA 1XMNB 3SNEA 1LO6A 2A5KA 2VRFA 2J9NA 4BAQB 1ELCA 4IMZA 1IHTH 2VGCB 4X2VA 2J94A 1K32A 2EEGA 3KEEA 1AQ7A 1AVGH 3Q77A 2G52A 3LT3A 1F0RA 2EI6A 2BDIA 2HNTF 2Q6DA 4Y79A 5A8XA 1H9IE 1CGHA 2WUCA 1O2LA 2Y5HA 1FC9A 1L2EA 3HATH 2D92A 2SGDE 1BTUA 3OY5U 3O8RA 2GCHG 2P59A 3SOEA 2FIRH 3S7KB 3RXRA 4JYVH 3U1JB 2C4FH 2K20A 5C3NA 2MHOA 2R2WU 3AASA 2Y5GA 2H9TH 3LC3A 2FZZA 3PWBA 4ISHH 2DLSA 3D65E 1H1BA 5C1YA 3PO1B 4FUDA 1LVOA 3VB4A 1BTXA 1SLXB 5A0BA 1GQ5A 2OSGA 6CHAC 3TGJE 2VWLA 5DTHA 1UTMA 3LKWA 5EYZA 3MYWA 3UQVA 1SQTA 2BVXH 3MNCA 1AHTH 1EJAA 2SNWA 3CBYA 2WYGA 1C1RA 4BAKB 1D3DB 4WJG2 2DE8A 3P17H 1K1NA 2FOEA 1GHVH 4K1EA 2GCHF 3EQ0H 3EA9A 1P2KA 3NFLA 3SO3A 1V62A 3A7XA 1C5SA 2OTVA 1WF7A 3UUZA 4OS6A 4D9QA 1QB1A 2A7JA 2HRVA 2J95A 2BLVA 2A2QH 1TP3A 4REYA 1UEWA 1O2PA 5E21A 5A09A 5DO4H 2FI3E 2FOAA 2GVFA 4MQAA 5C1XA 1IU2A 4WH8A 1DFPA 1FJSA 1A2CH 3KQEA 3M3TA 3PB1E 5DJ7A 1V6BA 4GCHF 4NCYA 3TK6A 1EAWA 1IQLA 1O2XA 2KOMA 1XUGA 1FCFA 2P3WA 3GDSA 1EATA 1OWIA 1WYKA 8LPRA 1GI6A 1PPCE 1EZSC 2XTTB 3PMHB 1S0QA 3SV6A 4CHAB 1ELTA 2G5NA 2QC2A 3RU4T 1S84A 2A4QA 3NXPA 1KTSB 4XFQA 2RCEA 4CRBA 2M5TA 2ZDNA 2QBWA 1LHDH 1HAPH 1O39A 1B5GH 1P2OA 1SQAA 2ZFPH 1P04A 2EC9H 1GGDC 1SGRE 2W7RA 2PUXB 1A5HA 3DD2H 3T29A 3F9HA 1NTEA 1N7TA 3WKMA 1GHXH 1P2NA 3R69A 4ABDA 2C8WB 3ZVFA 2PFEA 3GSLA 1FDPA 1NY22 5HM2A 1CHOG 1CA0B 4X6NA 3RC5A 2DC2A 1EOJA 1BA8B 3CC0A 1W9OA 5B6LA 5E8EH 1V2MT 3V13A 3P92A 1P01A 1N6YA 1QHRB 5A2MH 5EQQA 2OC7A 3UR9A 2M0VA 2P3UB 3M35A 1UJDA 1MCTA 2WPIS 2FOBA 3PYHA 3RXPA 1GBFA 5FBIA 2Z3DA 1SHYA 2OLGA 2G51A 3BTDE 2C8ZB 3K6YA 3LNYA 1DVAH 4K1TA 1H9HE 1MKXH 2OUAA 1FY8E 1CHOF 2H6MA 2XBYA 1TQ3A 3BEUA 4LXBH 3OU0A 2Y5FA 3RDZA 5L2YH 2ZCHP 3RLWH 2QF3A 4A92A 1K1JA 1HGTH 4FU8A 2PTNA 4NIYA 4GUXA 4SGBE 3KNXA 3SU6A 1DXWA 1RTLA 5AHGH 1GBJA 1TOCB 3CP7A 4XDEA 2TGAA 2FTMA 2Q6FA 2XXLA 4BNRA 4FUGA 3V12A 3ZZ7A 1O3IA 1Z1JA 3T25A 3DFJA 1BBRE 1X7AC 3RXHA 1Z1IA 3RC4A 3ZZDA 1T2MA 1C2JA 1ANCA 5ESTE 1SI5H 4YOIA 5DGJA 1BTZA 1UFXA 2RDLA 3LJOA 1YKTA 3UTUH 3SHUA 2EEKA 4Y10E 4KGAA 2GTBA 2ZC9H 2PNTA 1G37A 1GI5A 1O33A 1PPZA 2QT5A 2ZU5A 3K9XB 4E7NA 3CBXA 3GYLB 2ZGHA 3PV4A 1ZYOA 4NFFA 2PZDA 1GBMA 1O34A 1S85A 4GVDA 2RA3A 1DSTA 1V1TA 1C2HA 1TMTH 1NRRH 4J2YB 1QA7A 1BUIA 5TJXA 1GBAA 3PLPA 1A0LA 3URCA 1NC6A 3SU0A 1YLDA 1BTWA 1NU9A 4K1SA 3SNCA 1GM1A 3GJ9A 2ZIQH 1J15A 3SUEA 3Q3XA 1VCQA 2VZ5A 3UNRA 1WAYB 2PR3A 4FUJA 1U3BA 2SGFE 3QWCH 2NU3E 2VWOA 3FP6E 1EZUC 2OCSA 3SBKA 1P12E 2UZCA 2QN5T 2F9NA 4DVAU 2A1DB 1AE8H 3A8BA 2PKAA 4B1TA 1Q31A 1O2KA 1RZXA 1GPZA 1TGSZ 1ACBE 1LTOA 3L6PA 3RUOA 2EEIA 4Y11E 1WTGH 3STJA 3TLOA 2R3YA 5DP5A 2R0LA 1X5RA 5F03A 2IWPA 2QYIA 2FLBH 1O3OA 5IYTA 2OC0A 2QF0A 1TX6A 3UY9A 3BN9A 1HAIH 2A4RA 5GXPA 5GIBA 3GCHC 3AAVA 1DX5M 3SI3H 2HNTC 1ELGA 2QXJA 5JB9S 2OC1A 3NKKA 1Z86A 1HAVB 3O46A 4JOFA 1G9IE 1W7GH 4LMMA 2V3HH 5F8TA 3ZZBA 1DWEH 1BRUP 1Z8IB 2LC6A 5FXLA 2O8WA 1VITH 2ZHWH 5EW1H 3GY4A 3HVQC 4INHA 1DITH 4ABHA 5HFBA 2B8OH 5L30H 3RMNH 4NIWA 2BTCE 2HE2A 4H4FA 1KLTA 3SUDA 2W3KA 4X8VH 2FESH 2JH5D 1NESE 1Y5BT 1E35B 2P95A 2VGCC 2Q3GA 4JZIA 1QBNA 2M3MA 3BPUA 2OQSA 3ATMA 4O9VA 1SLVB 1DWBH 3R3GB 4IN2A 1S5SA 2WPHS 3RXTA 1M9UA 2XWBI 1S6HA 2NU4E 4CRDA 1T31A 4FVBA 3OY6U 2AMQA 1JWTA 1PPFE 1P0SH 3ZZ3A 3SW2B 1ZLRA 1KTTB 2BLWA 5HEYA 3RXGA 2JOAA 3RU4D 1BMLA 4MNVA 1FN8A 1BZXE 2VINA 4A7IB 1WFGA 3Q76A 2HPPH 1P10A 1THSH 2X7ZA 3BTTE 2XBVA 3TK5A 2BLOA 2SGPE 4DJZB 4R0IA 2H3MA 1O3GA 5ETXA 1XM1A 2VIWA 1ELFA 3PO1C 5F6MA 2PKTA 2TIOA 1GHYH 5F8XA 4X1PU 4KP0A 2FM2A 1ANDA 1A3BH 2TGTA 3A7VA 1O2ZA 4Q6HA 3K2UA 1C1WH 2Z9KA 1O3BA 2A4GA 1T8MA 5DP9A 1P1EA 2L4SA 5EXLA 4YYXA 4ZKRU 1PQAA 2BD9A 5EG4A 2J34A 2XW9A 1KXEA 1DWDH 3NWUA 2YT7A 1OOKB 1YYY1 2Y7XA 3LDXH 1OBZA 2M0TA 4MG3A 2J38A 4I8KA 1XUKA 3A82A 4NXRA 2FOFA 2QA9E 1UK3A 5JPMH 3T62A 2Y7ZA 2BXTH 5FBEA 1AE5A 1CO7E 3K65B 4HTCH 1EJNA 2KG2A 4Z0KA 2AINA 4AG2A 3F6UH 1L6OA 1UITA 1AUTC 1TYNA 1ARCA 1O2JA 1MAXA 4E35A 5JXBA 3BG8A 4GPGA 5HFEA 3R68A 3PMAB 4NXQA 1HAGE 2KAIB 4Y8ZA 4CREA 4ABAA 4OS5A 1OWEA 1AKSA 4UD9H 3ZYDA 4DG4A 4ISIH 1P11E 4DIHH 1W0ZU 3KQBA 4MTBA 2H3LA 3KGPA 4JZEH 4B76A 2VWRA 1Y3XA 3AVZA 4MNWA 3UR6A 3ITIA 2A45B 3L33A 3A8CA 2ZU1A 1NU7B 4CHAC 1MFGA 5F8ZA 5EPNA 4ABBA 3OYPA 2ANKH 1C1UH 1HNEE 1UJVA 1UCYE 2F83A 5E0GA 1SC8U 4ABGA 1ZTLA 1O3AA 4TY6A 2UUFB 5K7RA 1MBQA 3SUZA 2J92A 3ATIA 1QCPA 4NNLA 2PW8H 1G2LA 4YDPA 3T27A 1BFEA 1GHWH 3E6PH 5LPEA 2CV3A 3RL7A 2GCTB 5E0JA 5HYOA 3M5LA 3Q3KA 3GCTG 5I25A 1UJUA 1IQIA 4TPYA 1MQ5A 3E3TA 2FOMB 2ZHFH 2QY0B 3CYYA 1MD7A 2FYQA 1K1IA 3MU0A 4WWYA 2OBOA 4IC6A 4TWYA 1EX3A 4BOHA 1U6QA 1H8DH 1YF4A 5DP8A 1NO9H 1IQHA 1OYQA 2ZPQA 3F1SB 3DFLA 4FUHA 1GHZA 1OX1A 3QDZB 1TX7A 1C5RA 1F5KU 2PA1A 8GCHF 2UUYA 1PDRA 2XBWA 1QJ6B 2AMPA 1C5WB 2PV9B 1XUFA 4FXGH 1SBWA 2BD8A 2AWXA 4WH6A 4AFZA 5C20A 1UM7A 2TPIZ 4WXVA 1U37A 1WFVA 4BTTB 2Y81A 4NXPA 1PPEE 1MAYA 2WL7A 1PPBH 4I32A 1K22H 1TX8A 1FMGA 3QIKA 3MO6A 2Z3CA 3ENSB 3FP7E 3U69H 1Y3YA 1T4UH 1UHBB 3LH3A 2A5IA 3T28A 2A31A 1V2OT 2VVVA 1BTPA 2ANMH 1C9TA 1B0FA 4MVNA 2YT8A 3A7TA 2B7DH 4G69A 1GHAG 3UOUA 3B8JA 1RD3B 1TGTA 4GHNA 4O03A 3PWCA 1L1JA 2ZDAH 1WHDA 1MZAA 2I6SA 2BX4A 3VB5A 1ORFA 1SLUB 4AZ2B 1SR5C 2W7SA 3O8DA 5BPEA 1G30B 3VGCB 3RXEA 2V6NA 1AY6H 1ESTA 4UU6A 4RSPA 2BY5X 1PQ5A 1Z7KA 2W3IA 1C2GA 2HALA 5DK1A 3RXSA 1O2IA 1W12U 1DLEA 3M5MA 2OMJA 4OS1A 2K1QA 3IWMA 4O3UA 1QY6A 5FPYA 1P1DA 1GI3A 1U39A 2ZPMA 1VCPA 2Z9IA 2JXOA 3SGBE 4JK5A 4HOPB 1GJ4H 2C93B 1YBOA 3A7WA 1NFWA 1XUJA 1VJAU 1GBEA 2ODYB 1DANH 3ZRTA 3QO6A 1Q3OA 1S83A 4AFQA 4OS7A 1E37B 2DB5A 1BBRH 3TU7H 2ZKSA 4Y7BA 1OWHA 1V5LA 2MX6A 5JB8S 4K76A 5EZ0A 1YCPM 1C1OA 3UPEA 1FY4A 1GL1A 1YM0A 1K1OA 1O2OA 2JH6D 3ESTA 1VB7A 5G1DA 4O3TA 2IN2A 3A89A 1HIAA 2KYLA 3DIWA 1KXDA 3SU4A 1ZZZA 1RRKA 4FUBA 3E16B 1O3HA 3KN2A 5GJ4B 3SZNA 1GBKA 4KTSA 1Q3XA 1GJ7B 1LPKB 4B73A 1GI9B 2D2DA 1FZZA 1GG6B 1O35A 3E90B 4ISLA 1BRCE 4Q7ZA 5FPSA 3UOPA 1O5BB 1SQOA 3MO9A 4B2AA 1G3BA 2P94A 2VNTA 4ZH8A 4NZLA 3A80A 2NU2E 3NZIA 2LA8A 4AX9H 1OS8A 1PPHE 5EU8A 3QGJA 1EP6A 2IPHA 1QURH 4Z33A 2BHGA 2BY8X 1HLTH 5GNDA 3MH5A 4VGCB 5JBTA 3SUFA 2G5VA 1SOZA 4JYTA 1E36B 2SFAA 3TNTA 1AD8H 1UEZA 3HK3B 2Q9VA 5DP6A 3RP2A 1Z87A 1GBLA 2FN5A 2XWAA 1UVTH 3ZVBA 3QGLA 1CHGA 3LPRA 1WG6A 2JIKA 2ZU4A 2V35A 4X1SU 1XVMA 2BXUH 3UIRA 5F67A 1O3LA 1O38A 1P06A 1QGFA 4CRFA 4NMRA 5GLJA 2XRCA 3M36A 1YPHC 1SGIB 1LHCH 4NMQA 1OBYA 3FP8E 2ZA5A 2O2TA 1MTNB 3GYMA 1CBWC 1A0HB 2THFB 1ZRBA 3TK9A 2BYAX 3RXFA 4CBOA 1T7CA 5DG6A 4NMVA 5CHAB 3BTWE 1EB2A 4E34A 1HRTH 4ZXYH 5J4QA 3RXDA 5EQSA 2H2BA 4YZUA 1PQ8A 2D8IA 5FPTA 1SSXA 3PV5A 4ESTE 3QN7A 1AFEH 3HPTB 4NGAH 1OKXA 1U38A 2QIQA 5HDYA 1WQSA 4OS4A 1UJ1A 1ETRH 1LKBA 2ZHEH 2EGKA 2PKSC 4ASHA 2FOGA 4MDSA 2R0KA 1LPZB 1RTKA 1TRMA 4UFEH 3I1EA 2F91A 2GP9B 3A8DA 1UM1A 3A81A 4AFUA 1TNIA 1GMDG 1QQUA 2LUIA 1AWHB 1BB0B 1PQ7A 3KHFA 1XKBC 2BDAA 1L4ZA 1UF1A 2BD2A 2R2MB 1SGEE 1CT0E 1GJBB 3FY5A 2BVRH 4X1NU 2VWNA 2F9BH 1QLCA 4Y8YA 1FN6A 1TMUH 1FIZA 2AS9A 1C5PA 1ZGVA 1NROH 1O3FA 1P9SA 1GMHG 1RS0A 3EGKH 1RJXB 2ZCLP 5HJ1A 1Z6EA 1EAIA 1AMHA 3NPSA 3MH6A 4NIVA 1EPTC 2FI5E 4CRAA 1W9EA 1GMDF 2AGIX 3D62A 1Z8RA 4DT7B 2PHBA 4K5ZA 3K1RA 1P05A 1ANEA 1TQ0B 1NT1A 3RMOH 1QA0A 3LNXA 4UFDH 3EYDA 4GVUA 2BD5A 4JZDH 2YTWA 2Y82A 1KXBA 2OQUA 1E34B 2LPRA 1WTHD 3VB6A 1WSSH 4LOYH 3O8CA 2GZVA 1O2QA 1JRSA 1YCPK 1C1PA 1C1MA 3EE0B 1W8BH 1HXEH 1W0YH 2JKHA 2AWWA 4NMOA 4DCDA 1NFXA 1A61H 2WINI 1NTPA 1SVPA 4WXIA 1T8LA 2V3OH 2J4IA 1RFNA 2ESTE 3ODDA 2VVCA 2FXRA 2ZGXH 3AAUA 6ESTA 2HGAA 1GHBG 2YNAA 4TYDA 3E91A 3R0FA 3KZDA 5GDSH 1O36A 4KELA 2BVSH 2C8XB 2GCTC 2BDBA 2F9OA 1IHSH 2GZ7A 3MH4A 1P3EA 3P8FA 1AZZA 1C5ZB 1Y5AT 2FYRA 2EDVA 1UEQA 4LK4A 3M61U 2TGPZ 1LHFH 2CSSA 4FUFA 3SHWA 2ZQ1A 1QRXA 4YT6H 1O5CB 1XUHA 2VIOA 4Q2KA 1WOFA 4AB8A 1WUNH 1MTWA 4ZHAA 1OXGA 4X2WA 4K2YA 1I16A 1UVOA 1BBRK 2QGRA 4LZ4B 1ID5H 2ANWA 2Z3EA 1QJ1B 2CHAB 1QB6A 4BXSA 3EDXB 1FPHH 5E22A 5E11A 4BXWA 1E38B 1TBZH 1TMBH 1UCYH 2KJDA 4X6PA 1BRBE 1F0UA 3M7TA 4N6XA 1KXFA 3SNDA 2ZZUH 2O9QA 1QAVB 3TJVA 2I0LA 1CU1A 1W10U 2B0FA 1KWAA 1O3KA 1QL9A 3ID4A 2AGGX 1O30A 3VXFH 5C1UA 2CJIA 2BZAA 3RXAA 4AGKA 5JBCS 5JDUB 2G5MB 3GY8A 2LOBA 3VB7A 2EEHA 2EXGA 1EZQA 2QKVA 2ZDLA 1FAKH 1QRZA 2ZGCA 1BDAA 1WCZA 1QQ4A 4H6TA 3RXMA 1W11U 5ESBA 4GVCA 3RXLA 1T4VH 3D23A 2WPJS 1MQ6A 4QT8C 4CRGA 1NFUA 1O2UA 4RKOB 1GBCA 4Z6AH 2HWLB 2I0IA 1TA6A 2AERH 3TPIZ 1RGRA 4AYVB 3RMLH 3QTOH 2ZG0H 1Y3VA 3LJJA 4ZHMU 1XUIA 2STAE 5AFZH 4X6MA 2BD7A 2SGQE 1WBGB 2G4TA 3MMGA 2AGEX 3B76A 3LONA 1GI8B 1J17T 1VA8A 3MHWU 3VGCC 1GI1A 1N8OC 2WV5A 2C90B 3F9EA 5EQRA 2CF8H 2QV1A 5C2ZA 3BTME 5E2OA 1RIWB 4AN7A 4YLUA 4JOHA 3S9BA 2V1WA 1A3EH 5EODA 1N99A 4WVPE 2HOBA 2JETB 3DA9B 1IQNA 2F9UA 1XXDA 3BTFE 1TGBA 4JZFH 3JXTA 2HPQH 1M5ZA 5HETA 1TPOA 2ILNA 2OC8A 4GSOA 1NRSH 2QG1A 2PKAB 2Z9JA 1GBTA 4IS5A 2M10A 2IOTA 4BTUB 3MNXA 2ZCKP 3DJ3A 1LHEH 1MMJN 1UHPA 3SJ8A 1G3DA 1O2RA 1PYTD 3ID3A 1GL0E 2HLCA 4CRCA 3DT0H 1NN6A 1TNJA 1UTJA 4Z8JA 1PPGE 2PUQH 1UTQA 2EEJA 2ZECA 4BAHB 2EA3A 5HGGA 2QXHA 3PS4A 1OWDA 2BLQA 2HNTE 3W94A 4MLFB 4A1TA 3PM3A 4OGYA 3ZZ5A 2F5YA 1ANBA 1GG6C 1SB1H 2EJYA 1HB0B 3VEQB 1ZMJA 3CBZA 1FY1A 3E8LA 1AB9B 1FLEE 5C67A 4K60A 1SG8B 4I8LA 3BTQE 4A1XA 1BT7A 2EDPA 3HPMA 1ETTH 1BE9A 1S82A 1EB1H 4VGCC 1VITG 4B74A 1O2GH 3SNAA 3MWIU 5G4BA 3M5NA 2H5DA 3QGNB 3RLEA 1QIXB 2CXVA 5GWZA 2ZFQH 3KIDU 4K8BA 5T6FA 3FVFB 3C27B 1IQKA 3IG6B 1K28D 4X0WU 1MTUA 4AFSA 1KSNA 1GWAA 4YO9A 4DURA 1ZPCA 4KKDA 2K1ZA 2STBE 2ZU2A 4I31A 4YLQH 1N6XA 1CSOE 4NSVA 1C1SA 4L8NA 2CF9H 2KRGA 1NF3C 1SLWB 3FANA 1KXCA 1MTNC 1NFYA 1HAVA 3U1IB 2ZFTA 2ODPA 1YLCA 1G3CA 2PWXA 5A8ZA 1C5MD 5B6OA 1QB9A 1J16A 1VITF 3MI4A 5CHAC 4IBLH 1CQQA 1GCTB 1ZHRA 3BF6H 1AVWA 1HDTH 2IJOB 3P6ZB 1MU8B 1HJ8A 3L4FD 4UFFH 1CGJE 3QE1A 1GJDB 1LCYA 1Z6JH 1UTKA 1TPAE 1MC7A 1TGNA 1C4Y2 2FLRH 4I7YH 2W4FA 1P09A 4PROA 3RXCA 2ZPRA 4JMYA 4TPIZ 3GY7A 3RLYH 2Z6BD 3ZYEA 1KDQB 1WIFA 2ZFSA 1Z8JB 2WYJA 4FUIA 2PKUA 2Z9LA 2Q1JA 1DT2A 3SU3A 3T2NA 1AFQB 1BHXB 1ESAA 1HV7A 3BG4B 4NSYA 2TGDA 1ELBA 3NCLA 4YESB 3LU9B 1CA8B 1CVWH 3VQGA 4XHVA 1C5QA 4XBCA 1ZOMA 1HBTH 1L0ZA 3I4WA 2OP9A 2ZI2H 1UCYK 3MU1A 1ZSJA 1MFLA 3ZZ4A 2GV6A 1VJ6A 2DUCA 4OAJA 1KXAA 3BEFB 1TOMH 3TH3H 1TBRH 1AKSB 5EXNA 1HUTH 3RXOA 5T6GA 4XE4A 1MD8A 3K50A 5FAHA 1IOEA 5E6PB 4UEHH 1JOUB 3HGPA 1HXFH 1WHAA 3SGAE 2GDDA 1YGCH 2EGNA 1L1NA 3HPKA 3RXJA 1VR1H 4Q7YA 1BTHH 2EHRA 1OPHB 1DY9A 2ODQA 4Q2PA 3EAJA 5T3HA 4H42U 3SORA 1OSSA 1T8OA 1EPTA 1Q2WA 1UVSH 2VIVA 1TP5A 1H4WA 2NU1E 3SQHE 1ELAA 4YT7H 1KY9A 4NMPA 2BYGA 4HGCA 1N6FA 1CT2E 1RXPA 1C2DA 1VZQH 5TCAA 1B0EA 2G81E 3PLKA 7KMEH 3H5CB 2VIDA 1F0TA 3KZEA 2QXGA 1V2UT 4DOQA 4FU9A 1QFKH 1S0RA 4BANB 2E7KA 3BIUH 1GJ5H 2A4OA 2I6QA 2XC5A 4F49A 4BAOB 1CA0C 4JOKA 2H9HA 4U2WA 1O5EH 5E0HA 1V2WT 1W2KH 1MCVA 1XX9A 3A8AA 5SGAE 3AW0A 1DE7H 3DHKH 1KIGH 4UE7H 2VWMA 2BZ6H 1VJ9U 2XC0A 1RGWA 1JXPA 3QK1A 2CHAC 5AVDA 2ZEBA 1GGDB 1F92A 1OP0A 8KME2 2XNIA 3E0NB 4ZHLU 1GDNA 3RXQA 1P03A 2OPGA 4YOJA 1LPGB 1D4PB 1SGNE 2KJKA 4ZKNU 2RG3A 3TSWA 3EA8A 2RA0A 1Y8TA 4Q7XA 2D1JA 1OBXA 2FOHA 3GCTF 2NU0E 2DAZA 4U30A 4YTAA 1GI2A 1QR3E 3OTPA 3WY8A 4E7RG 1X5QA 1O3NA 1X6DA 2BQ7B 1Y3WA 2BMGB 1TGCA 4Q80A 4U32A 4WYUA 4X1RU 4Y0ZE 4TWWA 4ISOA 1P57B 1A1RA 1YCPH 1FC7A 3HGNA 2UWPA 3LGUA 4NIXA 1AZ8A 1W9QA 2OZFA 1MUEB 1SGFA 4O06A 4X8SH 2JH0D 4CH8B 1AIXH 1WU1A 3BEIB 3M3VA 3QX5H 4D76A 3MU5A 4A5TS 1MKWH 2ZQ2A 1TE0A 2V90A 1ZJDA 4H6SB 4BAMB 4K75A 2HE4A 3TGIE 1SGPE 1V2JT 4IW4E 5EXMA 2IWNA 1ZOKA 4NMTA 3M37A 4K78A 1GI0A 1LKAA 1IHJA 4ZKOU 2JETC 4AG1A 1BCUH 1KLIH 2BD3A 1OP8A 2D90A 2G8TA 1TONA 1GHAF 2AMDA 5FB8C 3SUGA 3TIUA 1O2YA 1P2IA 8ESTE 1V5QA
chains in the Genus database with same CATH superfamily
2BOHB 3SV2H 3GY2A 1GBDA 1HIAB 2ULLA 4X1QU 4JOJA 1TFXA 1AN1E 2K0QA 1FNIA 4NG9H 2ZDMA 2I04A 1A7SA 3PLBA 2XCFA 4ABEA 4MPUA 1MBMA 3U8RH 1DWCH 4HFPB 2RCZA 1OWJA 1YPLH 1HPGA 2W7UA 1J14A 3H7TA 3N7EA 4HOPA 4KFVA 3UQOA 1QTFA 2VH0A 4MNXA 1O2NA 2ZU3A 3S69A 2VVUA 3ATKA 3GDVA 1WXRA 3K6ZA 1OHHD 1AB9C 1LHGH 1X45A 1TBQH 4ABFA 4NFEA 3SV7A 1ZMNA 1H9LB 2DMZA 3LC5A 4EDJA 2JSNA 4K6YA 2V3MA 4NA9H 1WF8A 3IITA 2RRMA 3NFKA 5D13A 1V2RT 1ZGIA 1FONA 2KAWA 1C1VH 1GJ6A 2AYWA 2GMTB 3BSQA 3OTJE 1EQ9A 3BTGE 3W95A 1TRYA 1SL3A 5C94A 1VAEA 2KCAA 2ZHQH 2WPLS 1Q3PA 2AIPA 1FC6A 3MH7A 4GLYA 2ALVA 3V0XA 1BQYA 4XRNA 1V2PT 1AUJA 1UEPA 1YPHE 3P8NA 3UFAA 1FXYA 4WF8A 3PROA 3MOCA 1O2SA 4IMQA 1GBIA 2F9VA 4THNH 5AFYH 4F8KA 3UWJH 2FOCA 2FCFA 3KQCA 5PTPA 5CDFE 4PQWA 1TLDA 1S6FA 1V6DA 1Y59T 2ZTXA 3LGWA 5FHTA 1RGQA 2VPHA 2A2XH 3SQEE 4MPXA 2ZWLH 1IAUA 1S6LA 2LELA 2ZDKA 4KFWA 5DP4A 2GD4B 1GCTC 2OGPA 2BY9X 4B71A 4M7GA 3S9CA 2FPZA 1F5RA 3ELAH 1UMAH 1HYLA 4E06H 1HFDA 3MO3A 4K69A 4B2BA 5JBAS 4JOGA 1P02A 2AEIH 2XOKD 2R3UA 2ZPSA 2H2CA 3FAOA 1BOQA 2AWUA 1YY3A 1EP5A 3A7YA 1MZDA 1IQGA 5HKKD 1BITA 1JBUH 5EJ1A 2YNBA 3NK8A 7ESTE 3WKLA 2PLXA 3I29A 2LP6A 2ZNKH 1ZRKA 2CS5A 1X9ZA 2FODA 3SV8A 2BDHA 2A5AA 1THPB 5DKMA 2JJ2D 3GY5A 4X2XA 1AFQC 1GDUA 3BG4C 1EZXC 1PYTC 1YP9A 3SN8A 1FIWA 3FFGA 2OCVB 2F3CE 3U9AH 1GQ4A 1ESBA 3QZRA 2KA9A 3PTBA 1QL7A 2OD3B 1EKBB 2GGVB 2F0AA 2FWWA 3TNSA 2KPKA 1K2I1 1VGCB 2IWQA 4DY7B 5F3XA 4I8HA 3C1KA 3SU2A 1C5TA 3PMJA 2EV8A 1UW7A 4D9RA 3QZQA 4GCHG 2KJPA 1XVOA 1TB6H 1O3CA 1E1RD 1GJAB 1BMFD 5IDKA 1WH1A 4XBDA 2DE9A 4R2ZA 1TNLA 3KQDA 1BTYA 2M0ZA 1EASA 2H1UA 1YPMH 9ESTA 2QAAA 3P8OA 4AORA 2Q6GA 3UNSA 1ABJH 1GMHF 2WUBA 1ZR0A 2O8UA 2J2UA 3T26A 2ASUB 1DY8A 2QXIA 2VIQA 1L4DA 4FVDA 3RC6A 3VXEH 4E05H 1CE5A 3NCVA 4B2CA 2KPLA 1YC0A 3TH2H 7GCHG 3D49H 3MU4A 1SFIA 4FUEA 3N7OA 1G9OA 1FY5A 3RXUA 2FX4A 2GDEH 3H09A 2G2LA 1HJAB 1MKWK 2BY7X 3HK6B 1OYTH 2UWLA 3PDVA 1C1NA 1JIMA 1XXFA 3ZZAA 1TNHA 4DGJA 3ZZCA 3GCNA 5FX5A 1TALA 3K82A 4JL7A 3RU4E 4Q3HA 2WPKS 4XD7D 4F4OC 3QLPH 1HAXB 1B8QA 2OQ5A 3F2HA 1LQEA 2OS6A 3UWIA 1P2MA 2GZ8A 2FTLE 1YPGH 3I18A 4FUCA 2REYA 4OS2A 4A1VA 1N6EA 4JJ0A 3N7DA 3A88A 1V2QT 1WI2A 2JREA 4JORA 7GCHF 1O3PB 1Y5UT 1FUJA 1O5AB 2IWOA 1GHBF 1W0KD 1EOLA 3H7OA 1X8SA 1FI8A 3DCLA 1EAXA 3VG8A 1YPKH 2ZF0H 5HFDA 1C5YB 4I8GA 3SI4H 2L6OA 3P8GA 3TJNA 5A8YA 2BDGA 3LGVA 2O8MA 2DLUA 2JINA 5HXFA 2ZGJA 4X6OA 2BB4A 1C2KA 4FU7A 2BD4A 2GV7A 1X5NA 3UB0A 2ZTYA 2PDZA 1C5LH 1YBWA 1GJ9B 3RM0H 2ZP0H 3SHAH 1F0SA 3SU5A 4I33A 4TY7A 3FOAA 1SMFE 1TPPA 3DORA 3KCGH 3TH4H 3KHVA 3FKSD 1D3TB 2YMSD 5LPFA 1C5UA 1EJMA 4J1YA 3UREA 4D7GA 1ABIH 2CK3D 3DSOA 1FQ3A 1P2JA 1IQMA 4Y8XA 2ZHDA 1O2HA 1C4U2 5LPRA 4WYTA 2DM8A 9LPRA 1MH0A 3A83A 3O5NA 4FGMA 1YPEH 2KOHA 2Z7FE 2ENOA 1G3EA 1O37A 4CBNA 3ZV8A 3HKJB 4Q2NA 2EI8A 2M2AA 2KL1A 1FAXA 1BIOA 4JK6A 1GCDA 4SGAE 1QAVA 3FN8A 3SGQE 5E2PA 3RXKA 1ZSLA 2ZDVH 3FO8D 3DUXH 3FZZA 1THRH 1W3CA 1BMMH 3GCOA 2BX3A 1MTSA 3GOVB 4UONA 3MFJA 4NWLA 3TSVA 1VCWA 3CH8A 2PSYA 4ABIA 1SFQB 3BTHE 1LMWB 4GHTA 1DLKB 5A0CA 1Y7NA 2KZ4A 2V0BA 2BDCA 5LGOA 3GISB 3M7QA 1QRWA 2GT7A 1UTLM 2JJ1D 2KCYA 1AI8H 1O2TA 1G2MA 1D3QB 3S7HB 3STIA 1A5GH 3ZVEA 1A46H 3P95A 5FCRA 2NWNA 1C2EA 4Y6DA 1N1LA 3A87A 1JRTA 3UNQA 2P8OB 3M5OA 1HAZB 4ZKSU 1XKAC 4MPAA 1D6RA 1GVZA 1TIOA 2OXSA 1TNKA 1KEFA 1W13U 2H5CA 3SU1A 1XZ9A 1UK2A 2FEQH 3TGKE 1IU0A 4ACAA 2EAQA 3U8TH 4WMEA 1O3MA 1JIRA 2AIQA 2ZFFH 1N6DA 3I78A 1MABB 3TVJB 2L4TA 1SOTA 4IN1A 2CSJA 3BTKE 4INKA 4YM9A 3P70B 2FMJA 4Y0YE 3AXAA 5EOKA 1UVUH 2VB0A 1V2LT 3KF2A 4CR9A 1W14U 1L1GA 1O5GH 2SGAA 3NGHA 2A0QB 2EGOA 4KTCA 2P3TB 5CMXH 1A4WH 1FPCH 3GY6A 2JDID 3JZ2B 3ZZ6A 5DPAA 2PGQB 1TQ7B 2FO9A 2D8WA 2GMTC 1JMOH 5EPYA 4A6LA 1ZSKA 2YUBA 1BRAA 1SGQE 3RM2H 2YMSB 4IC5A 1C1TA 3PDZA 1D6WA 1ZHPA 2IPQX 2GZ9A 4DW2U 1K1PA 4AYYB 2EDZA 1R6JA 1GMCG 2QKTA 1IQJA 2B5TB 5EJZA 1CT4E 4GHQA 2TRMA 4NA8A 2FP7B 4H11A 5HM9A 2WV4A 1V2KT 2QKUA 3GS9A 3B23B 5E1YA 5C5OA 4Q2QA 1A5IA 1GDQA 2SNVA 3PV2A 3SV9A 5KEDA 1DS2E 3QJMA 6LPRA 1DXPA 1Z71A 3B9FH 1DUAA 5HFCA 1I92A 1GVKB 4OEOA 1V3XA 1SGCA 4D7FA 1NRNH 1GI4A 1O2MA 2KQFA 1QL8A 2PGBB 1Q7XA 1F5LA 1G32B 2BQWB 1O3DA 5HF1A 1C2MA 1EXFA 1V2ST 4NMSA 2A32A 5JBBS 3TMHA 1Y3UA 5L6NH 4ZAEA 1GJ8B 1GMCF 1UTOA 1WQVH 2Y80A 3LH1A 3KDKA 1UTNA 2ALPA 2VJ1A 4XBBA 3SZEA 1AU8A 5A2PA 5DP3A 3A7ZA 2W26A 1NM6A 4B75A 1MTVA 1O3EA 1GBHA 1LQDB 1RTFB 1ZPZA 7LPRA 4RKJB 1CBWB 1O5FH 2G4UA 2VSPA 1F2SE 1ZTKA 4K8YA 5C5NA 6GCHG 4NWKA 4OGXA 2HLDD 2XBXA 1C2IA 1DM4B 2BOKA 2Y6TA 4KTUA 3ZVGA 3A86A 1BMAA 1YPJH 3I77A 3LGIA 3VFEA 1SGDE 2PKSB 3GY3A 1C9PA 3M7UA 1HJ9A 3KL6A 3TITA 1F7ZA 1J8AA 2H2ZA 1VGCC 3OX7U 1NS3A 4ZMAH 1RY4A 5J4SA 1UO6A 3TJUA 1HAOH 4YOGA 3Q00A 4AMHA 2KOJA 1C2FA 3PTNA 2D26C 4XOJA 3CS7A 5LH8A 2LC7A 3VQFA 2YOLA 2G55A 1BJUA 1UVPA 3FZDA 3F2FA 2FI4E 5CE1A 6CHAB 3MQKC 2I4SA 3DJ1A 1SHHB 1SPJA 4Y71A 3SJIA 1B7XB 1KDQA 1QNJA 6GCHF 2FDAA 2R4HA 5JYIA 5K0HA 2ANYA 2Z9GA 3GICB 1T8NA 5L2ZH 2DKRA 4HI3A 2WHXA 1NRPH 3F9FA 4X2YA 2VIPA 1EPTB 3CS0A 2PTCE 4NZQA 3Q3YA 3R0HA 1LVYA 3S0NA 2I1NA 4JOPA 1P2QA 1QJ7B 3TJOA 4MPVA 1MKXK 2QCYA 4Z1MD 5I46H 5EW2H 5I7ZA 1UK4A 3QUMP 1BHXF 2FS8A 1AO5A 1G36A 2R9PA 5DP7A 3ID2A 4D8NA 4Y7AA 1WV7H 3SHCH 1GBBA 1O32A 2ZTZA 3MU8A 4ZUHA 2WV9A 1HJAC 1FV9A 3BIVH 4HZHA 4CH2B 5H4IB 4M9FA 2BDYA 3JZ1B 2I6VA 4Q2OA 1H8IH 1O0DH 2SGEE 2Z94A 1ZUBA 2ZPLA 4X8TH 2KAIA 5TCCA 3V3MA 1KMHB 2KFWA 1OZIA 1GJCB 1P3CA 4GAWA 1K0HA 1MU6B 1PJPA 3LIWA 4RT1A 3SOSA 3RMMH 2L97A 4NNMA 2JWEA 3MNBA 1HCGA 3GGEA 3E0PB 1KLJH 4JCNA 2ZO3H 3U28C 1PFXC 3A84A 1T32A 3O8BA 2A7HA 4I8JA 4ZROA 2FX6A 2HVYB 8GCHG 2G00A 2KX4A 4XSKU 2VSVA 2EQNA 3RXBA 4X8UH 3SJKA 2QF4A 3RXIA 3L3TA 5FX6A 1GVLA 2OBQA 1NPMA 3SJOA 1CGIE 1N7EA 2JILA 1K1LA 3AW1A 5HEDA 2UUKB 1OWKA 5H3JA 1ZPBA 2BY6X 5HEBA 1DPOA 2A7CA 3DJAA 3SNBA 5EGMA 1TA2A 3LOXA 1IQFA 1FY3A 4ABJA 5C0TA 2W5EA 4JOEA 1QAUA 1ZMLA 3ATLA 3LGTA 4OEPA 4Y76A 2FE5A 3MNSA 3VPKA 5GPIB 3F9GA 2XC4A 3GDUA 2H9EH 3S9AA 1ZHMA 2ZFRH 1V2NT 3E17A 3A85A 2YUYA 3G01A 1AGJA 1BMNH 1AVXA 3EGGC 3PRBA 4JYUH 4DIIH 1HAHH 1O2VA 2GKVE 3OSYA 4AOQA 1D9IA 1SGFG 1LVMA 3ZVCA 1TABE 1WI4A 4IGDA 2GX4A 1O2WA 1Z8GA 3RXVA 2TBSA 4RI0A 2BM2A 3QTVH 2P3FH 4JZ1A 1ELEE 1RIWC 1E0FD 1C1QA 1C5OH 1O5DH 1J9CH 2PSXA 4Q6SA 3RL8A 3SFJA 1DUEA 2O8TA 2EI7A 2WPMS 3NUMA 1UHBA 2HVXA 3EGHC 3SJ9A 1EAUA 1DDJA 3ZVAA 2DJTA 2KV8A 1NRQH 3QDOA 5HF4A 1V2TT 3ZZ9A 2AFQB 3M3SA 1C4V2 5FCKA 5AF9H 4UU5A 1O3JA 3ODFA 4ISNA 4UFGH 4O97A 2UWOA 4WY3A 3URDA 1C2LA 1N8OB 2M0UA 1C5XB 4WMFA 1SGYE 2CGAA 5G1EA 2P8OC 4LZ1H 1TNGA 3ID1A 1EUFA 2CN0H 2C8YB 4U01A 4BTIB 1DOJA 1LDTT 2HGTH 1NBMD 4TT3D 1WJLA 3LGYA 3VB3A 2B9LA 1C5NH 2ZGBH 2C3SA 2LNCA 2O8LA 1ELDE 5GCHG 3U98H 1NZQH 4AB9A 2Z17A 3ZVDA 4R8TB 3MTYA 1V2VT 1P8VC 2CMYA 1DSUA 2UUJB 4MPWA 3CENA 3EE7A 4AGJA 2AH4X 1ELVA 1DICA 4RN6A 3U8OH 1UTPA 2VH6A 1TRNA 3PMBB 3ZV9A 2XYAA 1D3PB 4K3JA 4WMDA 1INCA 4ZXXH 5T6DA 3E1XB 2KBSA 1K21H 1IQEA 3TSZA 3F68H 3WW7A 1A0JA 1ZTJA 1QBVH 1TAWA 2YMSC 4P2AB 4NA7A 1BJVA 1OP2A 4K72A 1WDIA 2P93A 5BRRE 1S81A 1D5GA 5GCHF 1C5VA 1P9UA 4MNYA 1K9OE 1COWD 3GCHB 1LVBA 1SGTA 2FNEA 2GT8A 3V7TA 4P0CA 1E79D 2P16A 5HFFA 1ZJKA 3ZZ8A 1TPSA 3EA7A 4E3BA 2VU8E 3T5FH 1HAYB 1W7XH 1ETSH 2OINA 1ARBA 1N7FA 1O31A 1GI7B 3ATWA 4TSFD 3AK5A 2XCNA 5HMAA 5ABWA 1K1MA 4UDWH 3QJNA 2FS9A 2F9PA 3HKIB 1KYNA 3BTEE 4INLA 4CR5A 1TWXB 5A0AE 1AWFH 2BQ6B 3BV9B 1YWUA 1QBOA 1XMNB 3SNEA 1LO6A 2A5KA 2VRFA 2J9NA 4BAQB 1ELCA 4IMZA 1IHTH 2VGCB 4X2VA 2J94A 1K32A 2EEGA 3KEEA 1AQ7A 1AVGH 3Q77A 2G52A 3LT3A 1F0RA 2EI6A 2BDIA 2HNTF 5F53A 2Q6DA 4Y79A 5A8XA 1H9IE 1CGHA 2WUCA 1O2LA 2Y5HA 1FC9A 1L2EA 3HATH 2D92A 2SGDE 1BTUA 3OY5U 3O8RA 2GCHG 2P59A 3SOEA 2FIRH 3S7KB 3RXRA 2F43B 4JYVH 2C4FH 2K20A 5C3NA 3U1JB 2MHOA 2R2WU 3AASA 2RDEA 2H9TH 2Y5GA 3LC3A 2FZZA 3PWBA 4ISHH 2DLSA 3D65E 1H1BA 5C1YA 3PO1B 4FUDA 1LVOA 3VB4A 1BTXA 1SLXB 5A0BA 1GQ5A 2OSGA 6CHAC 3TGJE 2VWLA 5DTHA 1UTMA 3LKWA 5EYZA 3MYWA 3UQVA 1SQTA 1SQRA 2BVXH 3MNCA 1AHTH 1EJAA 2SNWA 5FL7D 1H8ED 3CBYA 2WYGA 1C1RA 4BAKB 1D3DB 4WJG2 2DE8A 3P17H 1K1NA 2FOEA 1GHVH 4K1EA 2GCHF 3EQ0H 3EA9A 1P2KA 3NFLA 3SO3A 1V62A 3A7XA 1C5SA 2OTVA 5B42A 1WF7A 3UUZA 4OS6A 4D9QA 1QB1A 2A7JA 2HRVA 2J95A 2BLVA 2A2QH 1TP3A 4REYA 1UEWA 1O2PA 5E21A 5A09A 5DO4H 2FI3E 2FOAA 2GVFA 2IJD1 4MQAA 5C1XA 1IU2A 4WH8A 1DFPA 1FJSA 1A2CH 3KQEA 3M3TA 3PB1E 5DJ7A 1V6BA 4GCHF 4NCYA 3TK6A 1EAWA 1IQLA 1O2XA 2KOMA 1XUGA 1FCFA 2P3WA 3GDSA 1EATA 1OWIA 1WYKA 8LPRA 1GI6A 1PPCE 1EZSC 2XTTB 3PMHB 1S0QA 3SV6A 4CHAB 1ELTA 2G5NA 2QC2A 3RU4T 1S84A 2A4QA 3NXPA 1KTSB 4XFQA 2RCEA 4CRBA 2M5TA 2ZDNA 2QBWA 1LHDH 1HAPH 1O39A 1B5GH 1P2OA 1SQAA 2ZFPH 1P04A 2EC9H 1GGDC 1SGRE 3ZIAD 2W7RA 2PUXB 3GABA 1A5HA 3DD2H 3T29A 3F9HA 1NTEA 1N7TA 3WKMA 1GHXH 1P2NA 3R69A 4ABDA 2C8WB 3ZVFA 2PFEA 3GSLA 1FDPA 1NY22 3CNRA 1CHOG 1CA0B 4X6NA 5HM2A 3RC5A 2DC2A 1EOJA 1BA8B 3CC0A 1W9OA 5B6LA 5E8EH 1V2MT 3V13A 3P92A 1P01A 1N6YA 1QHRB 5A2MH 5EQQA 2OC7A 3UR9A 2M0VA 2P3UB 3M35A 1UJDA 1MCTA 2WPIS 2FOBA 3PYHA 2L74A 3RXPA 1GBFA 5FBIA 2Z3DA 1SHYA 2OLGA 2G51A 3BTDE 2C8ZB 3F3BA 3K6YA 3LNYA 1DVAH 1QZ8A 4K1TA 1H9HE 1MKXH 2OUAA 1FY8E 1CHOF 2H6MA 2XBYA 1TQ3A 3BEUA 4LXBH 3OU0A 2Y5FA 3RDZA 5L2YH 2ZCHP 3RLWH 2QF3A 4A92A 1K1JA 1HGTH 4FU8A 2PTNA 4NIYA 4GUXA 4SGBE 3KNXA 3SU6A 1DXWA 1RTLA 5AHGH 1GBJA 1TOCB 3CP7A 4XDEA 2TGAA 2FTMA 2Q6FA 2XXLA 4BNRA 4FUGA 3V12A 3ZZ7A 1O3IA 1Z1JA 3T25A 3DFJA 1BBRE 1X7AC 3RXHA 1Z1IA 3RC4A 3ZZDA 1T2MA 1C2JA 1ANCA 5ESTE 1SI5H 4YOIA 5DGJA 1BTZA 1UFXA 2RDLA 3LJOA 1YKTA 3UTUH 3SHUA 2EEKA 4Y10E 4KGAA 2GTBA 2ZC9H 2PNTA 1G37A 1GI5A 1O33A 1PPZA 2QT5A 2ZU5A 3SYJA 3K9XB 4E7NA 3CBXA 3GYLB 2ZGHA 3PV4A 1ZYOA 4NFFA 1W0JD 2PZDA 1GBMA 1O34A 1S85A 4GVDA 2RA3A 1DSTA 1V1TA 2KCPA 1C2HA 1TMTH 1NRRH 4J2YB 1QA7A 1BUIA 5TJXA 1GBAA 3PLPA 1A0LA 3URCA 1NC6A 3SU0A 1YLDA 1BTWA 1NU9A 2VBCA 4K1SA 3SNCA 1GM1A 3GJ9A 2ZIQH 1J15A 3SUEA 3Q3XA 1VCQA 2VZ5A 3UNRA 1WAYB 2PR3A 4FUJA 1U3BA 4F48B 2SGFE 3QWCH 2J5UA 2NU3E 2VWOA 3FP6E 1EZUC 2OCSA 3SBKA 1P12E 2UZCA 2QN5T 2F9NA 4DVAU 2A1DB 1AE8H 3A8BA 2PKAA 4B1TA 1Q31A 1O2KA 1RZXA 1GPZA 1TGSZ 1ACBE 1LTOA 3L6PA 3RUOA 2EEIA 4Y11E 1WTGH 3STJA 3TLOA 2R3YA 5DP5A 2R0LA 1X5RA 5F03A 2IWPA 2QYIA 4FETA 2FLBH 1O3OA 5IYTA 2OC0A 2AHME 2QF0A 1TX6A 3UY9A 3BN9A 1HAIH 2A4RA 5GXPA 5GIBA 3GCHC 3AAVA 1DX5M 3SI3H 2HNTC 1ELGA 2QXJA 5JB9S 2OC1A 3NKKA 1Z86A 1HAVB 3O46A 4JOFA 1G9IE 1W7GH 4LMMA 2V3HH 5F8TA 3ZZBA 4ACBA 1DWEH 1BRUP 1Z8IB 2LC6A 5FXLA 2O8WA 1VITH 2ZHWH 5EW1H 3GY4A 3HVQC 4INHA 1DITH 4ABHA 5HFBA 2B8OH 5L30H 3RMNH 4NIWA 2BTCE 2HE2A 4H4FA 4I86A 1KLTA 3SUDA 2W3KA 4X8VH 2FESH 2JH5D 4Q63A 1NESE 1Y5BT 1E35B 2P95A 2VGCC 2Q3GA 4JZIA 1QBNA 2M3MA 3BPUA 2OQSA 3ATMA 4O9VA 1SLVB 1DWBH 3R3GB 4IN2A 1S5SA 2WPHS 3RXTA 1M9UA 2XWBI 1S6HA 2NU4E 4CRDA 1T31A 4FVBA 3OY6U 2AMQA 1JWTA 1PPFE 1P0SH 3ZZ3A 3SW2B 1ZLRA 1KTTB 2BLWA 5HEYA 3RXGA 2JOAA 3RU4D 1BMLA 4MNVA 1FN8A 1BZXE 2VINA 4A7IB 1WFGA 3Q76A 2HPPH 1P10A 1THSH 2X7ZA 3BTTE 2XBVA 3TK5A 2BLOA 2SGPE 4DJZB 4R0IA 2H3MA 1O3GA 5KGOA 5ETXA 1XM1A 3OEHD 2VIWA 1ELFA 3PO1C 5F6MA 2PKTA 2TIOA 1GHYH 5F8XA 4X1PU 4KP0A 2FM2A 1ANDA 3UAIC 1A3BH 2TGTA 3A7VA 1O2ZA 4Q6HA 3K2UA 1C1WH 2Z9KA 1O3BA 2A4GA 1T8MA 5DP9A 1P1EA 2L4SA 5EXLA 4YYXA 4ZKRU 1PQAA 2BD9A 5EG4A 2J34A 2XW9A 1KXEA 1DWDH 3NWUA 2YT7A 1OOKB 1YYY1 2Y7XA 3OAAD 3LDXH 1OBZA 2M0TA 4MG3A 2J38A 4I8KA 1XUKA 3A82A 4NXRA 2FOFA 2QA9E 1UK3A 5JPMH 3T62A 2Y7ZA 2BXTH 5FBEA 1AE5A 1CO7E 3K65B 4HTCH 1EJNA 2KG2A 1E1QD 2AINA 4Z0KA 4AG2A 3F6UH 1L6OA 5C17A 1UITA 1AUTC 1TYNA 1ARCA 1O2JA 1MAXA 4E35A 5JXBA 3BG8A 3OEED 4GPGA 5HFEA 3R68A 3PMAB 4NXQA 1HAGE 2KAIB 4Y8ZA 4OM9A 4CREA 4ABAA 4OS5A 1OWEA 1AKSA 4UD9H 3ZYDA 4DG4A 4ISIH 1P11E 4DIHH 1W0ZU 3KQBA 4MTBA 2H3LA 3KGPA 4JZEH 4B76A 2VWRA 1Y3XA 3AVZA 4MNWA 3UR6A 3ITIA 2A45B 3L33A 3A8CA 2ZU1A 1NU7B 3W1EA 4CHAC 1MFGA 5F8ZA 5EPNA 4ABBA 3OYPA 2ANKH 1C1UH 1HNEE 1UJVA 1UCYE 2F83A 5E0GA 1SC8U 4ABGA 1ZTLA 1O3AA 4TY6A 2UUFB 5K7RA 1MBQA 3SUZA 2J92A 3ATIA 1QCPA 4NNLA 2PW8H 1G2LA 4YDPA 3T27A 1BFEA 1GHWH 3E6PH 5LPEA 2CV3A 3RL7A 2GCTB 5E0JA 5HYOA 3M5LA 3Q3KA 3GCTG 5I25A 1UJUA 1IQIA 4TPYA 1MQ5A 3E3TA 2FOMB 5HIZA 2ZHFH 2QY0B 3CYYA 1MD7A 2FYQA 1K1IA 3MU0A 4WWYA 2OBOA 4IC6A 4TWYA 1EX3A 4BOHA 1U6QA 1H8DH 1YF4A 5DP8A 1NO9H 1IQHA 1OYQA 2ZPQA 3F1SB 3DFLA 4FUHA 1GHZA 2J98A 1OX1A 3QDZB 1TX7A 1C5RA 1F5KU 2PA1A 8GCHF 4ASUD 2UUYA 1PDRA 2XBWA 1QJ6B 2AMPA 1C5WB 2PV9B 1XUFA 4FXGH 1SBWA 2BD8A 2AWXA 4WH6A 4AFZA 5C20A 1UM7A 2TPIZ 4WXVA 1U37A 4RT0A 1WFVA 4BTTB 2Y81A 4NXPA 1PPEE 1MAYA 2WL7A 1PPBH 4I32A 1K22H 1TX8A 1FMGA 3QIKA 3MO6A 2Z3CA 3ENSB 3FP7E 3U69H 1Y3YA 1T4UH 1UHBB 2J97A 2A5IA 3LH3A 2A31A 3T28A 1V2OT 2VVVA 1BTPA 2ANMH 1C9TA 1B0FA 4MVNA 2YT8A 3A7TA 2GJGA 2B7DH 4G69A 1GHAG 5EIYA 3UOUA 3B8JA 1RD3B 1TGTA 4GHNA 4O03A 3PWCA 1L1JA 2ZDAH 1WHDA 1MZAA 2I6SA 2BX4A 3VB5A 1ORFA 1SLUB 4AZ2B 1SR5C 2W7SA 3O8DA 5BPEA 1G30B 2OK5A 3VGCB 3RXEA 2F4LA 2V6NA 1AY6H 1ESTA 4UU6A 4RSPA 2BY5X 1PQ5A 1Z7KA 2W3IA 1C2GA 2HALA 5DK1A 3RXSA 1O2IA 2W6JD 3N99A 1W12U 1DLEA 3M5MA 5DN6D 2OMJA 4OS1A 2K1QA 3IWMA 4O3UA 1QY6A 5FPYA 1P1DA 1GI3A 1U39A 2ZPMA 1VCPA 2Z9IA 2JXOA 3SGBE 4JK5A 4HOPB 4AC9A 1GJ4H 2C93B 1YBOA 3A7WA 1NFWA 1XUJA 1VJAU 1GBEA 2ODYB 1DANH 3ZRTA 3QO6A 5T1VA 1Q3OA 1S83A 4AFQA 4OS7A 1E37B 2DB5A 1BBRH 3TU7H 2ZKSA 4Y7BA 1OWHA 1V5LA 2MX6A 3PRDA 5JB8S 4K76A 5EZ0A 1YCPM 1C1OA 3UPEA 1FY4A 1GL1A 1YM0A 1K1OA 3WWBA 1O2OA 2JH6D 3ESTA 1VB7A 5G1DA 4O3TA 2IN2A 3A89A 1HIAA 2KYLA 3DIWA 1KXDA 3SU4A 1ZZZA 1RRKA 4FUBA 3E16B 1O3HA 3KN2A 5GJ4B 3SZNA 1GBKA 4KTSA 1Q3XA 1GJ7B 1EFRD 1LPKB 4B73A 1GI9B 2D2DA 1FZZA 1GG6B 1O35A 3E90B 4ISLA 1BRCE 4Q7ZA 5FPSA 3UOPA 1O5BB 1SQOA 3MO9A 4B2AA 1G3BA 2P94A 2VNTA 4ZH8A 4NZLA 3A80A 2NU2E 3NZIA 2LA8A 4AX9H 1OS8A 1PPHE 5EU8A 3QGJA 1EP6A 2IPHA 1QURH 4Z33A 2BHGA 2BY8X 1HLTH 5GNDA 3MH5A 4VGCB 5JBTA 3SUFA 2G5VA 1SOZA 4JYTA 1E36B 2SFAA 3NRLA 1AD8H 1UEZA 3HK3B 3TNTA 2Q9VA 5DP6A 3RP2A 1Z87A 1GBLA 2FN5A 2XWAA 1UVTH 3ZVBA 3QGLA 1CHGA 3LPRA 1WG6A 2JIKA 2ZU4A 2V35A 4X1SU 1XVMA 2BXUH 3UIRA 5F67A 1O3LA 1O38A 1P06A 1QGFA 4CRFA 4NMRA 5GLJA 2XRCA 3M36A 1YPHC 1SGIB 1LHCH 4NMQA 1OBYA 3FP8E 2ZA5A 2O2TA 1MTNB 3GYMA 3WWFA 1CBWC 1A0HB 2THFB 1ZRBA 3TK9A 2BYAX 3RXFA 4CBOA 1T7CA 3KQ5A 5DG6A 4NMVA 5CHAB 3BTWE 1EB2A 4E34A 1HRTH 2JIZD 4ZXYH 5J4QA 3RXDA 5EQSA 2H2BA 4YZUA 1PQ8A 2D8IA 5FPTA 4FOUC 1SSXA 3PV5A 4ESTE 3QN7A 1AFEH 3HPTB 4NGAH 1OKXA 1U38A 4JJ3A 2QIQA 5HDYA 1WQSA 3F2GA 4OS4A 1UJ1A 1ETRH 1LKBA 2ZHEH 2EGKA 2PKSC 5CHBA 4ASHA 2FOGA 4MDSA 2R0KA 1LPZB 1RTKA 1TRMA 4UFEH 3I1EA 2F91A 2GP9B 3A8DA 1UM1A 3A81A 4AFUA 1TNIA 1GMDG 1QQUA 2LUIA 1AWHB 1BB0B 1PQ7A 3KHFA 1XKBC 2BDAA 1L4ZA 1UF1A 2BD2A 2R2MB 1SGEE 1CT0E 5KECA 1GJBB 3FY5A 2BVRH 4X1NU 2VWNA 2F9BH 1QLCA 4Y8YA 1FN6A 1TMUH 2V7QD 1FIZA 2AS9A 1C5PA 1ZGVA 1NROH 1O3FA 1P9SA 1GMHG 1RS0A 3EGKH 1RJXB 3DSGA 2ZCLP 5HJ1A 1Z6EA 1EAIA 1AMHA 3NPSA 3MH6A 4NIVA 5IK2D 1EPTC 2FI5E 4CRAA 4P02A 5IL9A 1W9EA 1GMDF 2AGIX 3D62A 3F0OA 1Z8RA 4DT7B 2K8IA 2PHBA 4K5ZA 3K1RA 1P05A 1ANEA 1TQ0B 1NT1A 3RMOH 1QA0A 3LNXA 4UFDH 3EYDA 4GVUA 2BD5A 4JZDH 2YTWA 2Y82A 1KXBA 2OQUA 1E34B 2LPRA 1WTHD 3VB6A 2PP6A 1WSSH 3DSPA 4LOYH 3O8CA 2GZVA 1O2QA 1JRSA 1YCPK 1C1PA 1C1MA 3EE0B 1W8BH 1HXEH 1W0YH 2JKHA 2AWWA 4NMOA 4DCDA 1NFXA 1A61H 2WINI 1NTPA 1SVPA 4WXIA 1T8LA 2V3OH 2J4IA 1RFNA 2ESTE 3KYFA 2VVCA 2FXRA 2ZGXH 3AAUA 3ODDA 2HGAA 6ESTA 1GHBG 2YNAA 4TYDA 3E91A 3R0FA 3KZDA 5GDSH 1O36A 5DSFA 4KELA 2BVSH 2C8XB 1FX0B 2GCTC 2BDBA 2F9OA 1IHSH 2GZ7A 3MH4A 1P3EA 3P8FA 1AZZA 1C5ZB 1Y5AT 2FYRA 2EDVA 1UEQA 4LK4A 3M61U 2TGPZ 2QE7D 1LHFH 2CSSA 4FUFA 3SHWA 2ZQ1A 1QRXA 4YT6H 1O5CB 1XUHA 2VIOA 4Q2KA 1WOFA 4AB8A 1WUNH 1MTWA 4ZHAA 1OXGA 4X2WA 4K2YA 1SKYE 1I16A 1UVOA 1BBRK 2QGRA 4LZ4B 1ID5H 2ANWA 2Z3EA 1QJ1B 2CHAB 1QB6A 4BXSA 3EDXB 1FPHH 5E22A 5E11A 4BXWA 1E38B 1TBZH 1TMBH 1UCYH 2KJDA 4X6PA 1BRBE 1F0UA 3M7TA 4N6XA 1KXFA 3SNDA 2ZZUH 2O9QA 1QAVB 3TJVA 2I0LA 1CU1A 1W10U 2B0FA 1KWAA 1O3KA 1QL9A 5C0UA 3ID4A 2AGGX 1O30A 3VXFH 5C1UA 2CJIA 2BZAA 3RXAA 1VKYA 4AGKA 5JBCS 5JDUB 2G5MB 3GY8A 2LOBA 3VB7A 2EEHA 2EXGA 1EZQA 2QKVA 2ZDLA 1FAKH 1QRZA 2ZGCA 1BDAA 1WCZA 1QQ4A 4H6TA 3RXMA 1W11U 5ESBA 4GVCA 3RXLA 1T4VH 3D23A 2WPJS 1MQ6A 4QT8C 4CRGA 1NFUA 1O2UA 4RKOB 1GBCA 4Z6AH 2HWLB 2I0IA 1TA6A 2AERH 3TPIZ 1RGRA 4AYVB 3RMLH 3QTOH 2ZG0H 1Y3VA 3LJJA 4ZHMU 1XUIA 2STAE 5AFZH 4X6MA 2BD7A 2SGQE 1WBGB 2G4TA 3MMGA 2AGEX 3B76A 4YXWD 3LONA 1GI8B 1J17T 1VA8A 3MHWU 3VGCC 1GI1A 1N8OC 2WV5A 2C90B 3F9EA 5EQRA 2CF8H 2QV1A 5C2ZA 3BTME 5E2OA 1RIWB 2QF5A 4AN7A 4YLUA 4JOHA 3S9BA 2V1WA 1A3EH 4FLNA 5EODA 1N99A 4WVPE 2HOBA 2JETB 3DA9B 1IQNA 4F55A 2F9UA 1XXDA 3BTFE 2WSSD 1TGBA 4JZFH 3JXTA 2HPQH 1M5ZA 5HETA 1TPOA 2ILNA 2OC8A 4GSOA 1NRSH 2QG1A 2PKAB 2Z9JA 1GBTA 4IS5A 2M10A 2IOTA 4BTUB 3MNXA 2ZCKP 3DJ3A 1LHEH 1MMJN 1UHPA 3SJ8A 1G3DA 1O2RA 1PYTD 3ID3A 1GL0E 2HLCA 4CRCA 3DT0H 1NN6A 1TNJA 1UTJA 4Z8JA 1PPGE 2PUQH 1UTQA 2EEJA 2ZECA 4BAHB 2EA3A 5HGGA 2QXHA 3PS4A 1OWDA 2BLQA 2HNTE 3W94A 4MLFB 4A1TA 3PM3A 4OGYA 3ZZ5A 2F5YA 1ANBA 1GG6C 1SB1H 2EJYA 1HB0B 3VEQB 1ZMJA 3CBZA 1FY1A 3E8LA 1AB9B 1FLEE 5C67A 4K60A 1SG8B 4I8LA 3BTQE 4A1XA 1BT7A 2EDPA 4DT4A 3HPMA 1ETTH 1BE9A 1S82A 1EB1H 4VGCC 1VITG 4B74A 1YLNA 1O2GH 3SNAA 3MWIU 5G4BA 3M5NA 2H5DA 2EY4C 3QGNB 3RLEA 1QIXB 2CXVA 5GWZA 2ZFQH 3KIDU 4K8BA 5T6FA 3FVFB 3KDGA 3C27B 1IQKA 3IG6B 1K28D 4X0WU 1MTUA 4AFSA 1KSNA 1GWAA 4YO9A 4DURA 1ZPCA 4KKDA 2K1ZA 2STBE 2ZU2A 4I31A 4YLQH 2W6ID 1N6XA 1CSOE 4NSVA 1C1SA 4L8NA 2CF9H 2KRGA 1NF3C 1SLWB 3FANA 1KXCA 1MTNC 1NFYA 1HAVA 3U1IB 2ZFTA 2ODPA 1YLCA 1G3CA 2PWXA 5A8ZA 2GEFA 1C5MD 5B6OA 1QB9A 1J16A 1VITF 3MI4A 5CHAC 4IBLH 1CQQA 1GCTB 1ZHRA 1NBME 1AVWA 1HDTH 2IJOB 3BF6H 1MU8B 1HJ8A 3P6ZB 3L4FD 3F0PA 4UFFH 1CGJE 3QE1A 1GJDB 2KCOA 5HIYA 1LCYA 1Z6JH 1UTKA 1TPAE 1MC7A 1TGNA 1C4Y2 2FLRH 4I7YH 2W4FA 1P09A 4PROA 3RXCA 2RFKC 2ZPRA 4JMYA 4TPIZ 3GY7A 3RLYH 2Z6BD 3ZYEA 1KDQB 1WIFA 2ZFSA 1Z8JB 2WYJA 4FUIA 2PKUA 2Z9LA 2Q1JA 1DT2A 3SU3A 3T2NA 1AFQB 1BHXB 1ESAA 1HV7A 3BG4B 4NSYA 2TGDA 1ELBA 3NCLA 4YESB 3LU9B 1CA8B 1CVWH 2WZQA 3VQGA 4XHVA 1C5QA 4B6EA 4XBCA 1ZOMA 1HBTH 1L0ZA 3I4WA 2OP9A 2ZI2H 1UCYK 3MU1A 1ZSJA 4ZCNA 1MFLA 3ZZ4A 2GV6A 1VJ6A 2DUCA 4OAJA 4Q4LA 1KXAA 3BEFB 1TOMH 3TH3H 1TBRH 1AKSB 5EXNA 1HUTH 2KM0A 3RXOA 5T6GA 4XE4A 1MD8A 3K50A 5FAHA 1IOEA 5E6PB 4UEHH 1JOUB 3HGPA 1HXFH 1WHAA 3SGAE 2GDDA 1YGCH 2EGNA 1L1NA 3HPKA 3RXJA 1VR1H 4Q7YA 1BTHH 2EHRA 1OPHB 1DY9A 2ODQA 4Q2PA 3EAJA 5T3HA 4H42U 3SORA 1OSSA 1T8OA 1EPTA 1Q2WA 1UVSH 2VIVA 1TP5A 1H4WA 2NU1E 3SQHE 1ELAA 4YT7H 2XNDD 1KY9A 4NMPA 2BYGA 4HGCA 1N6FA 3KYGA 1CT2E 1RXPA 1C2DA 1VZQH 3OFND 5TCAA 1B0EA 2G81E 3PLKA 7KMEH 3H5CB 2VIDA 1F0TA 3KZEA 2QXGA 1V2UT 4DOQA 4FU9A 1QFKH 1S0RA 4BANB 2E7KA 3BIUH 1GJ5H 2A4OA 2I6QA 2XC5A 4F49A 4BAOB 1CA0C 4JOKA 2H9HA 4U2WA 1O5EH 5E0HA 1V2WT 1W2KH 1MCVA 1XX9A 3A8AA 5SGAE 3AW0A 1DE7H 3DHKH 1KIGH 4UE7H 2J98B 2VWMA 2BZ6H 1VJ9U 2XC0A 1RGWA 1JXPA 3QK1A 2CHAC 5AVDA 2ZEBA 1GGDB 1F92A 1OP0A 5ILBA 2XNIA 3E0NB 8KME2 4ZHLU 1GDNA 3RXQA 1P03A 2OPGA 4YOJA 1LPGB 1D4PB 1SGNE 2KJKA 4ZKNU 2RG3A 3TSWA 3EA8A 2RA0A 1Y8TA 4Q7XA 2D1JA 1OBXA 2FOHA 3GCTF 2NU0E 2DAZA 4U30A 5EJLA 4YTAA 1GI2A 1QR3E 3OTPA 3OE7D 3WY8A 4E7RG 1X5QA 1O3NA 1X6DA 2BQ7B 1Y3WA 2BMGB 1TGCA 4Q80A 4U32A 4WYUA 4X1RU 4Y0ZE 4TWWA 4ISOA 1P57B 1A1RA 1YCPH 1FC7A 3HGNA 2UWPA 3LGUA 4B6FA 4NIXA 1AZ8A 1H8HD 1W9QA 2OZFA 1MUEB 1SGFA 4O06A 4X8SH 2JH0D 4CH8B 1AIXH 1WU1A 3BEIB 3M3VA 3QX5H 4D76A 3MU5A 4A5TS 1MKWH 2ZQ2A 1TE0A 2V90A 2WPDD 1ZJDA 4H6SB 4BAMB 4K75A 2HE4A 3TGIE 1SGPE 1V2JT 4IW4E 5EXMA 2IWNA 1ZOKA 4NMTA 3M37A 4K78A 1GI0A 2KR7A 1LKAA 1IHJA 4ZKOU 2JETC 4AG1A 1BCUH 1KLIH 2BD3A 1OP8A 2D90A 2G8TA 1TONA 1GHAF 4HG6A 2AMDA 5FB8C 3SUGA 3TIUA 4P00A 1O2YA 1P2IA 8ESTE 1V5QA
chains in the Genus database with same CATH topology
2BOHB 3SV2H 3GY2A 1GBDA 1HIAB 2ULLA 4X1QU 4JOJA 1TFXA 1AN1E 1FNIA 4NG9H 2ZDMA 2I04A 1A7SA 3PLBA 2XCFA 4ABEA 4MPUA 1MBMA 3U8RH 1DWCH 4HFPB 2RCZA 1OWJA 1YPLH 1HPGA 2W7UA 1J14A 3H7TA 4HOPA 4KFVA 3UQOA 1QTFA 2VH0A 4MNXA 1O2NA 2ZU3A 3S69A 2VVUA 3ATKA 3GDVA 3K6ZA 1AB9C 1LHGH 1X45A 1TBQH 4ABFA 4NFEA 3SV7A 1ZMNA 1H9LB 2DMZA 3LC5A 4EDJA 2JSNA 4K6YA 4NA9H 1WF8A 3IITA 2RRMA 3NFKA 5D13A 1V2RT 1ZGIA 1FONA 2KAWA 1C1VH 1GJ6A 2AYWA 2GMTB 3BSQA 3OTJE 1EQ9A 3BTGE 3W95A 1TRYA 1SL3A 1VAEA 2ZHQH 2WPLS 1Q3PA 2AIPA 1FC6A 3MH7A 4GLYA 2ALVA 3V0XA 1BQYA 1V2PT 1AUJA 1UEPA 1YPHE 3P8NA 3UFAA 1FXYA 4WF8A 3PROA 3MOCA 1O2SA 4IMQA 1GBIA 2F9VA 4THNH 5AFYH 4F8KA 3UWJH 2FOCA 2FCFA 3KQCA 5PTPA 4PQWA 1TLDA 1S6FA 1V6DA 1Y59T 2ZTXA 3LGWA 5FHTA 1RGQA 2VPHA 2A2XH 3SQEE 4MPXA 2ZWLH 1IAUA 2ZDKA 4KFWA 5DP4A 2GD4B 1GCTC 2OGPA 2BY9X 4B71A 4M7GA 3S9CA 2FPZA 1F5RA 3ELAH 1UMAH 1HYLA 4E06H 1HFDA 3MO3A 4K69A 4B2BA 5JBAS 4JOGA 1P02A 2AEIH 2R3UA 2ZPSA 2H2CA 3FAOA 1BOQA 2AWUA 1EP5A 3A7YA 1MZDA 1IQGA 1BITA 1JBUH 2YNBA 3NK8A 7ESTE 3WKLA 2PLXA 3I29A 2ZNKH 1ZRKA 2CS5A 1X9ZA 2FODA 3SV8A 2BDHA 2A5AA 1THPB 5DKMA 3GY5A 4X2XA 1AFQC 1GDUA 3BG4C 1EZXC 1PYTC 1YP9A 3SN8A 1FIWA 3FFGA 2OCVB 2F3CE 3U9AH 1GQ4A 1ESBA 3QZRA 2KA9A 3PTBA 1QL7A 2OD3B 1EKBB 2GGVB 2F0AA 2FWWA 3TNSA 2KPKA 1K2I1 1VGCB 2IWQA 4DY7B 5F3XA 4I8HA 3C1KA 3SU2A 1C5TA 3PMJA 2EV8A 4D9RA 3QZQA 4GCHG 2KJPA 1XVOA 1TB6H 1O3CA 1GJAB 5IDKA 1WH1A 4XBDA 2DE9A 4R2ZA 1TNLA 3KQDA 1BTYA 2M0ZA 1EASA 2H1UA 1YPMH 9ESTA 2QAAA 3P8OA 4AORA 2Q6GA 3UNSA 1ABJH 1GMHF 2WUBA 1ZR0A 2O8UA 2J2UA 3T26A 2ASUB 1DY8A 2QXIA 2VIQA 1L4DA 4FVDA 3RC6A 3VXEH 4E05H 1CE5A 3NCVA 4B2CA 2KPLA 1YC0A 3TH2H 7GCHG 3D49H 3MU4A 1SFIA 4FUEA 3N7OA 1G9OA 1FY5A 3RXUA 2FX4A 2GDEH 2G2LA 1HJAB 1MKWK 2BY7X 3HK6B 1OYTH 2UWLA 3PDVA 1C1NA 1JIMA 1XXFA 3ZZAA 1TNHA 4DGJA 3ZZCA 3GCNA 5FX5A 1TALA 3K82A 4JL7A 3RU4E 4Q3HA 2WPKS 4F4OC 3QLPH 1HAXB 1B8QA 2OQ5A 1LQEA 2OS6A 3UWIA 1P2MA 2GZ8A 2FTLE 1YPGH 3I18A 4FUCA 2REYA 4OS2A 4A1VA 1N6EA 4JJ0A 3A88A 1V2QT 1WI2A 2JREA 4JORA 7GCHF 1O3PB 1Y5UT 1FUJA 1O5AB 2IWOA 1GHBF 1EOLA 3H7OA 1X8SA 1FI8A 1EAXA