1D5GA

Solution structure of the pdz2 domain from human phosphatase hptp1e complexed with a peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN PHOSPHATASE HPTP1E
publication title Solution Structure of the PDZ2 Domain from Cytosolic Human Phosphatase hPTP1E Complexed with a Peptide Reveals Contribution of the beta2-beta3 Loop to PDZ Domain-Ligand Interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 13
structure length 96
sequence length 96
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1d5gA00
4AMHA 2EDPA 3K50A 2OMJA 2EGOA 2HGAA 3QGLA 5H3JA 3I18A 3CYYA 2OS6A 4UU6A 3CH8A 1UJUA 2YUYA 4OEOA 3TSWA 2YTWA 1QAVB 1N6FA 1K32A 2MHOA 1WJLA 4KFVA 1OBXA 2GZVA 4NXQA 2OSGA 5G1DA 3WKLA 2OQSA 2PNTA 2QG1A 2L97A 1GQ4A 1LCYA 1GM1A 2AWWA 4NXPA 3HVQC 3DORA 1W9QA 1VAEA 1G9OA 3WKMA 1UEZA 2H3LA 2L4SA 4UU5A 1V5LA 3NFKA 1NTEA 3TSZA 5FHTA 2EEHA 1UJDA 3QE1A 1P1DA 1GQ5A 3ID4A 3EGHC 1TP5A 2QKVA 3SHWA 2I0IA 4L8NA 3E17A 4GVDA 3TSVA 2AINA 4N6XA 5E1YA 2EAQA 2DC2A 3STJA 1Y7NA 3PV5A 1VJ6A 2PA1A 1U39A 4MPAA 1Q7XA 1R6JA 4GVCA 2G2LA 4H11A 5D13A 2F0AA 4NMQA 4P0CA 2Z17A 1Y8TA 2X7ZA 4Z33A 1I92A 4E34A 4K6YA 3PV4A 2DAZA 2KJPA 2FCFA 1V6BA 3LNXA 1I16A 1U37A 1N7EA 4NNMA 5HETA 2VWRA 5HFCA 1NF3C 2PKTA 2I0LA 3GDVA 3GJ9A 2KJDA 2V1WA 1WG6A 1UFXA 1UHPA 1XZ9A 2K20A 1X8SA 2ZPLA 2H2BA 2PZDA 5HEDA 3MH7A 2VSVA 2EHRA 1MFLA 1WHDA 3RL7A 3K1RA 1RGRA 4E35A 1U38A 4Q2NA 1UF1A 3DIWA 1ZOKA 1WF8A 3GSLA 2EJYA 2DMZA 1UM1A 2DLSA 2PDZA 3O5NA 3PDZA 3DJ1A 2EV8A 5EYZA 3I1EA 2I4SA 2KAWA 2W4FA 4GHNA 4Q2OA 5HJ1A 1WHAA 1VB7A 1TQ3A 1BE9A 2D92A 2DB5A 2RCZA 2KOJA 3CBYA 2M0VA 2QT5A 5HFEA 5E11A 1UITA 4YDPA 1RY4A 2OPGA 2WL7A 1KWAA 5HFFA 2JXOA 4NMSA 2FNEA 1OBYA 3HPMA 2KL1A 2KQFA 5HFBA 2JIKA 1M5ZA 2KRGA 1ZUBA 1RGWA 2CSJA 2FE5A 1X6DA 2M0TA 5HEBA 4K75A 2Z9IA 1WIFA 2CS5A 4HOPB 4JL7A 5B6LA 2YT7A 4HOPA 1W9OA 1X5NA 2CSSA 1BFEA 4JOFA 3SFJA 1WH1A 2Q3GA 3CBZA 1VCWA 1N99A 2IWPA 2REYA 3CS0A 1PDRA 2I1NA 2M3MA 2DM8A 1IHJA 3R69A 2QKUA 5HEYA 4YYXA 3KZEA 2D8IA 4XHVA 2EGNA 2EGKA 2K1ZA 2O2TA 1V62A 4JOPA 1MC7A 3VQFA 3ZRTA 2KG2A 1OBZA 2H3MA 1V1TA 2EEIA 4Q6HA 3EGGC 3GGEA 3TMHA 1UM7A 1UJVA 3KHFA 1N7TA 1SOTA 2D90A 2KYLA 5EZ0A 4EDJA 4Q3HA 1UEWA 3OU0A 5HF4A 3BPUA 2FN5A 1V5QA 3DJ3A 4F8KA 3GDUA 3RL8A 2JOAA 1X5RA 4OEPA 2V90A 1N7FA 1UEPA 1P1EA 1WI4A 2OGPA 1YBOA 2JINA 1RZXA 5I7ZA 3QO6A 2KPKA 2DJTA 2L4TA 2BYGA 2IWQA 2ZPMA 2OCSA 3JXTA 3LNYA 4WYUA 5F67A 1TP3A 4PQWA 4E3BA 1X5QA 4JOJA 2G5MB 1Q3OA 3PDVA 1L6OA 4NMTA 2E7KA 1X45A 3R68A 1VA8A 2UZCA 2I04A 4K72A 2KPLA 3ID1A 3O46A 3QJMA 3OTPA 1SOZA 5E22A 3ID2A 2R4HA 3CBXA 4P2AB 2AWUA 3CC0A 2Q9VA 2EEJA 2VZ5A 4RI0A 3FY5A 3GCOA 3NFLA 2LC6A 2JWEA 2VPHA 4LMMA 3RLEA 1UEQA 4O06A 3MH4A 5A2PA 4JOGA 1Z86A 5FB8C 4JOHA 1N6DA 3AXAA 2DLUA 1FCFA 2HE2A 5JXBA 2IWNA 2F5YA 5HFDA 3SHUA 2OZFA 3VQGA 2YT8A 3HPKA 1QAVA 2QKTA 4NMRA 4JOKA 1T2MA 4JOEA 3QDOA 4Q6SA 2EDZA 2VSPA 3L4FD 4K76A 5G1EA 3SUZA 1QLCA 4NNLA 5DTHA 3QIKA 3NGHA 3SOEA 1WFVA 4G69A 4JORA 4NMPA 3R0HA 1IU2A 2M0UA 2HE4A 3PV2A 1FC6A 5GLJA 5HDYA 1WI2A 1WFGA 4IC6A 1W9EA 2VRFA 3GDSA 2R3YA 4OAJA 4Q2PA 1U3BA 1MFGA 1N6EA 2KA9A 1KEFA 2QBWA 4Z8JA 5F3XA 2LUIA 2YUBA 5E6PB 2M10A 2EXGA 5GNDA 2I6VA 4REYA 3B76A 4K78A 5HF1A 2PKUA 4R2ZA 2DKRA 4NXRA 2JILA 1KY9A 1B8QA 1TE0A 2KBSA 3I4WA 2EEGA 2LOBA 1OZIA 1QAUA 1Q3PA 3KZDA 4Q2QA 2IWOA 2AWXA 4KFWA 1FC9A 2JREA 2KV8A 2KOHA 2KJKA 1D5GA 3PS4A 4FGMA 4WYTA 2RRMA 3ID3A 2LA8A 4NMOA 3MH6A 1IU0A 5E21A 1Z87A 2W7RA 1WF7A 2MX6A 1FC7A 2H2CA 3DJAA 4NMVA 3QJNA 2P3WA 2KOMA 3K82A 3GCNA 2LC7A 2M0ZA 2EDVA 2ENOA
chains in the Genus database with same CATH superfamily
4AMHA 2EDPA 3K50A 2OMJA 2EGOA 2HGAA 3QGLA 5H3JA 3KDKA 3I18A 3CYYA 2OS6A 4UU6A 3CH8A 1UJUA 2YUYA 4OEOA 3TSWA 2YTWA 1QAVB 1N6FA 1K32A 2MHOA 1WJLA 4KFVA 1OBXA 2GZVA 4NXQA 2OSGA 5G1DA 3WKLA 2OQSA 2PNTA 2QG1A 2L97A 1GQ4A 1LCYA 5B42A 1GM1A 2AWWA 4NXPA 3HVQC 3DORA 1W9QA 1VAEA 1G9OA 3WKMA 1UEZA 2H3LA 2L4SA 4UU5A 1V5LA 3NFKA 1NTEA 3TSZA 5FHTA 2EEHA 1UJDA 3QE1A 1P1DA 1GQ5A 3ID4A 3EGHC 5IL9A 1TP5A 2QKVA 3SHWA 3NCVA 2I0IA 4L8NA 3E17A 4GVDA 3TSVA 2AINA 4N6XA 5E1YA 2EAQA 2DC2A 3STJA 1Y7NA 3PV5A 1VJ6A 2PA1A 1U39A 4MPAA 1Q7XA 1R6JA 4GVCA 2G2LA 4H11A 5D13A 2F0AA 4NMQA 4P0CA 3GABA 2Z17A 1Y8TA 2X7ZA 4Z33A 1I92A 4E34A 4K6YA 3PV4A 2DAZA 2KJPA 2FCFA 1V6BA 3LNXA 1I16A 1U37A 1N7EA 4NNMA 5HETA 2VWRA 5HFCA 1NF3C 2PKTA 2I0LA 3GDVA 3GJ9A 2KJDA 2V1WA 1WG6A 1UFXA 1UHPA 1XZ9A 2K20A 1X8SA 2ZPLA 2H2BA 2PZDA 5HEDA 3MH7A 2VSVA 2EHRA 1MFLA 1WHDA 3RL7A 3K1RA 4FLNA 1RGRA 4E35A 1U38A 4Q2NA 1UF1A 3DIWA 1ZOKA 1WF8A 3GSLA 2EJYA 2DMZA 1UM1A 2DLSA 2PDZA 3O5NA 3PDZA 3DJ1A 2EV8A 5EYZA 3I1EA 2I4SA 2KAWA 2W4FA 4GHNA 4Q2OA 2GEFA 5HJ1A 1WHAA 1VB7A 1TQ3A 1BE9A 2D92A 2DB5A 2JSNA 2RCZA 2KOJA 3CBYA 3KDGA 2M0VA 2QT5A 5HFEA 5E11A 1UITA 4YDPA 1RY4A 2OPGA 2WL7A 1KWAA 5HFFA 2JXOA 4NMSA 2FNEA 1OBYA 3HPMA 2KL1A 2KQFA 5HFBA 2JIKA 1M5ZA 2KRGA 1ZUBA 1RGWA 2CSJA 2FE5A 1X6DA 2M0TA 5HEBA 4K75A 2Z9IA 1WIFA 2CS5A 4HOPB 4JL7A 5B6LA 2YT7A 4HOPA 1W9OA 1X5NA 2CSSA 1BFEA 4JOFA 3SFJA 1WH1A 2Q3GA 3CBZA 1VCWA 1N99A 2IWPA 2REYA 3CS0A 1PDRA 2I1NA 2M3MA 2DM8A 1IHJA 3R69A 2QKUA 5HEYA 4YYXA 3KZEA 2D8IA 4XHVA 2EGNA 2EGKA 2K1ZA 2O2TA 1V62A 4JOPA 1MC7A 3VQFA 3ZRTA 2KG2A 1OBZA 2H3MA 1V1TA 2EEIA 4Q6HA 3EGGC 3GGEA 3TMHA 1UM7A 1UJVA 3KHFA 1N7TA 1SOTA 2D90A 2KYLA 5EZ0A 4EDJA 4Q3HA 1UEWA 3OU0A 5HF4A 3BPUA 2FN5A 1V5QA 3DJ3A 4F8KA 3GDUA 3RL8A 2JOAA 1X5RA 4OEPA 2V90A 1N7FA 1UEPA 1P1EA 1WI4A 2OGPA 1YBOA 2JINA 1RZXA 5I7ZA 3QO6A 2KPKA 2DJTA 2L4TA 2BYGA 2IWQA 2ZPMA 2OCSA 3JXTA 3LNYA 4WYUA 5F67A 1TP3A 4PQWA 4E3BA 1X5QA 4JOJA 2G5MB 1Q3OA 3PDVA 1L6OA 4NMTA 2E7KA 1X45A 3R68A 1VA8A 2UZCA 2I04A 4K72A 2KPLA 3ID1A 3O46A 3QJMA 3OTPA 1SOZA 5E22A 3ID2A 2R4HA 3CBXA 4P2AB 2AWUA 3CC0A 2Q9VA 2EEJA 2VZ5A 4RI0A 3FY5A 3GCOA 3NFLA 2LC6A 2JWEA 2VPHA 4LMMA 3RLEA 1UEQA 1X9ZA 4O06A 3MH4A 5A2PA 4JOGA 1Z86A 5FB8C 4JOHA 1N6DA 3AXAA 2DLUA 1FCFA 2HE2A 5JXBA 2IWNA 2F5YA 5HFDA 3SHUA 2OZFA 3VQGA 2YT8A 3HPKA 1QAVA 2QKTA 4NMRA 4JOKA 1T2MA 4JOEA 3QDOA 4Q6SA 2EDZA 2VSPA 3L4FD 4K76A 5G1EA 3SUZA 4JJ0A 1QLCA 4NNLA 5DTHA 3QIKA 3NGHA 3SOEA 1WFVA 4G69A 4JORA 4NMPA 3R0HA 1IU2A 2M0UA 2HE4A 3PV2A 1FC6A 5GLJA 5HDYA 1WI2A 1WFGA 4IC6A 1W9EA 2VRFA 3GDSA 2R3YA 4OAJA 4Q2PA 1U3BA 1MFGA 1N6EA 2KA9A 1KEFA 2QBWA 4Z8JA 5F3XA 2LUIA 2YUBA 5E6PB 2M10A 2EXGA 5GNDA 2I6VA 4REYA 3B76A 4K78A 5HF1A 2PKUA 4JJ3A 4R2ZA 2DKRA 5ILBA 4NXRA 2JILA 1KY9A 1B8QA 1TE0A 2KBSA 3I4WA 2EEGA 2LOBA 1OZIA 1QAUA 1Q3PA 3KZDA 4Q2QA 2IWOA 2AWXA 4KFWA 1FC9A 2JREA 2KV8A 2KOHA 2KJKA 1D5GA 3PS4A 4FGMA 4WYTA 2RRMA 3ID3A 2LA8A 4NMOA 3MH6A 1IU0A 5E21A 1Z87A 2W7RA 1WF7A 2MX6A 1FC7A 2H2CA 3DJAA 4NMVA 3QJNA 2P3WA 2KOMA 3K82A 3GCNA 2LC7A 2M0ZA 2EDVA 2ENOA
chains in the Genus database with same CATH topology
4AMHA 2EDPA 3K50A 2OMJA 2EGOA 2HGAA 3QGLA 5H3JA 3KDKA 3I18A 3CYYA 2OS6A 4UU6A 3CH8A 1UJUA 2YUYA 4OEOA 3TSWA 2YTWA 1QAVB 1N6FA 1K32A 2MHOA 1WJLA 4KFVA 1OBXA 2GZVA 4NXQA 2OSGA 5G1DA 3WKLA 2OQSA 2PNTA 2QG1A 2L97A 1GQ4A 1LCYA 5B42A 1GM1A 2AWWA 4NXPA 3HVQC 3DORA 1W9QA 1VAEA 1G9OA 3WKMA 1UEZA 2H3LA 2L4SA 4UU5A 1V5LA 3NFKA 1NTEA 3TSZA 5FHTA 2EEHA 1UJDA 3QE1A 1P1DA 1GQ5A 3ID4A 3EGHC 5IL9A 1TP5A 2QKVA 3SHWA 3NCVA 2I0IA 4L8NA 3E17A 4GVDA 3TSVA 2AINA 4N6XA 5E1YA 2EAQA 2DC2A 3STJA 1Y7NA 3PV5A 1VJ6A 2PA1A 1U39A 4MPAA 1Q7XA 1R6JA 4GVCA 2G2LA 4H11A 5D13A 2F0AA 4NMQA 4P0CA 3GABA 2Z17A 1Y8TA 2X7ZA 4Z33A 1I92A 4E34A 4K6YA 3PV4A 2DAZA 2KJPA 2FCFA 1V6BA 3LNXA 1I16A 1U37A 1N7EA 4NNMA 5HETA 2VWRA 5HFCA 1NF3C 2PKTA 2I0LA 3GDVA 3GJ9A 2KJDA 2V1WA 1WG6A 1UFXA 1UHPA 1XZ9A 2K20A 1X8SA 2ZPLA 2H2BA 2PZDA 5HEDA 3MH7A 2VSVA 2EHRA 1MFLA 1WHDA 3RL7A 3K1RA 4FLNA 1RGRA 4E35A 1U38A 4Q2NA 1UF1A 3DIWA 1ZOKA 1WF8A 3GSLA 2EJYA 2DMZA 1UM1A 2DLSA 2PDZA 3O5NA 3PDZA 3DJ1A 2EV8A 5EYZA 3I1EA 2I4SA 2KAWA 2W4FA 4GHNA 4Q2OA 2GEFA 5HJ1A 1WHAA 1VB7A 1TQ3A 1BE9A 2D92A 2DB5A 2JSNA 2RCZA 2KOJA 3CBYA 3KDGA 2M0VA 2QT5A 5HFEA 5E11A 1UITA 4YDPA 1RY4A 2OPGA 2WL7A 1KWAA 5HFFA 2JXOA 4NMSA 2FNEA 1OBYA 3HPMA 2KL1A 2KQFA 5HFBA 2JIKA 1M5ZA 2KRGA 1ZUBA 1RGWA 2CSJA 2FE5A 1X6DA 2M0TA 5HEBA 4K75A 2Z9IA 1WIFA 2CS5A 4HOPB 4JL7A 5B6LA 2YT7A 4HOPA 1W9OA 1X5NA 2CSSA 1BFEA 4JOFA 3SFJA 1WH1A 2Q3GA 3CBZA 1VCWA 1N99A 2IWPA 2REYA 3CS0A 1PDRA 2I1NA 2M3MA 2DM8A 1IHJA 3R69A 2QKUA 5HEYA 4YYXA 3KZEA 2D8IA 4XHVA 2EGNA 2EGKA 2K1ZA 2O2TA 1V62A 4JOPA 1MC7A 3VQFA 3ZRTA 2KG2A 1OBZA 2H3MA 1V1TA 2EEIA 4Q6HA 3EGGC 3GGEA 3TMHA 1UM7A 1UJVA 3KHFA 1N7TA 1SOTA 2D90A 2KYLA 5EZ0A 4EDJA 4Q3HA 1UEWA 3OU0A 5HF4A 3BPUA 2FN5A 1V5QA 3DJ3A 4F8KA 3GDUA 3RL8A 2JOAA 1X5RA 4OEPA 2V90A 1N7FA 1UEPA 1P1EA 1WI4A 2OGPA 1YBOA 2JINA 1RZXA 5I7ZA 3QO6A 2KPKA 2DJTA 2L4TA 2BYGA 2IWQA 2ZPMA 2OCSA 3JXTA 3LNYA 4WYUA 5F67A 1TP3A 4PQWA 4E3BA 1X5QA 4JOJA 2G5MB 1Q3OA 3PDVA 1L6OA 4NMTA 2E7KA 1X45A 3R68A 1VA8A 2UZCA 2I04A 4K72A 2KPLA 3ID1A 3O46A 3QJMA 3OTPA 1SOZA 5E22A 3ID2A 2R4HA 3CBXA 4P2AB 2AWUA 3CC0A 2Q9VA 2EEJA 2VZ5A 4RI0A 3FY5A 3GCOA 3NFLA 2LC6A 2JWEA 2VPHA 4LMMA 3RLEA 1UEQA 1X9ZA 4O06A 3MH4A 5A2PA 4JOGA 1Z86A 5FB8C 4JOHA 1N6DA 3AXAA 2DLUA 1FCFA 2HE2A 5JXBA 2IWNA 2F5YA 5HFDA 3SHUA 2OZFA 3VQGA 2YT8A 3HPKA 1QAVA 2QKTA 4NMRA 4JOKA 1T2MA 4JOEA 3QDOA 4Q6SA 2EDZA 2VSPA 3L4FD 4K76A 5G1EA 3SUZA 4JJ0A 1QLCA 4NNLA 5DTHA 3QIKA 3NGHA 3SOEA 1WFVA 4G69A 4JORA 4NMPA 3R0HA 1IU2A 2M0UA 2HE4A 3PV2A 1FC6A 5GLJA 5HDYA 1WI2A 1WFGA 4IC6A 1W9EA 2VRFA 3GDSA 2R3YA 4OAJA 4Q2PA 1U3BA 1MFGA 1N6EA 2KA9A 1KEFA 2QBWA 4Z8JA 5F3XA 2LUIA 2YUBA 5E6PB 2M10A 2EXGA 5GNDA 2I6VA 4REYA 3B76A 4K78A 5HF1A 2PKUA 4JJ3A 4R2ZA 2DKRA 5ILBA 4NXRA 2JILA 1KY9A 1B8QA 1TE0A 2KBSA 3I4WA 2EEGA 2LOBA 1OZIA 1QAUA 1Q3PA 3KZDA 4Q2QA 2IWOA 2AWXA 4KFWA 1FC9A 2JREA 2KV8A 2KOHA 2KJKA 1D5GA 3PS4A 4FGMA 4WYTA 2RRMA 3ID3A 2LA8A 4NMOA 3MH6A 1IU0A 5E21A 1Z87A 2W7RA 1WF7A 2MX6A 1FC7A 2H2CA 3DJAA 4NMVA 3QJNA 2P3WA 2KOMA 3K82A 3GCNA 2LC7A 2M0ZA 2EDVA 2ENOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AMH A;  2EDP A;  3K50 A;  2OMJ A;  2EGO A;  2HGA A;  3QGL A;  5H3J A;  3I18 A;  3CYY A;  2OS6 A;  4UU6 A;  3CH8 A;  1UJU A;  2YUY A;  4OEO A;  3TSW A;  2YTW A;  1QAV B;  1N6F A;  1K32 A;  2MHO A;  1WJL A;  4KFV A;  1OBX A;  2GZV A;  4NXQ A;  2OSG A;  5G1D A;  3WKL A;  2OQS A;  2PNT A;  2QG1 A;  2L97 A;  1GQ4 A;  1LCY A;  1GM1 A;  2AWW A;  4NXP A;  3HVQ C;  3DOR A;  1W9Q A;  1VAE A;  1G9O A;  3WKM A;  1UEZ A;  2H3L A;  2L4S A;  4UU5 A;  1V5L A;  3NFK A;  1NTE A;  3TSZ A;  5FHT A;  2EEH A;  1UJD A;  3QE1 A;  1P1D A;  1GQ5 A;  3ID4 A;  3EGH C;  1TP5 A;  2QKV A;  3SHW A;  2I0I A;  4L8N A;  3E17 A;  4GVD A;  3TSV A;  2AIN A;  4N6X A;  5E1Y A;  2EAQ A;  2DC2 A;  3STJ A;  1Y7N A;  3PV5 A;  1VJ6 A;  2PA1 A;  1U39 A;  4MPA A;  1Q7X A;  1R6J A;  4GVC A;  2G2L A;  4H11 A;  5D13 A;  2F0A A;  4NMQ A;  4P0C A;  2Z17 A;  1Y8T A;  2X7Z A;  4Z33 A;  1I92 A;  4E34 A;  4K6Y A;  3PV4 A;  2DAZ A;  2KJP A;  2FCF A;  1V6B A;  3LNX A;  1I16 A;  1U37 A;  1N7E A;  4NNM A;  5HET A;  2VWR A;  5HFC A;  1NF3 C;  2PKT A;  2I0L A;  3GDV A;  3GJ9 A;  2KJD A;  2V1W A;  1WG6 A;  1UFX A;  1UHP A;  1XZ9 A;  2K20 A;  1X8S A;  2ZPL A;  2H2B A;  2PZD A;  5HED A;  3MH7 A;  2VSV A;  2EHR A;  1MFL A;  1WHD A;  3RL7 A;  3K1R A;  1RGR A;  4E35 A;  1U38 A;  4Q2N A;  1UF1 A;  3DIW A;  1ZOK A;  1WF8 A;  3GSL A;  2EJY A;  2DMZ A;  1UM1 A;  2DLS A;  2PDZ A;  3O5N A;  3PDZ A;  3DJ1 A;  2EV8 A;  5EYZ A;  3I1E A;  2I4S A;  2KAW A;  2W4F A;  4GHN A;  4Q2O A;  5HJ1 A;  1WHA A;  1VB7 A;  1TQ3 A;  1BE9 A;  2D92 A;  2DB5 A;  2RCZ A;  2KOJ A;  3CBY A;  2M0V A;  2QT5 A;  5HFE A;  5E11 A;  1UIT A;  4YDP A;  1RY4 A;  2OPG A;  2WL7 A;  1KWA A;  5HFF A;  2JXO A;  4NMS A;  2FNE A;  1OBY A;  3HPM A;  2KL1 A;  2KQF A;  5HFB A;  2JIK A;  1M5Z A;  2KRG A;  1ZUB A;  1RGW A;  2CSJ A;  2FE5 A;  1X6D A;  2M0T A;  5HEB A;  4K75 A;  2Z9I A;  1WIF A;  2CS5 A;  4HOP B;  4JL7 A;  5B6L A;  2YT7 A;  4HOP A;  1W9O A;  1X5N A;  2CSS A;  1BFE A;  4JOF A;  3SFJ A;  1WH1 A;  2Q3G A;  3CBZ A;  1VCW A;  1N99 A;  2IWP A;  2REY A;  3CS0 A;  1PDR A;  2I1N A;  2M3M A;  2DM8 A;  1IHJ A;  3R69 A;  2QKU A;  5HEY A;  4YYX A;  3KZE A;  2D8I A;  4XHV A;  2EGN A;  2EGK A;  2K1Z A;  2O2T A;  1V62 A;  4JOP A;  1MC7 A;  3VQF A;  3ZRT A;  2KG2 A;  1OBZ A;  2H3M A;  1V1T A;  2EEI A;  4Q6H A;  3EGG C;  3GGE A;  3TMH A;  1UM7 A;  1UJV A;  3KHF A;  1N7T A;  1SOT A;  2D90 A;  2KYL A;  5EZ0 A;  4EDJ A;  4Q3H A;  1UEW A;  3OU0 A;  5HF4 A;  3BPU A;  2FN5 A;  1V5Q A;  3DJ3 A;  4F8K A;  3GDU A;  3RL8 A;  2JOA A;  1X5R A;  4OEP A;  2V90 A;  1N7F A;  1UEP A;  1P1E A;  1WI4 A;  2OGP A;  1YBO A;  2JIN A;  1RZX A;  5I7Z A;  3QO6 A;  2KPK A;  2DJT A;  2L4T A;  2BYG A;  2IWQ A;  2ZPM A;  2OCS A;  3JXT A;  3LNY A;  4WYU A;  5F67 A;  1TP3 A;  4PQW A;  4E3B A;  1X5Q A;  4JOJ A;  2G5M B;  1Q3O A;  3PDV A;  1L6O A;  4NMT A;  2E7K A;  1X45 A;  3R68 A;  1VA8 A;  2UZC A;  2I04 A;  4K72 A;  2KPL A;  3ID1 A;  3O46 A;  3QJM A;  3OTP A;  1SOZ A;  5E22 A;  3ID2 A;  2R4H A;  3CBX A;  4P2A B;  2AWU A;  3CC0 A;  2Q9V A;  2EEJ A;  2VZ5 A;  4RI0 A;  3FY5 A;  3GCO A;  3NFL A;  2LC6 A;  2JWE A;  2VPH A;  4LMM A;  3RLE A;  1UEQ A;  4O06 A;  3MH4 A;  5A2P A;  4JOG A;  1Z86 A;  5FB8 C;  4JOH A;  1N6D A;  3AXA A;  2DLU A;  1FCF A;  2HE2 A;  5JXB A;  2IWN A;  2F5Y A;  5HFD A;  3SHU A;  2OZF A;  3VQG A;  2YT8 A;  3HPK A;  1QAV A;  2QKT A;  4NMR A;  4JOK A;  1T2M A;  4JOE A;  3QDO A;  4Q6S A;  2EDZ A;  2VSP A;  3L4F D;  4K76 A;  5G1E A;  3SUZ A;  1QLC A;  4NNL A;  5DTH A;  3QIK A;  3NGH A;  3SOE A;  1WFV A;  4G69 A;  4JOR A;  4NMP A;  3R0H A;  1IU2 A;  2M0U A;  2HE4 A;  3PV2 A;  1FC6 A;  5GLJ A;  5HDY A;  1WI2 A;  1WFG A;  4IC6 A;  1W9E A;  2VRF A;  3GDS A;  2R3Y A;  4OAJ A;  4Q2P A;  1U3B A;  1MFG A;  1N6E A;  2KA9 A;  1KEF A;  2QBW A;  4Z8J A;  5F3X A;  2LUI A;  2YUB A;  5E6P B;  2M10 A;  2EXG A;  5GND A;  2I6V A;  4REY A;  3B76 A;  4K78 A;  5HF1 A;  2PKU A;  4R2Z A;  2DKR A;  4NXR A;  2JIL A;  1KY9 A;  1B8Q A;  1TE0 A;  2KBS A;  3I4W A;  2EEG A;  2LOB A;  1OZI A;  1QAU A;  1Q3P A;  3KZD A;  4Q2Q A;  2IWO A;  2AWX A;  4KFW A;  1FC9 A;  2JRE A;  2KV8 A;  2KOH A;  2KJK A;  1D5G A;  3PS4 A;  4FGM A;  4WYT A;  2RRM A;  3ID3 A;  2LA8 A;  4NMO A;  3MH6 A;  1IU0 A;  5E21 A;  1Z87 A;  2W7R A;  1WF7 A;  2MX6 A;  1FC7 A;  2H2C A;  3DJA A;  4NMV A;  3QJN A;  2P3W A;  2KOM A;  3K82 A;  3GCN A;  2LC7 A;  2M0Z A;  2EDV A;  2ENO A; 
#chains in the Genus database with same CATH topology
 4AMH A;  2EDP A;  3K50 A;  2OMJ A;  2EGO A;  2HGA A;  3QGL A;  5H3J A;  3KDK A;  3I18 A;  3CYY A;  2OS6 A;  4UU6 A;  3CH8 A;  1UJU A;  2YUY A;  4OEO A;  3TSW A;  2YTW A;  1QAV B;  1N6F A;  1K32 A;  2MHO A;  1WJL A;  4KFV A;  1OBX A;  2GZV A;  4NXQ A;  2OSG A;  5G1D A;  3WKL A;  2OQS A;  2PNT A;  2QG1 A;  2L97 A;  1GQ4 A;  1LCY A;  5B42 A;  1GM1 A;  2AWW A;  4NXP A;  3HVQ C;  3DOR A;  1W9Q A;  1VAE A;  1G9O A;  3WKM A;  1UEZ A;  2H3L A;  2L4S A;  4UU5 A;  1V5L A;  3NFK A;  1NTE A;  3TSZ A;  5FHT A;  2EEH A;  1UJD A;  3QE1 A;  1P1D A;  1GQ5 A;  3ID4 A;  3EGH C;  5IL9 A;  1TP5 A;  2QKV A;  3SHW A;  3NCV A;  2I0I A;  4L8N A;  3E17 A;  4GVD A;  3TSV A;  2AIN A;  4N6X A;  5E1Y A;  2EAQ A;  2DC2 A;  3STJ A;  1Y7N A;  3PV5 A;  1VJ6 A;  2PA1 A;  1U39 A;  4MPA A;  1Q7X A;  1R6J A;  4GVC A;  2G2L A;  4H11 A;  5D13 A;  2F0A A;  4NMQ A;  4P0C A;  3GAB A;  2Z17 A;  1Y8T A;  2X7Z A;  4Z33 A;  1I92 A;  4E34 A;  4K6Y A;  3PV4 A;  2DAZ A;  2KJP A;  2FCF A;  1V6B A;  3LNX A;  1I16 A;  1U37 A;  1N7E A;  4NNM A;  5HET A;  2VWR A;  5HFC A;  1NF3 C;  2PKT A;  2I0L A;  3GDV A;  3GJ9 A;  2KJD A;  2V1W A;  1WG6 A;  1UFX A;  1UHP A;  1XZ9 A;  2K20 A;  1X8S A;  2ZPL A;  2H2B A;  2PZD A;  5HED A;  3MH7 A;  2VSV A;  2EHR A;  1MFL A;  1WHD A;  3RL7 A;  3K1R A;  4FLN A;  1RGR A;  4E35 A;  1U38 A;  4Q2N A;  1UF1 A;  3DIW A;  1ZOK A;  1WF8 A;  3GSL A;  2EJY A;  2DMZ A;  1UM1 A;  2DLS A;  2PDZ A;  3O5N A;  3PDZ A;  3DJ1 A;  2EV8 A;  5EYZ A;  3I1E A;  2I4S A;  2KAW A;  2W4F A;  4GHN A;  4Q2O A;  2GEF A;  5HJ1 A;  1WHA A;  1VB7 A;  1TQ3 A;  1BE9 A;  2D92 A;  2DB5 A;  2JSN A;  2RCZ A;  2KOJ A;  3CBY A;  3KDG A;  2M0V A;  2QT5 A;  5HFE A;  5E11 A;  1UIT A;  4YDP A;  1RY4 A;  2OPG A;  2WL7 A;  1KWA A;  5HFF A;  2JXO A;  4NMS A;  2FNE A;  1OBY A;  3HPM A;  2KL1 A;  2KQF A;  5HFB A;  2JIK A;  1M5Z A;  2KRG A;  1ZUB A;  1RGW A;  2CSJ A;  2FE5 A;  1X6D A;  2M0T A;  5HEB A;  4K75 A;  2Z9I A;  1WIF A;  2CS5 A;  4HOP B;  4JL7 A;  5B6L A;  2YT7 A;  4HOP A;  1W9O A;  1X5N A;  2CSS A;  1BFE A;  4JOF A;  3SFJ A;  1WH1 A;  2Q3G A;  3CBZ A;  1VCW A;  1N99 A;  2IWP A;  2REY A;  3CS0 A;  1PDR A;  2I1N A;  2M3M A;  2DM8 A;  1IHJ A;  3R69 A;  2QKU A;  5HEY A;  4YYX A;  3KZE A;  2D8I A;  4XHV A;  2EGN A;  2EGK A;  2K1Z A;  2O2T A;  1V62 A;  4JOP A;  1MC7 A;  3VQF A;  3ZRT A;  2KG2 A;  1OBZ A;  2H3M A;  1V1T A;  2EEI A;  4Q6H A;  3EGG C;  3GGE A;  3TMH A;  1UM7 A;  1UJV A;  3KHF A;  1N7T A;  1SOT A;  2D90 A;  2KYL A;  5EZ0 A;  4EDJ A;  4Q3H A;  1UEW A;  3OU0 A;  5HF4 A;  3BPU A;  2FN5 A;  1V5Q A;  3DJ3 A;  4F8K A;  3GDU A;  3RL8 A;  2JOA A;  1X5R A;  4OEP A;  2V90 A;  1N7F A;  1UEP A;  1P1E A;  1WI4 A;  2OGP A;  1YBO A;  2JIN A;  1RZX A;  5I7Z A;  3QO6 A;  2KPK A;  2DJT A;  2L4T A;  2BYG A;  2IWQ A;  2ZPM A;  2OCS A;  3JXT A;  3LNY A;  4WYU A;  5F67 A;  1TP3 A;  4PQW A;  4E3B A;  1X5Q A;  4JOJ A;  2G5M B;  1Q3O A;  3PDV A;  1L6O A;  4NMT A;  2E7K A;  1X45 A;  3R68 A;  1VA8 A;  2UZC A;  2I04 A;  4K72 A;  2KPL A;  3ID1 A;  3O46 A;  3QJM A;  3OTP A;  1SOZ A;  5E22 A;  3ID2 A;  2R4H A;  3CBX A;  4P2A B;  2AWU A;  3CC0 A;  2Q9V A;  2EEJ A;  2VZ5 A;  4RI0 A;  3FY5 A;  3GCO A;  3NFL A;  2LC6 A;  2JWE A;  2VPH A;  4LMM A;  3RLE A;  1UEQ A;  1X9Z A;  4O06 A;  3MH4 A;  5A2P A;  4JOG A;  1Z86 A;  5FB8 C;  4JOH A;  1N6D A;  3AXA A;  2DLU A;  1FCF A;  2HE2 A;  5JXB A;  2IWN A;  2F5Y A;  5HFD A;  3SHU A;  2OZF A;  3VQG A;  2YT8 A;  3HPK A;  1QAV A;  2QKT A;  4NMR A;  4JOK A;  1T2M A;  4JOE A;  3QDO A;  4Q6S A;  2EDZ A;  2VSP A;  3L4F D;  4K76 A;  5G1E A;  3SUZ A;  4JJ0 A;  1QLC A;  4NNL A;  5DTH A;  3QIK A;  3NGH A;  3SOE A;  1WFV A;  4G69 A;  4JOR A;  4NMP A;  3R0H A;  1IU2 A;  2M0U A;  2HE4 A;  3PV2 A;  1FC6 A;  5GLJ A;  5HDY A;  1WI2 A;  1WFG A;  4IC6 A;  1W9E A;  2VRF A;  3GDS A;  2R3Y A;  4OAJ A;  4Q2P A;  1U3B A;  1MFG A;  1N6E A;  2KA9 A;  1KEF A;  2QBW A;  4Z8J A;  5F3X A;  2LUI A;  2YUB A;  5E6P B;  2M10 A;  2EXG A;  5GND A;  2I6V A;  4REY A;  3B76 A;  4K78 A;  5HF1 A;  2PKU A;  4JJ3 A;  4R2Z A;  2DKR A;  5ILB A;  4NXR A;  2JIL A;  1KY9 A;  1B8Q A;  1TE0 A;  2KBS A;  3I4W A;  2EEG A;  2LOB A;  1OZI A;  1QAU A;  1Q3P A;  3KZD A;  4Q2Q A;  2IWO A;  2AWX A;  4KFW A;  1FC9 A;  2JRE A;  2KV8 A;  2KOH A;  2KJK A;  1D5G A;  3PS4 A;  4FGM A;  4WYT A;  2RRM A;  3ID3 A;  2LA8 A;  4NMO A;  3MH6 A;  1IU0 A;  5E21 A;  1Z87 A;  2W7R A;  1WF7 A;  2MX6 A;  1FC7 A;  2H2C A;  3DJA A;  4NMV A;  3QJN A;  2P3W A;  2KOM A;  3K82 A;  3GCN A;  2LC7 A;  2M0Z A;  2EDV A;  2ENO A; 
#chains in the Genus database with same CATH homology
 4AMH A;  2EDP A;  3K50 A;  2OMJ A;  2EGO A;  2HGA A;  3QGL A;  5H3J A;  3KDK A;  3I18 A;  3CYY A;  2OS6 A;  4UU6 A;  3CH8 A;  1UJU A;  2YUY A;  4OEO A;  3TSW A;  2YTW A;  1QAV B;  1N6F A;  1K32 A;  2MHO A;  1WJL A;  4KFV A;  1OBX A;  2GZV A;  4NXQ A;  2OSG A;  5G1D A;  3WKL A;  2OQS A;  2PNT A;  2QG1 A;  2L97 A;  1GQ4 A;  1LCY A;  5B42 A;  1GM1 A;  2AWW A;  4NXP A;  3HVQ C;  3DOR A;  1W9Q A;  1VAE A;  1G9O A;  3WKM A;  1UEZ A;  2H3L A;  2L4S A;  4UU5 A;  1V5L A;  3NFK A;  1NTE A;  3TSZ A;  5FHT A;  2EEH A;  1UJD A;  3QE1 A;  1P1D A;  1GQ5 A;  3ID4 A;  3EGH C;  5IL9 A;  1TP5 A;  2QKV A;  3SHW A;  3NCV A;  2I0I A;  4L8N A;  3E17 A;  4GVD A;  3TSV A;  2AIN A;  4N6X A;  5E1Y A;  2EAQ A;  2DC2 A;  3STJ A;  1Y7N A;  3PV5 A;  1VJ6 A;  2PA1 A;  1U39 A;  4MPA A;  1Q7X A;  1R6J A;  4GVC A;  2G2L A;  4H11 A;  5D13 A;  2F0A A;  4NMQ A;  4P0C A;  3GAB A;  2Z17 A;  1Y8T A;  2X7Z A;  4Z33 A;  1I92 A;  4E34 A;  4K6Y A;  3PV4 A;  2DAZ A;  2KJP A;  2FCF A;  1V6B A;  3LNX A;  1I16 A;  1U37 A;  1N7E A;  4NNM A;  5HET A;  2VWR A;  5HFC A;  1NF3 C;  2PKT A;  2I0L A;  3GDV A;  3GJ9 A;  2KJD A;  2V1W A;  1WG6 A;  1UFX A;  1UHP A;  1XZ9 A;  2K20 A;  1X8S A;  2ZPL A;  2H2B A;  2PZD A;  5HED A;  3MH7 A;  2VSV A;  2EHR A;  1MFL A;  1WHD A;  3RL7 A;  3K1R A;  4FLN A;  1RGR A;  4E35 A;  1U38 A;  4Q2N A;  1UF1 A;  3DIW A;  1ZOK A;  1WF8 A;  3GSL A;  2EJY A;  2DMZ A;  1UM1 A;  2DLS A;  2PDZ A;  3O5N A;  3PDZ A;  3DJ1 A;  2EV8 A;  5EYZ A;  3I1E A;  2I4S A;  2KAW A;  2W4F A;  4GHN A;  4Q2O A;  2GEF A;  5HJ1 A;  1WHA A;  1VB7 A;  1TQ3 A;  1BE9 A;  2D92 A;  2DB5 A;  2JSN A;  2RCZ A;  2KOJ A;  3CBY A;  3KDG A;  2M0V A;  2QT5 A;  5HFE A;  5E11 A;  1UIT A;  4YDP A;  1RY4 A;  2OPG A;  2WL7 A;  1KWA A;  5HFF A;  2JXO A;  4NMS A;  2FNE A;  1OBY A;  3HPM A;  2KL1 A;  2KQF A;  5HFB A;  2JIK A;  1M5Z A;  2KRG A;  1ZUB A;  1RGW A;  2CSJ A;  2FE5 A;  1X6D A;  2M0T A;  5HEB A;  4K75 A;  2Z9I A;  1WIF A;  2CS5 A;  4HOP B;  4JL7 A;  5B6L A;  2YT7 A;  4HOP A;  1W9O A;  1X5N A;  2CSS A;  1BFE A;  4JOF A;  3SFJ A;  1WH1 A;  2Q3G A;  3CBZ A;  1VCW A;  1N99 A;  2IWP A;  2REY A;  3CS0 A;  1PDR A;  2I1N A;  2M3M A;  2DM8 A;  1IHJ A;  3R69 A;  2QKU A;  5HEY A;  4YYX A;  3KZE A;  2D8I A;  4XHV A;  2EGN A;  2EGK A;  2K1Z A;  2O2T A;  1V62 A;  4JOP A;  1MC7 A;  3VQF A;  3ZRT A;  2KG2 A;  1OBZ A;  2H3M A;  1V1T A;  2EEI A;  4Q6H A;  3EGG C;  3GGE A;  3TMH A;  1UM7 A;  1UJV A;  3KHF A;  1N7T A;  1SOT A;  2D90 A;  2KYL A;  5EZ0 A;  4EDJ A;  4Q3H A;  1UEW A;  3OU0 A;  5HF4 A;  3BPU A;  2FN5 A;  1V5Q A;  3DJ3 A;  4F8K A;  3GDU A;  3RL8 A;  2JOA A;  1X5R A;  4OEP A;  2V90 A;  1N7F A;  1UEP A;  1P1E A;  1WI4 A;  2OGP A;  1YBO A;  2JIN A;  1RZX A;  5I7Z A;  3QO6 A;  2KPK A;  2DJT A;  2L4T A;  2BYG A;  2IWQ A;  2ZPM A;  2OCS A;  3JXT A;  3LNY A;  4WYU A;  5F67 A;  1TP3 A;  4PQW A;  4E3B A;  1X5Q A;  4JOJ A;  2G5M B;  1Q3O A;  3PDV A;  1L6O A;  4NMT A;  2E7K A;  1X45 A;  3R68 A;  1VA8 A;  2UZC A;  2I04 A;  4K72 A;  2KPL A;  3ID1 A;  3O46 A;  3QJM A;  3OTP A;  1SOZ A;  5E22 A;  3ID2 A;  2R4H A;  3CBX A;  4P2A B;  2AWU A;  3CC0 A;  2Q9V A;  2EEJ A;  2VZ5 A;  4RI0 A;  3FY5 A;  3GCO A;  3NFL A;  2LC6 A;  2JWE A;  2VPH A;  4LMM A;  3RLE A;  1UEQ A;  1X9Z A;  4O06 A;  3MH4 A;  5A2P A;  4JOG A;  1Z86 A;  5FB8 C;  4JOH A;  1N6D A;  3AXA A;  2DLU A;  1FCF A;  2HE2 A;  5JXB A;  2IWN A;  2F5Y A;  5HFD A;  3SHU A;  2OZF A;  3VQG A;  2YT8 A;  3HPK A;  1QAV A;  2QKT A;  4NMR A;  4JOK A;  1T2M A;  4JOE A;  3QDO A;  4Q6S A;  2EDZ A;  2VSP A;  3L4F D;  4K76 A;  5G1E A;  3SUZ A;  4JJ0 A;  1QLC A;  4NNL A;  5DTH A;  3QIK A;  3NGH A;  3SOE A;  1WFV A;  4G69 A;  4JOR A;  4NMP A;  3R0H A;  1IU2 A;  2M0U A;  2HE4 A;  3PV2 A;  1FC6 A;  5GLJ A;  5HDY A;  1WI2 A;  1WFG A;  4IC6 A;  1W9E A;  2VRF A;  3GDS A;  2R3Y A;  4OAJ A;  4Q2P A;  1U3B A;  1MFG A;  1N6E A;  2KA9 A;  1KEF A;  2QBW A;  4Z8J A;  5F3X A;  2LUI A;  2YUB A;  5E6P B;  2M10 A;  2EXG A;  5GND A;  2I6V A;  4REY A;  3B76 A;  4K78 A;  5HF1 A;  2PKU A;  4JJ3 A;  4R2Z A;  2DKR A;  5ILB A;  4NXR A;  2JIL A;  1KY9 A;  1B8Q A;  1TE0 A;  2KBS A;  3I4W A;  2EEG A;  2LOB A;  1OZI A;  1QAU A;  1Q3P A;  3KZD A;  4Q2Q A;  2IWO A;  2AWX A;  4KFW A;  1FC9 A;  2JRE A;  2KV8 A;  2KOH A;  2KJK A;  1D5G A;  3PS4 A;  4FGM A;  4WYT A;  2RRM A;  3ID3 A;  2LA8 A;  4NMO A;  3MH6 A;  1IU0 A;  5E21 A;  1Z87 A;  2W7R A;  1WF7 A;  2MX6 A;  1FC7 A;  2H2C A;  3DJA A;  4NMV A;  3QJN A;  2P3W A;  2KOM A;  3K82 A;  3GCN A;  2LC7 A;  2M0Z A;  2EDV A;  2ENO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...